Beta-1,4-galactosyltransferase 4

Overview
NameBeta-1,4-galactosyltransferase 4
Smed IDSMED30004897
Length (bp)1123
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Beta-1,4-galactosyltransferase 4 (SMED30004897) t-SNE clustered cells

Violin plots show distribution of expression levels for Beta-1,4-galactosyltransferase 4 (SMED30004897) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Beta-1,4-galactosyltransferase 4 (SMED30004897) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Beta-1,4-galactosyltransferase 4 (SMED30004897) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004897

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30004897SMESG000002057.1 SmedASXL_009967SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
muscle cellSMED30004897SMESG000002057.1 dd_Smed_v4_13813_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30004897SMESG000002057.1 dd_Smed_v6_13813_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Human
Match: B4GALT2 (beta-1,4-galactosyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:925])

HSP 1 Score: 185.652 bits (470), Expect = 2.095e-55
Identity = 84/229 (36.68%), Postives = 137/229 (59.83%), Query Frame = 3
Query:  423 NLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKL-WKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKH-KARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPSP 1103
            + + +  +A+I+P+R R + L   + YL  +LRRQ   Y +Y++ Q G+  FN+  L+N GFLEA+K    +DC +F DVDL+P      Y C   P H ++++D F ++LPY+   GGV  +   QFL +NG+ N YW WG EDDD++ RI+ T ++++RP   I R+RM+KH + +   P   R   +  +K   + DG+ S+ Y V + +   L+T++ +D+G  P
Sbjct:   72 DCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITVDIGRPP 300          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Human
Match: B4GALT2 (beta-1,4-galactosyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:925])

HSP 1 Score: 186.037 bits (471), Expect = 8.251e-55
Identity = 86/235 (36.60%), Postives = 139/235 (59.15%), Query Frame = 3
Query:  405 WTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKL-WKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKH-KARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPSP 1103
            +T   C  + +  +A+I+P+R R + L   + YL  +LRRQ   Y +Y++ Q G+  FN+  L+N GFLEA+K    +DC +F DVDL+P      Y C   P H ++++D F ++LPY+   GGV  +   QFL +NG+ N YW WG EDDD++ RI+ T ++++RP   I R+RM+KH + +   P   R   +  +K   + DG+ S+ Y V + +   L+T++ +D+G  P
Sbjct:  134 YTPPDC--TPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITVDIGRPP 366          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Human
Match: B4GALT2 (beta-1,4-galactosyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:925])

HSP 1 Score: 186.037 bits (471), Expect = 8.251e-55
Identity = 86/235 (36.60%), Postives = 139/235 (59.15%), Query Frame = 3
Query:  405 WTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKL-WKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKH-KARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPSP 1103
            +T   C  + +  +A+I+P+R R + L   + YL  +LRRQ   Y +Y++ Q G+  FN+  L+N GFLEA+K    +DC +F DVDL+P      Y C   P H ++++D F ++LPY+   GGV  +   QFL +NG+ N YW WG EDDD++ RI+ T ++++RP   I R+RM+KH + +   P   R   +  +K   + DG+ S+ Y V + +   L+T++ +D+G  P
Sbjct:  134 YTPPDC--TPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITVDIGRPP 366          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Human
Match: B4GALT5 (beta-1,4-galactosyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:928])

HSP 1 Score: 186.422 bits (472), Expect = 8.733e-55
Identity = 94/269 (34.94%), Postives = 146/269 (54.28%), Query Frame = 3
Query:  294 EQMMKIMDPNLLTVEQITDSILNNKLIEDSTNNLTQIWTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPS 1100
            E++  +  P  + + +I    ++    +D T  L   W    C      K+AI++P+R+R   L +L ++L  +L+RQ   +  Y+VEQ G   FN+ +L N GF EAMK   +DC++FHDVD IPES    Y C  +P H +  +D + Y LPY+   GGV  +   QF  +NG+ N +W WG EDDDL+ R+      V+RP     +++ + H  R +     R+ LL  SK R  LDGLN+++Y     TY  LY ++ +++ P 
Sbjct:  116 ERLPSMKGPIDINMSEIGMDYIHELFSKDPTIKLGGHWKPSDC--MPRWKVAILIPFRNRHEHLPVLFRHLLPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKDLDWDCLIFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLNY-FANITYDALYKNITVNLTPE 381          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Human
Match: B4GALT1 (beta-1,4-galactosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:924])

