WD repeat-containing protein 93

Overview
NameWD repeat-containing protein 93
Smed IDSMED30004899
Length (bp)2039
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat-containing protein 93 (SMED30004899) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat-containing protein 93 (SMED30004899) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat-containing protein 93 (SMED30004899) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat-containing protein 93 (SMED30004899) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004899

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30004899h1SMcG0002273 SmedASXL_016640SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30004899h1SMcG0002273 dd_Smed_v4_12161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004899h1SMcG0002273 dd_Smed_v4_12161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30004899h1SMcG0002273 dd_Smed_v6_12161_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30004899h1SMcG0002273 dd_Smed_v4_12161_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat-containing protein 93 vs. Ensembl Human
Match: WDR93 (WD repeat domain 93 [Source:HGNC Symbol;Acc:HGNC:26924])

HSP 1 Score: 98.2117 bits (243), Expect = 1.229e-20
Identity = 123/600 (20.50%), Postives = 250/600 (41.67%), Query Frame = 1
Query:   52 KQDFSIPNDFDPDFSNNE---NFLKDPEMFFDRLPQPFHFINKILNRILNDAFDIIDENFKFKTLESNKLQIQEIKPFSIFEDFGPIQ------CIXXXXXXXXXXXXGLKNGLAVIDIVGNKLIDKWENEEMDILSISYERLCQNISILSTIDSNGTGGLVGLINNRLYSLKSFPGSKDGDKPCQITSVCLDKNIGYVAVCYDQFKDSEQWLEVHKINREIWIKELKAVGKNLHEYSAAQSDNKMAEPDQGS---------DESSSILDRNGLRVTGTNIIFKFKYQDSLGSIGTNNFSQIFKQL-DPSGQLIGIGLNHCMTSEFVDKLMSSYQMDYPNFLDFHIENDLNLMRIANVRFSEVSGQLIKDVGALQKSESS---VMFVWWSQSQHLLIFGLNKTNLKASETFSKPDSVRSFSSWIVTCELSSNNHYLAVGLQNGIFILLDILSGIT-RITQQVSTVALKSIYFLNF------QRCVSENQTK-ENEAYLSVIDADNQMFCLQYVSQTLSKDSNCVMISNEPGAD------SVSRLSRNSNITLSIYDGTIIILQDIVTGKKILKFQLPEYMTAVSPWQPICALSSRTGHLC 1743
            K    +P   + D+  ++   + L DP+   D LPQP+  INK++N + + +++II+E    +  ES+++Q       +++   G IQ      C+     +++Y+ +G   G ++ ++   K I  WE  ++D+ SI    L   I +++ +D  G   L       LY +K+     D  K  Q T + ++ + G     +      + WL+V+K+ +E W+K+L+      H    +    K+ +P   S         +  +++  +  ++++    I K K    +      +  ++F ++ D  G  +G G NH +     ++    +   Y  +LD   E +     ++   F  +    +  +    K  S    V+ + W++S +  ++ LN+T LK     + P+ V   ++ I   +LS ++ YL +  ++G+  L D+  G    +         +SI+FL +      Q    E Q K + +  +   DA      L  V  + ++     ++   P         +V+ +     + L       + L D+   + I  F  P       PW+P+ A+S    H C
Sbjct:   20 KGPLEVPPPTEKDWPKDDEQDHVLVDPDEELDSLPQPYRMINKLVNLLFDQSWEIIEERNALREAESSQIQP------TVYPPLGEIQLNKMPNCM---AVSQDYVFIGGAKGFSIYNLYSAKQIYAWEKLKVDVTSIWATDLGNEI-LIAPVDEMGIIRLFYFYKEGLYLVKAINEVDDTSK--QTTCIKMEISQGGDFAAFLLQGAGDIWLDVYKLPKETWLKKLE------HPQLTSNPKKKVRQPQLNSLGPISADPLEMDANVSFKGDIKLSLPVYIMKIKPPKPVTGTTFKSPLEVFAKIKDCYG--LGSGQNHFIKDSQWEQQAEIFNASYKKYLDREWEEE----PLSTATFYFLLPSCLFAMPPEVKGPSGMACVLGIHWTRSHNFFLYSLNRT-LKDK---ADPEGVWPCAAPIAVSQLSCSSSYLVLACEDGVLTLWDLAKGFPLGVAALPQGCFCQSIHFLKYFSVHKGQNMYPEGQVKSQMKCVVLCTDAS-----LHLVEASGTQGPTISVLVERPVKHLDKTICAVAPVPALPGMVLIFSKNGSVCLMDVAKREIICAFAPPGAFPLEVPWKPVFAVSP--DHPC 584          
BLAST of WD repeat-containing protein 93 vs. Ensembl Human
Match: WDR93 (WD repeat domain 93 [Source:HGNC Symbol;Acc:HGNC:26924])

HSP 1 Score: 90.5077 bits (223), Expect = 3.538e-18
Identity = 119/593 (20.07%), Postives = 242/593 (40.81%), Query Frame = 1
Query:   52 KQDFSIPNDFDPDFSNNE---NFLKDPEMFFDRLPQPFHFINKILNRILNDAFDIIDENFKFKTLESNKLQIQEIKPFSIFEDFGPIQ------CIXXXXXXXXXXXXGLKNGLAVIDIVGNKLIDKWENEEMDILSISYERLCQNISILSTIDSNGTGGLVGLINNRLYSLKSFPGSKDGDKPCQITSVCLDKNIGYVAVCYDQFKDSEQWLEVHKINREIWIKELKAVGKNLHEYSAAQSDNKMAEPDQGS---------DESSSILDRNGLRVTGTNIIFKFKYQDSLGSIGTNNFSQIFKQL-DPSGQLIGIGLNHCMTSEFVDKLMSSYQMDYPNFLDFHIENDLNLMRIANVRFSEVSGQLIKDVGALQKSESS---VMFVWWSQSQHLLIFGLNKTNLKASETFSKPDSVRSFSSWIVTCELSSNNHYLAVGLQNGIFILLDILSGITRITQQVSTVALKSIYFLNFQRCVSENQTK-ENEAYLSVIDADNQMFCLQYVSQTLSKDSNCVMISNEPGAD------SVSRLSRNSNITLSIYDGTIIILQDIVTGKKILKFQLPEYMTAVSPWQPICALSSRTGHLC 1743
            K    +P   + D+  ++   + L DP+   D LPQP+  INK++N + + +++II+E    +  ES+++Q       +++   G IQ      C+     +++Y+ +G   G ++ ++   K I  WE  ++D+ SI    L   I +++ +D  G   L       LY +K+     D  K  Q T + ++ + G     +      + WL+V+K+ +E W+K+L+      H    +    K+ +P   S         +  +++  +  ++++    I K K    +      +  ++F ++ D  G  +G G NH +     ++    +   Y  +LD   E +     ++   F  +    +  +    K  S    V+ + W++S +  ++ LN+T LK     + P+ V   ++ I   +LS ++ YL +  ++G+  L D+  G                     Q    E Q K + +  +   DA      L  V  + ++     ++   P         +V+ +     + L       + L D+   + I  F  P       PW+P+ A+S    H C
Sbjct:   20 KGPLEVPPPTEKDWPKDDEQDHVLVDPDEELDSLPQPYRMINKLVNLLFDQSWEIIEERNALREAESSQIQP------TVYPPLGEIQLNKMPNCM---AVSQDYVFIGGAKGFSIYNLYSAKQIYAWEKLKVDVTSIWATDLGNEI-LIAPVDEMGIIRLFYFYKEGLYLVKAINEVDDTSK--QTTCIKMEISQGGDFAAFLLQGAGDIWLDVYKLPKETWLKKLE------HPQLTSNPKKKVRQPQLNSLGPISADPLEMDANVSFKGDIKLSLPVYIMKIKPPKPVTGTTFKSPLEVFAKIKDCYG--LGSGQNHFIKDSQWEQQAEIFNASYKKYLDREWEEE----PLSTATFYFLLPSCLFAMPPEVKGPSGMACVLGIHWTRSHNFFLYSLNRT-LKDK---ADPEGVWPCAAPIAVSQLSCSSSYLVLACEDGVLTLWDLAKG---------------------QNMYPEGQVKSQMKCVVLCTDAS-----LHLVEASGTQGPTISVLVERPVKHLDKTICAVAPVPALPGMVLIFSKNGSVCLMDVAKREIICAFAPPGAFPLEVPWKPVFAVSP--DHPC 556          
BLAST of WD repeat-containing protein 93 vs. Ensembl Human
Match: WDR93 (WD repeat domain 93 [Source:HGNC Symbol;Acc:HGNC:26924])

HSP 1 Score: 52.373 bits (124), Expect = 3.811e-7
Identity = 39/157 (24.84%), Postives = 79/157 (50.32%), Query Frame = 1
Query:   52 KQDFSIPNDFDPDFSNNE---NFLKDPEMFFDRLPQPFHFINKILNRILNDAFDIIDENFKFKTLESNKLQIQEIKPFSIFEDFGPIQ------CIXXXXXXXXXXXXGLKNGLAVIDIVGNKLIDKWENEEMDILSISYERLCQNISILSTIDSNG 495
            K    +P   + D+  ++   + L DP+   D LPQP+  INK++N + + +++II+E    +  ES+++Q       +++   G IQ      C+     +++Y+ +G   G ++ ++   K I  WE  ++D+ SI    L   I +++ +D  G
Sbjct:   20 KGPLEVPPPTEKDWPKDDEQDHVLVDPDEELDSLPQPYRMINKLVNLLFDQSWEIIEERNALREAESSQIQP------TVYPPLGEIQLNKMPNCM---AVSQDYVFIGGAKGFSIYNLYSAKQIYAWEKLKVDVTSIWATDLGNEI-LIAPVDEMG 166          
BLAST of WD repeat-containing protein 93 vs. Ensembl Zebrafish
Match: wdr93 (WD repeat domain 93 [Source:ZFIN;Acc:ZDB-GENE-161017-52])

HSP 1 Score: 55.8398 bits (133), Expect = 1.520e-7
Identity = 67/338 (19.82%), Postives = 138/338 (40.83%), Query Frame = 1
Query:  349 GLKNGLAVIDIVGNKLIDKWENEEMDILSISYERLCQNISILSTIDSNGTGGLVGLINNRLYSLKSFPGSKDGDKPCQITSVCLDKNIGYVAVCYDQFKDSEQWLEVHKINREIWIKELKAVGKNLHEYSAAQSDNKMAEPDQGSDESSSILDRNGLRVTGTNIIFKFKYQDSLGSIGTNNFSQIFKQLDPSGQLIGIGLNHCMTSEFVDKLMSSYQMDYPNFLD----------FHIENDLNLMRIANVRFSEVSGQLIKDVGALQKSESSVMFVWWSQSQHLLIFGLNKTNLKASETFSKPDSVRSFSSWIVTCELSSNNHYLAVGLQNGIFILLD 1332
            G  +GL+VI       +  W++E ++I SIS   L     +L T+D  G   +        Y +K    + D ++        + ++  + A           WL++++  +E W+KEL+A               K A     + E+         +++   ++ K K  +        +  ++ ++ +  G +IG G NH ++S+  +    +++  Y  +++            + ++     + N  F  V G+    V A   + +SV   WW+ S++LL + L K   K  +   +PD +   S  I+   +SS   ++ +GL N +  + D
Sbjct:   99 GHTHGLSVISTSSLTCVKTWQDERVEITSISCASLGNVTHLLGTVDDMGIAQVFLHHKENTYLIKVINETDDINQRNICVKFEVSRSGAFGAAVM--MSHGSVWLDLYRFPQETWLKELEA---------------KQATQSPRATEA---------KLSPVVLLMKIKPPEIPAGTSLKSPFEVLQKTE-EGTMIGSGQNHLISSQQWESQDLAFRKMYAKYINTSSAGPPQQKVEVPSNCTCHFLFNEGFHSVPGE----VKAAGDTPTSVCL-WWNGSRNLLQYLLLKAP-KEKDNEPRPDVLWPNSQEILCSAVSSCTRFIVLGLDNQLVTIWD 403          
BLAST of WD repeat-containing protein 93 vs. Ensembl Xenopus
Match: drap1 (DR1-associated protein 1 (negative cofactor 2 alpha) [Source:Xenbase;Acc:XB-GENE-6083758])

HSP 1 Score: 65.855 bits (159), Expect = 5.449e-12
Identity = 45/160 (28.12%), Postives = 84/160 (52.50%), Query Frame = 1
Query:   31 MPIYLNSKQDFSIPNDFDPDFS---NNENFLKDPEMFFDRLPQPFHFINKILNRILNDAFDIIDENFKFKTLESNKLQIQEIKPFSIFEDFGPIQCIXXXXXXXXXXXXGLKNGLAVIDIVGNKLIDKWENEEMDILSISYERLCQNISILSTIDSNGTG 501
            MP+Y+  K    IP   + D++   + ++F+ DP+   D LPQPF  I+K++N ++  A +II+ N   +  +  + +I+   P +  +    + C+   +E+  YL VG  +GLAV +      I  WE  +++I S+S   +   + +L+ +D  G G
Sbjct:    1 MPVYIR-KGPLEIPPGSERDWALDHDEDSFITDPDQALDMLPQPFRMIDKVVNHLIYQALEIININEHRREADKLRKKIEVHPPVAEIQVSKRVNCL-AAVESGTYLFVGHSDGLAVYNFPDCSWICSWETAKIEICSLSICHVKNELYLLAAVDDMGNG 158          
BLAST of WD repeat-containing protein 93 vs. Ensembl Mouse
Match: Wdr93 (WD repeat domain 93 [Source:MGI Symbol;Acc:MGI:3646885])

HSP 1 Score: 107.457 bits (267), Expect = 1.247e-23
Identity = 137/621 (22.06%), Postives = 257/621 (41.38%), Query Frame = 1
Query:   34 PIYLNSKQDFSIPNDFDPDFSNNENFLKDPEMFFDRLPQPFHFINKILNRILNDAFDIIDENFKFKTLESNKLQIQEIKPFSIFEDFGPIQCIXXXXXXXXXXXX----GLKNGLAVIDIVGNKLIDKWENEEMDILSISYERLCQNISILSTIDSNGTGGLVGLINNRLYSLKSFPGSKDGDKPCQITSVCLDKNIGYVAVCYDQFKDSEQWLEVHKINREIWIKELKAVGKNLHEYSAAQSDNKMAEPDQGSDES----------------SSILDRNGLRVTGTNIIFKFKYQDSLGSIGTNNFSQIFKQLDPSGQLIGIGLNHCMTSEFVDKLMSSYQMDYPNFLDFHIENDLNLMRIANVRFSEVSGQLIKDVGALQKSESSVMFVWWSQSQHLLIFGLNKTNLKASETFSKPDSVRSFSSWIVTCELSSNNHYLAVGLQNGIFILLDILSG-ITRITQQVSTVALKSIYFLNFQRCVSENQTKENE-----AYLSVIDADNQMFCLQYVSQTLSKDSNCV----MISNEPGADSVSRLSRNSNITLSIYDGTIIILQDIVTGKKILKFQLPEYMTAVSPWQPICALSSRTGHLCIQVMANQREQPTDSEVLKQMT 1806
            P+ + S  +   P D + DF       KD +   D LPQP+  INK+++ + N +++II+E    + +E N      I P +I+     IQ                  GLK G ++ ++   K I   E  + D++SI    L  ++ I+  ID  G   L  L  + LY +K+     D  K      + + +N  + A  +    D   WLEV+K+ +EIW+KE++     L++   A+   +++ PD    ES                 +I  ++ L+++    + K K    +      +  ++F +++    L G G NH +     ++ M ++   Y   L+   E +   M   +  ++     +  DV +     + V+ + W+   +L  + LNKT    +E     ++V   ++ IV  ++SS + YLA+  ++G+ IL D+  G +  +         +SI+FL F   V E Q    +       + V+   +    L   S T    S  +    ++  E    +V+ +     + L       + L D+   + +  F  P       PW+P+ A+S    +  +   A+   Q T +E  K+ T
Sbjct:   21 PLEIPSPTEADWPKDDEKDF-----VFKDLDQELDSLPQPYRMINKLVDHLFNRSWEIIEERDSLREVEKN-----WIVP-AIYHPVAEIQLDKMPGGMAVSHDYLFIGGLK-GFSIYNLHNCKRIYVLEKFKADVISIWATDLGNDVLIVP-IDEMGIVRLFYLCKDSLYHIKAINEVDDSSKQSTCLKMEISQNGDFAAFLFQGAGDV--WLEVYKLPKEIWLKEMEHPQSTLNQKKKAK-QLQLSTPDSAVTESIETSSGPSVSSNSVQDLNISFKSDLKLSLPVFVMKIKPPKPIAGTTFKSPLEVFAKVEDYVGL-GSGQNHFIKDVQWEQHMETFYASYKKHLEGEWEEEPLSMATFHFFYTNSLTTMSMDVKS-SSGIACVLGIHWNGRHNLFFYSLNKTQKDKTEY----ENVWPCAAPIVMSQISSFSSYLALVCEDGVLILWDLAEGFLFGVVALPEGCFCQSIHFLRF-FLVHEGQNVYPDYPVKFEVMCVVLCTDASLHLVTASGTQGPTSKVLVGRPVMHMEEAICAVAPVPALPGMVLIFSRSQSVTLMDVAKAEVLCAFSAPTCHPQALPWKPLFAVSPHHPYFLLH-GAHPHGQTTSTEDPKKST 617          
BLAST of WD repeat-containing protein 93 vs. UniProt/SwissProt
Match: sp|Q402B2|WDR93_MOUSE (WD repeat-containing protein 93 OS=Mus musculus OX=10090 GN=Wdr93 PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 8.725e-23
Identity = 137/621 (22.06%), Postives = 257/621 (41.38%), Query Frame = 1
Query:   34 PIYLNSKQDFSIPNDFDPDFSNNENFLKDPEMFFDRLPQPFHFINKILNRILNDAFDIIDENFKFKTLESNKLQIQEIKPFSIFEDFGPIQCIXXXXXXXXXXXX----GLKNGLAVIDIVGNKLIDKWENEEMDILSISYERLCQNISILSTIDSNGTGGLVGLINNRLYSLKSFPGSKDGDKPCQITSVCLDKNIGYVAVCYDQFKDSEQWLEVHKINREIWIKELKAVGKNLHEYSAAQSDNKMAEPDQGSDES----------------SSILDRNGLRVTGTNIIFKFKYQDSLGSIGTNNFSQIFKQLDPSGQLIGIGLNHCMTSEFVDKLMSSYQMDYPNFLDFHIENDLNLMRIANVRFSEVSGQLIKDVGALQKSESSVMFVWWSQSQHLLIFGLNKTNLKASETFSKPDSVRSFSSWIVTCELSSNNHYLAVGLQNGIFILLDILSG-ITRITQQVSTVALKSIYFLNFQRCVSENQTKENE-----AYLSVIDADNQMFCLQYVSQTLSKDSNCV----MISNEPGADSVSRLSRNSNITLSIYDGTIIILQDIVTGKKILKFQLPEYMTAVSPWQPICALSSRTGHLCIQVMANQREQPTDSEVLKQMT 1806
            P+ + S  +   P D + DF       KD +   D LPQP+  INK+++ + N +++II+E    + +E N      I P +I+     IQ                  GLK G ++ ++   K I   E  + D++SI    L  ++ I+  ID  G   L  L  + LY +K+     D  K      + + +N  + A  +    D   WLEV+K+ +EIW+KE++     L++   A+   +++ PD    ES                 +I  ++ L+++    + K K    +      +  ++F +++    L G G NH +     ++ M ++   Y   L+   E +   M   +  ++     +  DV +     + V+ + W+   +L  + LNKT    +E     ++V   ++ IV  ++SS + YLA+  ++G+ IL D+  G +  +         +SI+FL F   V E Q    +       + V+   +    L   S T    S  +    ++  E    +V+ +     + L       + L D+   + +  F  P       PW+P+ A+S    +  +   A+   Q T +E  K+ T
Sbjct:   21 PLEIPSPTEADWPKDDEKDF-----VFKDLDQELDSLPQPYRMINKLVDHLFNRSWEIIEERDSLREVEKN-----WIVP-AIYHPVAEIQLDKMPGGMAVSHDYLFIGGLK-GFSIYNLHNCKRIYVLEKFKADVISIWATDLGNDVLIVP-IDEMGIVRLFYLCKDSLYHIKAINEVDDSSKQSTCLKMEISQNGDFAAFLFQGAGDV--WLEVYKLPKEIWLKEMEHPQSTLNQKKKAK-QLQLSTPDSAVTESIETSSGPSVSSNSVQDLNISFKSDLKLSLPVFVMKIKPPKPIAGTTFKSPLEVFAKVEDYVGL-GSGQNHFIKDVQWEQHMETFYASYKKHLEGEWEEEPLSMATFHFFYTNSLTTMSMDVKS-SSGIACVLGIHWNGRHNLFFYSLNKTQKDKTEY----ENVWPCAAPIVMSQISSFSSYLALVCEDGVLILWDLAEGFLFGVVALPEGCFCQSIHFLRF-FLVHEGQNVYPDYPVKFEVMCVVLCTDASLHLVTASGTQGPTSKVLVGRPVMHMEEAICAVAPVPALPGMVLIFSRSQSVTLMDVAKAEVLCAFSAPTCHPQALPWKPLFAVSPHHPYFLLH-GAHPHGQTTSTEDPKKST 617          
BLAST of WD repeat-containing protein 93 vs. UniProt/SwissProt
Match: sp|Q6P2C0|WDR93_HUMAN (WD repeat-containing protein 93 OS=Homo sapiens OX=9606 GN=WDR93 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 5.900e-20
Identity = 123/600 (20.50%), Postives = 250/600 (41.67%), Query Frame = 1
Query:   52 KQDFSIPNDFDPDFSNNE---NFLKDPEMFFDRLPQPFHFINKILNRILNDAFDIIDENFKFKTLESNKLQIQEIKPFSIFEDFGPIQ------CIXXXXXXXXXXXXGLKNGLAVIDIVGNKLIDKWENEEMDILSISYERLCQNISILSTIDSNGTGGLVGLINNRLYSLKSFPGSKDGDKPCQITSVCLDKNIGYVAVCYDQFKDSEQWLEVHKINREIWIKELKAVGKNLHEYSAAQSDNKMAEPDQGS---------DESSSILDRNGLRVTGTNIIFKFKYQDSLGSIGTNNFSQIFKQL-DPSGQLIGIGLNHCMTSEFVDKLMSSYQMDYPNFLDFHIENDLNLMRIANVRFSEVSGQLIKDVGALQKSESS---VMFVWWSQSQHLLIFGLNKTNLKASETFSKPDSVRSFSSWIVTCELSSNNHYLAVGLQNGIFILLDILSGIT-RITQQVSTVALKSIYFLNF------QRCVSENQTK-ENEAYLSVIDADNQMFCLQYVSQTLSKDSNCVMISNEPGAD------SVSRLSRNSNITLSIYDGTIIILQDIVTGKKILKFQLPEYMTAVSPWQPICALSSRTGHLC 1743
            K    +P   + D+  ++   + L DP+   D LPQP+  INK++N + + +++II+E    +  ES+++Q       +++   G IQ      C+     +++Y+ +G   G ++ ++   K I  WE  ++D+ SI    L   I +++ +D  G   L       LY +K+     D  K  Q T + ++ + G     +      + WL+V+K+ +E W+K+L+      H    +    K+ +P   S         +  +++  +  ++++    I K K    +      +  ++F ++ D  G  +G G NH +     ++    +   Y  +LD   E +     ++   F  +    +  +    K  S    V+ + W++S +  ++ LN+T LK     + P+ V   ++ I   +LS ++ YL +  ++G+  L D+  G    +         +SI+FL +      Q    E Q K + +  +   DA      L  V  + ++     ++   P         +V+ +     + L       + L D+   + I  F  P       PW+P+ A+S    H C
Sbjct:   20 KGPLEVPPPTEKDWPKDDEQDHVLVDPDEELDSLPQPYRMINKLVNLLFDQSWEIIEERNALREAESSQIQP------TVYPPLGEIQLNKMPNCM---AVSQDYVFIGGAKGFSIYNLYSAKQIYAWEKLKVDVTSIWATDLGNEI-LIAPVDEMGIIRLFYFYKEGLYLVKAINEVDDTSK--QTTCIKMEISQGGDFAAFLLQGAGDIWLDVYKLPKETWLKKLE------HPQLTSNPKKKVRQPQLNSLGPISADPLEMDANVSFKGDIKLSLPVYIMKIKPPKPVTGTTFKSPLEVFAKIKDCYG--LGSGQNHFIKDSQWEQQAEIFNASYKKYLDREWEEE----PLSTATFYFLLPSCLFAMPPEVKGPSGMACVLGIHWTRSHNFFLYSLNRT-LKDK---ADPEGVWPCAAPIAVSQLSCSSSYLVLACEDGVLTLWDLAKGFPLGVAALPQGCFCQSIHFLKYFSVHKGQNMYPEGQVKSQMKCVVLCTDAS-----LHLVEASGTQGPTISVLVERPVKHLDKTICAVAPVPALPGMVLIFSKNGSVCLMDVAKREIICAFAPPGAFPLEVPWKPVFAVSP--DHPC 584          
BLAST of WD repeat-containing protein 93 vs. TrEMBL
Match: K1PU98 (WD repeat-containing protein 93 OS=Crassostrea gigas OX=29159 GN=CGI_10013394 PE=4 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 3.026e-42
Identity = 132/594 (22.22%), Postives = 274/594 (46.13%), Query Frame = 1
Query:   31 MPIYLNSKQDFSIPNDFDPDFSNNENFLKDPEMFFDRLPQPFHFINKILNRILNDAFDIIDENFKFKTLESNKLQIQEIKPFSIFEDFGPIQCIXXXXXXXXXXXXGLKNGLAVIDIVGNKLIDKWENEEMDILSISYERLCQNISILSTIDSNGTGGLVGLINNRLYSLKSFPGSKDGDKPCQITSVCLDKNIGYVAVCYDQFKDSEQWLEVHKINREIWIKELKAVGKNLHEYS---------------AAQSDNKMAEPDQGSDESSSILDRNGLRVTGTNIIFKFKYQDSLGSIGTNNFSQIFKQLDPSGQLIGIGLNHCMTSEFVDKLMSSYQMDYPNFLDFHIENDLNLMRIANVRFSEVSGQLIKDVGALQKSE---SSVMFVWWSQSQHLLIFGLNKTNLKASETFS-KPDSVRSFSSWIVTCELSSNNHYLAVGLQNGIFILLDILSGITR-ITQQVSTVALKSIYFLNFQRC------VSENQTKENEAYLSVIDADNQMFCLQYVSQTLSKDSNCVMISNEPGAD---SVSRLSRNSNITLSIYDGTIIILQDIVTGKKILKFQLPEYMTAVSPWQPICALSS 1725
            MP+Y+    +F+ P+  +    ++E+++ DP+   DRLPQP+  I+K+L++  ++ + II++    +  ES +++  + +  +  E  G   C+ + ++     + G   GL+ +D+   + +  WE E +DI  +    +   + ++ TID  G   L+    ++ Y +K     ++G     I+     +N  Y+   ++  + +E WLEV+K+ R+ W+ EL++V     E S               A    N++  P   + E S+  +++  +++ T+++ K K   S+     ++     +++D SG++IG G+NH +T    D     +   + N +++ +  +     + +V F  ++   +   G  Q+S+    + + VWW  S H++ + L    LK  + F  KPD V  + S + +  +S +   LAVG +NG  I+ D   GI R I   +  V +  + FL+   C          +TK +   L++   DN    +      L  D  C+    E   D    V  +    ++ +++     + ++D + G  + +  LP+    ++PW P+ A+ +
Sbjct:    1 MPVYIRKNVNFTPPSIDNFPLEDDEDYITDPDQLLDRLPQPYRMIDKVLSQWYDEVWQIIEKRENERLEESRRIRAPQYECSAQMESQGRACCVCDSVDGRYIFI-GQPRGLSAVDVQTQEKVASWEEESVDIHYVKAYLIGVQVYLVVTIDDMGFARLLIFGGDKFYFVKILNEFQEGGTKLIISKCEASRNGDYLGAMFENPETAEVWLEVYKLPRDAWLNELESVLTKKEEKSEEDQGTDTQAPTDQEAPTPQNEVEPPPAATQEESTGGEKHTPKLSPTSVVMKLKPPPSMSGNPASSIHSACQKVD-SGEVIGTGVNHILTPNHKDMRKEVFAHLHDNLMEY-LPKEEEAEPLEDVNFHFMTAGRLVPTGLEQQSQIGLPTTIAVWWKGSTHVVHYSL----LKQHKDFDVKPDLVWPYLSPVTSSAISDDTSLLAVGFENGNIIIWDRYLGIQRGIVNIMDRVKIVQLTFLDPNICPQNLDDYQPYRTKTSTHLLAL--CDNGALYIMMSGPGLELDPICITPPVESEDDIFTMVQPIPGMHDLLITVLKSGKVQIRDTLQGTVLCEPVLPKSHELMTPWDPVVAVGA 585          
BLAST of WD repeat-containing protein 93 vs. TrEMBL
Match: A0A210QE22 (WD repeat-containing protein 93 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT14896 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.401e-41
Identity = 161/709 (22.71%), Postives = 317/709 (44.71%), Query Frame = 1
Query:   31 MPIYLNSKQDFSIPNDFDPDFSNNENFLKDPEMFFDRLPQPFHFINKILNRILNDAFDIIDENFKFKTLESNKLQIQEIKPFSIFEDFGPIQCIXXXXXXXXXXXXGLKNGLAVIDIVGNKLIDKWENEEMDILSISYERLCQNISILSTIDSNGTGGLVGLINNRLYSLKSFPGSKDGDKPCQ-ITSVCLDKNIG-YVAVCYDQFKDSEQWLEVHKINREIWIKEL------------KAVGKNLHEYSAA-QSDNKMAEPDQGSDES------SSILDRNGLRVTGTNIIFKFKYQDS-LGSIGTNNFSQIFKQLDPSGQLIGIGLNHCMTSEFVDKLMSSYQMDYPNFLDF--HIENDLNLMRIANVRFSEVSGQLIKDVGALQKSESSV--MFVWWSQSQHLLIFGLNKTNLKASETFSKPDSVRSFSSWIVTCELSSNNHYLAVGLQNGIFILLDILSGITRITQQVST-VALKSIYFLNFQRCVSENQT-----KENEAYLSVIDADNQMFCLQYVSQTLSKDSNCVMISNEPGAD-------SVSRLSRNSNITLSIYDGTIIILQDIVTGKKILKFQLPEYMTAVSPWQPICALSSRTGHLCIQVMANQREQP------------TDSEVLKQMTAVYKIELEVPNGDFI--ETTIVKEELELQEKHSFVTEKINSMLNFRYKYHEETQLELQESWSKLEE 1998
            MP+YL +  +F+ P+         +++++DPE   D LPQP+  ++K+LN++ +DA+ II++       ES + +  +       E  G    +     +   + VGL NG+AV+D V    I  WE ++++I+ +    + +N+ ++ ++D  G   L      RL+ LK    +++     + +   C     G Y+    +    +E WLE++++ R+ W++EL            K  GK + E      ++    + +Q + E+       S     G + +  ++I K K   +  G++ ++      +++D SG +IG G NH +TS  +++    ++ +Y + LD+    E  ++L+R  N  F   SG+L+ +         S   + VWW  S HL  + + K   K  E   KPD V  F+S I    +S++++ L +GL +G  ++ D   G+ R    ++T  A++ ++FL+   C  +         +  AYL V  +D  MF L      L  +  CV     P  D        V  +     +T+ +     I ++  + G  + + +LP     V+PW PI   + R   L ++  A + E+P             + + +  M  V+ ++   P  +F+  E T V   +     H+ + +++++++  R       +  +Q+ W  ++E
Sbjct:    1 MPVYLRNNVNFTPPSLDHIPVEQEDDYVQDPEQLKDHLPQPYRMLDKVLNKVFDDAWAIIEQRENAALEESLRFKPPQFDYEEQIEVLGGATSV-TCSSDGKVVFVGLPNGIAVLDSVTQNRICAWEEDKVEIIRLKTYPIAENMYLIISLDDMGLARLHAFAGERLFLLKLLNETQEEKSSTRLLIHKCEASAEGEYLGSLVENPTSAEVWLEIYRLPRDEWVQELEKRLADAQKEMEKKDGKAVEEPPPPVATEEGEGDTEQQTQETQPDTTPQSTQPDKGAKFSQLSLIMKLKPPPTPTGNLASSTHGAC-QKVD-SGDVIGTGQNHILTSSHLEQRAEIFENNYKHMLDYLPKEEKMIDLIRDVNFHFM-TSGRLMHNSQESPNHPGSPTNVAVWWQNSTHLYHYSVFKQPAKDGEM--KPDLVWPFTSKITATTMSTDSNLLVIGLASGNVVVWDRYLGMQRGVVNITTKAAVQQMWFLDPSLCPQDENNYPPYLTKTTAYLLVQSSDGAMFYLM-CGAGLPLEPYCV----SPPVDIEENMFTRVEPVPGKPELTMVVLKKGAIQIKHTLNGNVLCEAKLPPTHQLVTPWDPIITTACRGERLFVRGEA-KVEKPIEEENETTPEPQPEVDPVASMLFVFALKAFAPLEEFMVSERTPVAFTI-----HTTIDKRVDALMTERIAQQALRKTRMQDRWGLMKE 692          
BLAST of WD repeat-containing protein 93 vs. TrEMBL
Match: A0A4D9F0Y0 (WD repeat-containing protein 93 OS=Platysternon megacephalum OX=55544 GN=DR999_PMT03546 PE=4 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 2.016e-33
Identity = 140/605 (23.14%), Postives = 274/605 (45.29%), Query Frame = 1
Query:   31 MPIYLNSKQDFSIPNDFDPDF---SNNENF-LKDPEMFFDRLPQPFHFINKILNRILNDAFDIIDENFKFKTLESNKLQIQEIKPFSIFEDFGPIQCIXXXXXXXXXXXXGLKNGLAVIDIVGNKLIDKWENEEMDILSISYERLCQNISILSTIDSNGTGGLVGLINNRLYSLKSFPGSKDGDKPCQITSVCLDKNIGYVAVCYDQFKDSEQWLEVHKINREIWIKEL-----KAVGKNLHEYSAAQSDNKMAE-PDQGSDESSSILDRNGL--RVTGTNIIFKFKYQDSL-GSIGTNNFSQIFKQLDPSGQLIGIGLNHCMTSEFVDKLMSSYQMDYPNFLDFHIENDLNLMRIANVRFSEVSGQLIKDVGALQKSESSV---MFVWWSQSQHLLIFGLNKTNLKASETFSKPDSVRSFSSWIVTCELSSNNHYLAVGLQNGIFILLDILSGITRITQQVSTVAL-KSIYFLNFQRCVSENQTKENEAYLSVIDADNQMFCLQYVSQTLSKDSNCVMI---SNEPGADSVSRLSRNSNITLSI----YDGTIIILQDIVTGKKILKFQLPEYMTAVSPWQPICALSSRTGHLCIQVMANQREQ 1773
            MP+Y+  K    IP   + D+      ENF L+DP+  FD LPQPF  INK++  +   A++II++    +  +  K++     P + F+  G   C+     +  ++ VGL  GLAV ++   K +  WE+ +++I +I    L     +L T+D  G   L     + L  +K     ++  K        L +   Y  V       +E WLE++++ ++ W+KE       A   +  E   +Q+  K  E P +G+ E  S +  N +  +++   ++ K +    L GS   +    + K  D  G +IG+G NH +     ++  + ++  +   L+   E D    + ++  F  +    I  +G   K++  V   + V W+ S +L ++ L + + + ++   KP++V   ++ I    ++S + Y+A+  ++G   + D   G       +    L ++I+FL     V  +Q    +  L V+  D     L  V+ +  ++S  V++   S +P   ++S ++    +  ++    +DGT + L D  T + +  F  P   T  SPWQP+   +  T + C+ +  ++++Q
Sbjct:    1 MPVYIR-KHPLEIPPPSEKDWIKKDEEENFFLQDPDQIFDSLPQPFRMINKLVTLVFEQAWEIIEKREALREAQILKVKPTLYLPTAEFQVMGRANCL---AASGQHVFVGLSTGLAVFNMPNCKRVCAWESAKLEICAIRASNLGNETHLLVTMDEMGLARLFYFYRDSLLLIKVLNEVEEISKRNTCVEAELSQGGDYAGVLLQ--GSTEAWLEIYRLPKDSWLKETDHVQSAAAVSSFRERRFSQASTKSLELPGEGAAEMESPMSANRVETKLSLPVLLLKVRSPKPLTGSTFKSPLEALMKIDD--GSVIGLGQNHVIKDYQWEQQDAIFRSTFQKHLERESEPDSKEEKPSHAVFHFLLPGRILQIGPEIKAQPDVPTGISVHWNGSHNLCLYLLTRPSKEKTDAELKPETVWPCAAPITCSAVTSCSSYMALACEDGTITVWDRCLGFPLAVTALPEGCLSRTIHFLQ-TSTVPRDQLPRPKVQLLVLCTDGS---LHLVTVSGPRESRTVLLADRSKDPD-QTISAVAPIPALPGAVLVFSWDGT-VCLTDTATPQTVCHFITPPSHTVASPWQPV--FTVDTTNQCLLLRGDEQQQ 589          
BLAST of WD repeat-containing protein 93 vs. TrEMBL
Match: A0A2T7PWI1 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_00397 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 2.106e-33
Identity = 170/708 (24.01%), Postives = 303/708 (42.80%), Query Frame = 1
Query:   31 MPIYLNSKQDFSIPNDFDPDFSNNENFLKDPEMFFDRLPQPFHFINKILNRILNDAFDIIDEN-FKFKTLESNKLQIQEIKPFSIFEDFGPIQCIXXXXXXXXXXXXGLKNGLAVIDIVGNKLIDKWENEEMDILSI-SYERL-CQNISILSTIDSNGTGGLVGLINNRLYSLKSFPGSKDGDKPCQITSVCLDKNIG-YVAVCYD--QFKDSEQWLEVHKINREIWIKELKA---------VGKNLHEYSAAQS----DNKMAEPDQGSD---------ESSSILDRNGLRVTGTNIIFKFK-YQDSLGSIGTNNFSQIFKQLDPSGQLIGIGLNHCMTSEFVDKLMSSYQMDYPNFLDFHIENDLNLMR-IANVRFSEVSG---QLIKDVGALQKSESSVMFVWWSQSQHLLIFGLNKTNLKASETFS-KPDSVRSFSSWIVTCELSSNNHYLAVGLQNGIFILLDILSGITRITQQVS-TVALKSIYFLN-----FQRCVSENQTKENEAYLSVIDADNQMFCLQYVSQTLSKDSNCVMISNEPGADS-----VSRLSRNSNITLSIYDGTIIILQDIVTGKKILKFQLPEYMTAVSPWQPICALSSRTGHLCIQVMANQREQPTDSEVLKQMTAVYKIELE-VPNGD-FIETTIVKEELELQEKHSFVTEKINSMLNFRYKYHEETQLELQESWSKLEEILKTL 2013
            MP+Y+      + P+       N +++L+DP+   D LPQP+  IN ++N++ +D ++I+ E   K   LE      +  +P  + +  G +  +    +     + GL NG AV+     + +  WE    +I  I +Y  L   +IS    +  +  G +  +  + + +L+          P  + S       G YV V ++  Q+  ++ WLEVH+I RE+WIKEL+          V K+  E  A  S     +  AE  +  +           S I  +  ++ T  N++ K K       ++ T+ FS    Q   +G+++G G  H M++  +    S++Q  + N + +  + D      +    F  ++     L  D+   QK +   + VWWS S+HLL F L    LK+S+    KPD V  FS  I    +SS   ++A+GL+NG  ++ D+  GI R    +S T +L+ ++F++       R       ++   YL     D+  +      +T  +    V I   P AD      +  +     + + +     + L+DI TG K+ +  LP      SPW+PI A     G L   V  N  E   D+     ++ ++   L   P  D +   T  +  L     HS   +++++++  R++     +  LQ  W+ L   L+ L
Sbjct:    1 MPVYIRKNVSLTPPSISRMSEENEDDYLQDPDQLRDVLPQPYRMINNVMNQLFSDVWEIVQEKEIKRLELERKVRPPKYDQPIKL-QVHGKVTALTNSKDGNYIFI-GLPNGFAVVSSHNQQTVGIWEENGAEITRIYAYNFLNFASISTYLIVTLDDMGNIFCICVHVINALQEV-------VPKLLASAVHASLEGDYVGVVFESMQYDTNDTWLEVHRIPRELWIKELETSDIQFNKERVLKDTEESFAMTSMELATSHFAEEGKKPEGRLEQQLALSPSLIKTQAAVKFTSPNLVLKVKPLAPYSATVSTSTFS--LAQKADTGEVLGTGQMHIMSAAHLHSRDSTFQHMHSNLIKYLPQEDTQTQHSVMEATFHFLNPGRISLPGDLSTGQKDQPCSVAVWWSGSKHLLQFSL----LKSSKDLEHKPDVVWPFSCNITASAISSCTSHIAIGLENGNVVIWDLYLGIQRGVVNISATSSLRMLHFVDPSIYPTSRVHYPPYGQQGATYLLAQCQDSTQYLYDIGHETHDQP---VCIEQMPEADDEIQTLLEYVPDLPQLAVVVQKDGRLYLKDIQTGVKVCQLSLPATYHLASPWEPIMAFGG-CGQLLF-VKGNGVEV-NDAGETNDVSGLFVYTLRSFPTLDKYWAQTRYEGHL---SGHSTAEQRLDALMKERFEQQALRKQRLQSRWNLLRSDLEVL 684          
BLAST of WD repeat-containing protein 93 vs. TrEMBL
Match: A0A3Q0H4X1 (WD repeat-containing protein 93 isoform X3 OS=Alligator sinensis OX=38654 GN=WDR93 PE=4 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 1.187e-32
Identity = 155/685 (22.63%), Postives = 289/685 (42.19%), Query Frame = 1
Query:   31 MPIYLNSKQDFSIPNDFDPDF---SNNENF-LKDPEMFFDRLPQPFHFINKILNRILNDAFDIIDENFKFKTLESNKLQIQEIKPFSIFEDFGPIQCIXXXXXXXXXXXXGLKNGLAVIDIVGNKLIDKWENEEMDILSISYERLCQNISILSTIDSNGTGGLVGLINNRLYSLKSFPGSKDGDKPCQITSVCLDKNIGYVAVCYDQFKDSEQWLEVHKINREIWIKELKAVGKNLHEYSAAQSDNKMAEPDQGSDESSSILDRNGLRVTGTNIIFKFKYQDSL-GSIGTNNFSQIFKQLDPSGQLIGIGLNHCMTSEFVDKLMSSYQMDYPNFLDFHIENDLNLMRIANVRFSEVSGQLIKDVGALQKSESSV---MFVWWSQSQHLLIFGLNKTNLKASETFSKPDSVRSFSSWIVTCELSSNNHYLAVGLQNG-IFILLDILSGITRITQQVSTVALKSIYFLNFQR-------CVSENQTKENEAYLSV-IDADNQMFCLQYVSQTLSKDSNCVMISNEPGADS------VSRLSRNSNITLSIYDGTIIILQDIVTGKKILKFQLPEYMTAVSPWQPICALSSRTGHLCIQVMANQREQPTDSEVLKQMTAVYKIELEV-PNGDFIETTIVKEELELQEKHSFVTEKINSMLNFRYKYHEETQLELQESWSKLEEILKTL 2013
            MP+Y+  K    IP   + D+      ENF L+DP+   D+LPQPF  INK++N + ++A +II++    +  +  K++  +  P   F+  G   C+     +   + VGL  GLA       + +  WE  + +I +I    L     +L  +D  G   L     + L+ +K     +D  K      V L     Y  V       +E WLE++++ ++ W +E +         + A  +   ++  +     S+   + G R++   ++ K +    L GSI  +    + K  D  G ++G+G NH +    +++  + +   +  +L+   E+D   +   +  F  +    I  +G   KS+  V   + V WS S +L ++ L +   +  +T  KPD+V   ++ I    +SS + YLA+  ++  I +  + L     +T       ++SI+FL           C S + +      L++ +D       L  V+ + +  SN V+++  P             L+ N  + +   DGT+ ++ D VT + I     P   T  SPWQP+ AL +    L +Q    QR     S+     ++++  +    P  D     +      LQ  H    ++ +  L  R ++  E   ++   WS+L+    TL
Sbjct:    1 MPVYIR-KHPLEIPLPSEKDWIKEDEEENFFLQDPDQTLDQLPQPFRMINKMVNLVFDEALEIIEQREALREAQKLKVRPMQYMPTGDFKVAGRANCL---AASGKNIFVGLSTGLAAFSAADCRRVCAWEAAKFEICAIHASDLGNENHVLIALDEMGFAHLFYFCKDSLFLVKVLNEVEDISKRSTCEEVELSHGGSYAGVLLQ--GSTEAWLEIYRLPKDSWERETENASGAAAAAAPAVQERMFSQASEMETRMST--SKLGARLSLPMLLLKVRPPKPLSGSIFKSPLDALMKIDD--GSVLGLGHNHMIKDCQLEQQDAIFHSTFKTYLERGSESDSKEVTPRHTMFHFIFPGRILRMGPEIKSQPEVPAGISVHWSGSHNLCLYLLTRPLKEKGDTELKPDAVWPCAALITCSAVSSCSSYLALACEDSTITVWNNCLGSPLGVTALPEGCLIRSIHFLPSPAAPKDQGLCPSGDPSHPKVQLLALCVDGS-----LHLVAASWTGQSNTVLLAGRPQDPGQTINTVTPLLTFNGTLLVFSRDGTVSLI-DTVTLQTICHLVTPPSYTVASPWQPVFALDTENQRLLLQGQEQQRADAV-SQAKDNQSSIFLFDFNSHPLRDVFPKKLESPPESLQ--HLPWDKRCDIFLRNRREHLLELSQQMPGCWSRLQNYAATL 666          
BLAST of WD repeat-containing protein 93 vs. Ensembl Nematostella
Match: EDO45562 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSH1])

HSP 1 Score: 121.324 bits (303), Expect = 1.173e-28
Identity = 113/441 (25.62%), Postives = 200/441 (45.35%), Query Frame = 1
Query:  100 NENFLKDPEMFFDRLPQPFHFINKILNRILNDAFDIIDENFKFKTLESNKLQIQEIKPFSIFEDFGPIQCIXXXXXXXXXXXXGLKNGLAVIDIVGNKLIDKWENEEM-DILSISYERLCQNISILSTIDSNGTGGLVGLINNRLYSLKSFPGSKDGDKPCQITSVCLDKNIGYVAVCYDQFKDSEQWLEVHKINREIWIKELKA------------VGKNLHEYSAAQSDNKMAEPD-----QGSDESSSILDRNG-------LRVTGTNIIFKFKYQDSLGSIGTNNFSQIFKQLDPSGQLIGIGLNHCMTSEFVDKLMSSYQMDYPNFLDFHIENDLNLMRIANVRFSEVSGQLIKDVGALQKSESSVMFVWWSQSQHLLIFGLNKTNLKASETFSKPDSVRSFSSWIVTCELSSNNHYLAVGLQNGIFILLDILSGI 1347
            ++ F+ DPE  FD LPQPF  ++K +N I + A++II++    + L  +K  +          +F    C+   ++   YL +   +GL VI+ +  + +  +E+     +  +S   L +   +L+T D +G   L   I   ++  + F  ++DGDK    TSV L  + GY+A+ + +  D E  LEV+KI RE W+KE +A            VG++    S  QS +K ++ D     +G+  +S    R G          T  + + +      +G     N+    K +D    +IG G NH +  ++      +++  +   L    E +   MR     F +  G+LI        ++++ + V WS+   L I+ L KT   A +   KPD V   +  I+   +S     LA+GL+NG  ++ D+  G+
Sbjct:   23 DDGFVTDPEKIFDVLPQPFRLVDKTVNHIFDKAWEIIEDIENNRALRRSKESLPNFDCGKALHNFANPSCM-FSVDGGKYLFLAYCDGLVVIEALIGQSVATFEDPGCRKVTHMSACVLQEGFYLLTTRDEDGVAKLYCFIGETIHLARVF--NEDGDK--NATSVELSPDGGYIAIGW-EIPDEESSLEVYKIPRESWLKEAEAAVAAPKSRKPTVVGESAE--SGGQSVDKPSQEDEDPKEEGNPAASPPGSRPGSGQGAAVSSFTKPSAVLRIFPPAQVGPCSATNYVAALKAVDADNSVIGTGSNHILLQQYFQHSDMTFKALHEQQLQHLKEENSPQMRKPTTHFLK-PGKLIPAGLDSTPNKTNSVAVCWSKETQLSIYSLVKT---AKDIEHKPDVVWPSAQPILVSTVSDCLSLLALGLENGTVVVWDVHRGL 451          
BLAST of WD repeat-containing protein 93 vs. Ensembl Medaka
Match: ENSORLT00000036629.1 (WD repeat domain 93 [Source:NCBI gene;Acc:101155759])

HSP 1 Score: 52.7582 bits (125), Expect = 1.067e-6
Identity = 79/364 (21.70%), Postives = 142/364 (39.01%), Query Frame = 1
Query:  658 WLEVHKINREIWIKELKAVGKNLHEYSAAQSDNKMAEPDQGSDESSSILDRNGLRVTGTNIIFKFKYQDSLGSIGTNNFSQIFKQLDPSGQLIGIGLNHCMTSEFVDKLMSSYQMDYPNFLDFHIENDLNLMRIANVRF----SEVSGQLIKDVGALQKSESSVMFVWWSQSQHLLIFGLNKTNLKASETFSKPDSVRSFSSWIVTCELSSNNHYLAVGLQNGIFILLDILSG--ITRITQQVSTVALKSIYFLNFQRCVSENQTKENE-AYLSVIDADNQMFCLQYVSQTLSKDSNCVMISNEPGADSVSRLSRNSNITLSIYDGTIII--------LQDIVTGKKILKFQLPEYMTAVSPWQ 1704
            WLEV+++   +W+ EL+ V       SA + D  + E                      ++  K+   + L  I   +      Q    G L    L HC+    VD++ SS  +D     D    +     R     F       SGQ       LQ      + VWWS S +LL + L K ++K +E    PDS+   ++ I+   +S    Y+A+GL + +  + D  +G  ++ I+    +  L+  Y   +   +  +QT   E  +L V+    +++ ++    T      C    +E   D  SR   +  I++    G ++I        LQD++    +       ++T  +P+Q
Sbjct:  156 WLEVYQLPVAVWLAELETV-------SAREQDPNVTE----------------------SVDVKWSSVEVLIKITPPHLPAGNSQ---GGALGADLLKHCLV---VDEIRSSSCLDA----DAGTTDTSRSPRWCTHHFLLSCDPFSGQ------PLQSELPVAVAVWWSGSHNLLQYSLQKVSIKKAEAAPTPDSLWPNANRIICSAVSRRTRYIALGLDDALVCVWDRRTGAPLSIISLPKYSSLLRMEYLDCWPELLHPSQTPAAEVVHLLVMSKGGELYMIRAERGT----HTCTTQLSERPND--SRDLPSVTISMPFLPGILLIIQRNGKMFLQDVINKTAVC------FLTPPTPYQ 462          
BLAST of WD repeat-containing protein 93 vs. Planmine SMEST
Match: SMESG000037987.1 (SMESG000037987.1)

HSP 1 Score: 1305.81 bits (3378), Expect = 0.000e+0
Identity = 650/662 (98.19%), Postives = 655/662 (98.94%), Query Frame = 1
Query:   31 MPIYLNSKQDFSIPNDFDPDFSNNENFLKDPEMFFDRLPQPFHFINKILNRILNDAFDIIDENFKFKTLESNKLQIQEIKPFSIFEDFGPIQCIXXXXXXXXXXXXGLKNGLAVIDIVGNKLIDKWENEEMDILSISYERLCQNISILSTIDSNGTGGLVGLINNRLYSLKSFPGSKDGDKPCQITSVCLDKNIGYVAVCYDQFKDSEQWLEVHKINREIWIKELKAVGKNLHEYSAAQSDNKMAEPDQGSDESSSILDRNGLRVTGTNIIFKFKYQDSLGSIGTNNFSQIFKQLDPSGQLIGIGLNHCMTSEFVDKLMSSYQMDYPNFLDFHIENDLNLMRIANVRFSEVSGQLIKDVGALQKSESSVMFVWWSQSQHLLIFGLNKTNLKASETFSKPDSVRSFSSWIVTCELSSNNHYLAVGLQNGIFILLDILSGITRITQQVSTVALKSIYFLNFQRCVSENQTKENEAYLSVIDADNQMFCLQYVSQTLSKDSNCVMISNEPGADSVSRLSRNSNITLSIYDGTIIILQDIVTGKKILKFQLPEYMTAVSPWQPICALSSRTGHLCIQVMANQREQPTDSEVLKQMTAVYKIELEVPNGDFIETTIVKEELELQEKHSFVTEKINSMLNFRYKYHEETQLELQESWSKLEEILKTLS 2016
            MPIYLNSKQDFSIP+DFDPDFSNNENFLKDPEMFFDRLPQPFHFINKILNRILNDAFDIIDENFKFKTLESNKLQIQEIKPFSIFEDFGPIQCIVEVLENENYLVVG KNGLAVIDIVGNK+IDKWENEEMDILSISYERLCQNISILSTIDSNGTGGLVGLINNRLYSLKSFPGSKDGDKPCQ+TSVCLDKNIGYVAVCYDQFKDSEQWLEVHKINREIWIKELKAVGKNL EYSAAQSDNKMAEPDQGSDE SSILDRNGLRVTGTNIIFKFKYQDSLGSIGTNNFSQIFKQLDPSGQLIGIGLNHCMTSEFVDKLMSSYQMDYPNFLDFHIENDLNLMRIANVRFSEVSGQLIKDVGALQKSESSVMFVWWSQSQHLLIFGLNKTNLKASETFSKPDSVRSFSSWIVTCELSSNNHYLAVGLQNGIFILLDILSGITRI QQVSTVALKSIYFLNFQRCVSENQTKENEAYLSVIDADNQMFCLQYVSQTLSKDSNCVMISNEPGADSVSRLSRNSNITLSIYDGTIIILQDIVTGKKILKFQLPEYMTAVSPWQPICALSSRTGHLCIQVMANQREQP DSEVLKQMTAVYKIELEVPN DFI TTIVKEELELQ+KHSFVTEKINSMLNFRYKYHEE+QLELQESWSKLEEILKTLS
Sbjct:    1 MPIYLNSKQDFSIPSDFDPDFSNNENFLKDPEMFFDRLPQPFHFINKILNRILNDAFDIIDENFKFKTLESNKLQIQEIKPFSIFEDFGPIQCIVEVLENENYLVVGQKNGLAVIDIVGNKIIDKWENEEMDILSISYERLCQNISILSTIDSNGTGGLVGLINNRLYSLKSFPGSKDGDKPCQVTSVCLDKNIGYVAVCYDQFKDSEQWLEVHKINREIWIKELKAVGKNLDEYSAAQSDNKMAEPDQGSDEYSSILDRNGLRVTGTNIIFKFKYQDSLGSIGTNNFSQIFKQLDPSGQLIGIGLNHCMTSEFVDKLMSSYQMDYPNFLDFHIENDLNLMRIANVRFSEVSGQLIKDVGALQKSESSVMFVWWSQSQHLLIFGLNKTNLKASETFSKPDSVRSFSSWIVTCELSSNNHYLAVGLQNGIFILLDILSGITRIAQQVSTVALKSIYFLNFQRCVSENQTKENEAYLSVIDADNQMFCLQYVSQTLSKDSNCVMISNEPGADSVSRLSRNSNITLSIYDGTIIILQDIVTGKKILKFQLPEYMTAVSPWQPICALSSRTGHLCIQVMANQREQPKDSEVLKQMTAVYKIELEVPNVDFIATTIVKEELELQDKHSFVTEKINSMLNFRYKYHEESQLELQESWSKLEEILKTLS 662          
The following BLAST results are available for this feature:
BLAST of WD repeat-containing protein 93 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
WDR931.229e-2020.50WD repeat domain 93 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR933.538e-1820.07WD repeat domain 93 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR933.811e-724.84WD repeat domain 93 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of WD repeat-containing protein 93 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 93 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 93 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
wdr931.520e-719.82WD repeat domain 93 [Source:ZFIN;Acc:ZDB-GENE-1610... [more]
back to top
BLAST of WD repeat-containing protein 93 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
drap15.449e-1228.13DR1-associated protein 1 (negative cofactor 2 alph... [more]
back to top
BLAST of WD repeat-containing protein 93 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Wdr931.247e-2322.06WD repeat domain 93 [Source:MGI Symbol;Acc:MGI:364... [more]
back to top
BLAST of WD repeat-containing protein 93 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q402B2|WDR93_MOUSE8.725e-2322.06WD repeat-containing protein 93 OS=Mus musculus OX... [more]
sp|Q6P2C0|WDR93_HUMAN5.900e-2020.50WD repeat-containing protein 93 OS=Homo sapiens OX... [more]
back to top
BLAST of WD repeat-containing protein 93 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1PU983.026e-4222.22WD repeat-containing protein 93 OS=Crassostrea gig... [more]
A0A210QE221.401e-4122.71WD repeat-containing protein 93 OS=Mizuhopecten ye... [more]
A0A4D9F0Y02.016e-3323.14WD repeat-containing protein 93 OS=Platysternon me... [more]
A0A2T7PWI12.106e-3324.01Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A3Q0H4X11.187e-3222.63WD repeat-containing protein 93 isoform X3 OS=Alli... [more]
back to top
BLAST of WD repeat-containing protein 93 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 93 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 93 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 93 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO455621.173e-2825.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD repeat-containing protein 93 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000036629.11.067e-621.70WD repeat domain 93 [Source:NCBI gene;Acc:10115575... [more]
back to top
BLAST of WD repeat-containing protein 93 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000037987.10.000e+098.19SMESG000037987.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004899 ID=SMED30004899|Name=WD repeat-containing protein 93|organism=Schmidtea mediterranea sexual|type=transcript|length=2039bp
CTATATAAATCTTATATGTAAAATATAATCATGCCCATTTATTTGAATTC
TAAGCAAGACTTCTCCATTCCTAATGACTTCGATCCTGATTTTTCAAATA
ATGAAAACTTTCTTAAAGATCCTGAAATGTTTTTCGATAGATTACCACAA
CCATTTCATTTCATTAATAAAATACTAAATAGAATTTTAAATGATGCTTT
TGATATCATAGATGAAAATTTCAAATTCAAAACTTTAGAATCAAATAAAT
TGCAAATCCAAGAAATAAAACCTTTTTCGATTTTTGAGGATTTCGGACCA
ATTCAATGTATTGTCGAGGTTTTAGAGAATGAAAATTATTTAGTAGTCGG
ACTAAAAAATGGTCTGGCAGTCATTGATATCGTCGGAAATAAGCTCATTG
ATAAATGGGAGAATGAAGAAATGGATATTTTATCCATCAGCTATGAACGA
CTTTGCCAAAACATATCCATCCTGTCGACAATTGATAGCAATGGAACTGG
CGGGTTGGTGGGTCTAATAAACAATCGACTGTACTCGTTGAAATCGTTTC
CCGGTAGCAAAGATGGTGACAAACCTTGCCAGATAACCTCAGTGTGTTTG
GATAAAAACATAGGCTATGTTGCTGTTTGTTATGACCAGTTCAAGGACAG
TGAACAGTGGCTAGAAGTTCATAAGATTAACAGGGAAATTTGGATCAAAG
AATTGAAGGCAGTCGGCAAAAACCTTCATGAATATTCAGCTGCACAATCG
GATAATAAAATGGCAGAACCTGATCAAGGATCAGATGAGTCTTCGTCGAT
TCTTGACAGAAACGGTCTGCGGGTTACTGGAACGAATATTATTTTCAAGT
TTAAATATCAAGATTCCCTCGGGAGTATCGGAACGAATAACTTTTCGCAA
ATCTTTAAACAATTAGACCCGTCAGGCCAGCTCATTGGTATAGGATTGAA
CCATTGTATGACTTCCGAGTTTGTGGACAAACTGATGAGTTCATACCAAA
TGGATTATCCAAATTTCCTTGATTTTCACATAGAAAATGATCTCAATTTA
ATGAGAATCGCCAATGTACGATTTTCTGAAGTATCTGGACAATTAATAAA
GGACGTTGGAGCTTTACAAAAATCAGAATCATCAGTGATGTTTGTTTGGT
GGTCTCAAAGCCAGCATTTACTGATTTTCGGATTAAATAAAACTAATCTA
AAAGCAAGTGAAACATTTTCCAAACCAGACTCCGTTAGATCTTTTTCCAG
CTGGATTGTTACATGTGAATTATCCAGCAACAACCACTATCTTGCGGTTG
GTCTCCAGAACGGAATTTTTATATTATTAGATATATTATCGGGAATTACA
AGGATAACCCAACAAGTCTCTACTGTGGCATTAAAATCTATATATTTTTT
GAACTTTCAAAGGTGTGTTTCTGAAAATCAAACAAAGGAAAATGAGGCAT
ATTTGTCAGTAATTGATGCAGATAATCAAATGTTTTGTTTGCAATATGTT
TCGCAGACTTTGTCAAAAGATTCGAATTGCGTAATGATATCAAATGAGCC
CGGTGCCGATTCTGTTAGCCGTTTGAGTCGCAATAGCAACATAACTTTAT
CAATTTACGATGGAACTATTATCATTTTGCAAGATATAGTAACAGGCAAG
AAGATTCTCAAATTTCAGCTACCCGAATACATGACTGCGGTTTCTCCATG
GCAACCGATTTGCGCACTTTCATCTAGAACTGGGCATTTATGCATTCAAG
TAATGGCTAATCAGAGAGAACAACCAACGGATTCAGAAGTCTTGAAACAA
ATGACAGCTGTCTATAAAATAGAGTTAGAAGTTCCAAATGGTGATTTCAT
CGAAACTACAATCGTCAAGGAGGAGTTAGAGTTACAAGAAAAGCATTCGT
TTGTAACTGAAAAAATTAATTCAATGTTAAATTTTCGCTACAAATATCAT
GAAGAGACACAATTAGAGCTTCAAGAATCTTGGAGTAAACTTGAAGAAAT
CTTGAAAACATTATCATAATATTTTGAATTCTGTTTGTT
back to top

protein sequence of SMED30004899-orf-1

>SMED30004899-orf-1 ID=SMED30004899-orf-1|Name=SMED30004899-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=663bp
MPIYLNSKQDFSIPNDFDPDFSNNENFLKDPEMFFDRLPQPFHFINKILN
RILNDAFDIIDENFKFKTLESNKLQIQEIKPFSIFEDFGPIQCIVEVLEN
ENYLVVGLKNGLAVIDIVGNKLIDKWENEEMDILSISYERLCQNISILST
IDSNGTGGLVGLINNRLYSLKSFPGSKDGDKPCQITSVCLDKNIGYVAVC
YDQFKDSEQWLEVHKINREIWIKELKAVGKNLHEYSAAQSDNKMAEPDQG
SDESSSILDRNGLRVTGTNIIFKFKYQDSLGSIGTNNFSQIFKQLDPSGQ
LIGIGLNHCMTSEFVDKLMSSYQMDYPNFLDFHIENDLNLMRIANVRFSE
VSGQLIKDVGALQKSESSVMFVWWSQSQHLLIFGLNKTNLKASETFSKPD
SVRSFSSWIVTCELSSNNHYLAVGLQNGIFILLDILSGITRITQQVSTVA
LKSIYFLNFQRCVSENQTKENEAYLSVIDADNQMFCLQYVSQTLSKDSNC
VMISNEPGADSVSRLSRNSNITLSIYDGTIIILQDIVTGKKILKFQLPEY
MTAVSPWQPICALSSRTGHLCIQVMANQREQPTDSEVLKQMTAVYKIELE
VPNGDFIETTIVKEELELQEKHSFVTEKINSMLNFRYKYHEETQLELQES
WSKLEEILKTLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR006885NADH_UbQ_FeS_4_mit
IPR036322WD40_repeat_dom_sf
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016651oxidoreductase activity, acting on NAD(P)H
Vocabulary: biological process
TermDefinition
GO:0022900electron transport chain
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR12219:SF17WD REPEAT-CONTAINING PROTEIN 93coord: 6..661
IPR006885NADH dehydrogenase ubiquinone Fe-S protein 4, mitochondrialPANTHERPTHR12219NADH-UBIQUINONE OXIDOREDUCTASEcoord: 6..661
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 79..443
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 361..569