HSP 1 Score: 185.652 bits (470), Expect = 2.122e-54
Identity = 89/222 (40.09%), Postives = 137/222 (61.71%), Query Frame = 3
Query:  432 SSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKH-KARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            S +K+AII+P+R+R+  L+  + YL  +L+RQ   Y IY++ Q G + FN+  L+N GF EA+K + + C +F DVDLIP + +  Y C S P H+SV++D F + LPY    GGV  +   QFLT+NG+ N YW WG EDDD++ R+    + ++RP A + R RM++H + ++  P   R   ++ +K     DGLNS++Y V       LYT + +D+G
Sbjct:  174 SPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIG 395          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Celegans
Match: bre-4 (Beta-1,4-N-acetylgalactosaminyltransferase bre-4 [Source:UniProtKB/Swiss-Prot;Acc:Q9GUM2])

HSP 1 Score: 196.052 bits (497), Expect = 4.758e-59
Identity = 92/221 (41.63%), Postives = 138/221 (62.44%), Query Frame = 3
Query:  432 SSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPI-ELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDV 1091
            + +++AIIVPYRDR   L I++  L  LL +Q   Y I+IVEQ     FN+G LMN G+  A +L+ + C +FHDVDL+PE     Y+C   P H+SV+ID F+YKLPYS + GG+  +       +NG+SN +W WG EDDDL  R +   L+V+R P  IAR++M+KH     +P+ + R+K++  +K R+  DGL+++ Y +       LYT  ++D+
Sbjct:  146 ARHRVAIIVPYRDREAHLRIMLHNLHSLLAKQQLDYAIFIVEQVANQTFNRGKLMNVGYDVASRLYPWQCFIFHDVDLLPEDDRNLYTCPIQPRHMSVAIDKFNYKLPYSAIFGGISALTKDHLKKINGFSNDFWGWGGEDDDLATRTSMAGLKVSRYPTQIARYKMIKHSTEATNPVNKCRYKIMGQTKRRWTRDGLSNLKYKLVNLELKPLYTRAVVDL 366          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Celegans
Match: bre-4 (Beta-1,4-N-acetylgalactosaminyltransferase bre-4 [Source:UniProtKB/Swiss-Prot;Acc:Q9GUM2])

HSP 1 Score: 196.052 bits (497), Expect = 4.758e-59
Identity = 92/221 (41.63%), Postives = 138/221 (62.44%), Query Frame = 3
Query:  432 SSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPI-ELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDV 1091
            + +++AIIVPYRDR   L I++  L  LL +Q   Y I+IVEQ     FN+G LMN G+  A +L+ + C +FHDVDL+PE     Y+C   P H+SV+ID F+YKLPYS + GG+  +       +NG+SN +W WG EDDDL  R +   L+V+R P  IAR++M+KH     +P+ + R+K++  +K R+  DGL+++ Y +       LYT  ++D+
Sbjct:  146 ARHRVAIIVPYRDREAHLRIMLHNLHSLLAKQQLDYAIFIVEQVANQTFNRGKLMNVGYDVASRLYPWQCFIFHDVDLLPEDDRNLYTCPIQPRHMSVAIDKFNYKLPYSAIFGGISALTKDHLKKINGFSNDFWGWGGEDDDLATRTSMAGLKVSRYPTQIARYKMIKHSTEATNPVNKCRYKIMGQTKRRWTRDGLSNLKYKLVNLELKPLYTRAVVDL 366          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Celegans
Match: W02B12.11 (N-acetyllactosamine synthase [Source:UniProtKB/TrEMBL;Acc:G5EGS9])

HSP 1 Score: 189.504 bits (480), Expect = 1.687e-56
Identity = 95/234 (40.60%), Postives = 136/234 (58.12%), Query Frame = 3
Query:  405 WTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSI-SYAVQQRTYCELYTHLLIDVGPSP 1103
            W    C   + +K+A+I+PYR+R+  L  LI +L  +L+RQ   ++  + EQ+G   FNKG +MNA F+ A  L   DCV+FHDVD+ P+    PYSC   P HL   +    Y+L Y  +VGGV+ +    +  +NGYSN +W WG EDDD+  RI + N  + RP     R+ MLKH  R+++  +L +KLL  S  R   DGLN    + +++ T   LY HL +DVGP P
Sbjct:  150 WKPDDCQ--ARDKIAVIIPYRERQTHLTRLIDFLIPILQRQRLDFRFIVTEQYGNDLFNKGRIMNAAFIFAESL-GVDCVVFHDVDMFPQDDRNPYSCPPGPRHLGAFVSNLGYQLWYKEIVGGVLAVSMADYRAVNGYSNQFWAWGGEDDDMGQRILSLNYTIERPNPETGRYSMLKHVKRKRTAPKLIYKLLGNSANRVAYDGLNETDKWTIRKVTTRPLYYHLYVDVGPVP 380          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Celegans
Match: W02B12.11 (N-acetyllactosamine synthase [Source:UniProtKB/TrEMBL;Acc:G5EGS9])

HSP 1 Score: 189.504 bits (480), Expect = 1.687e-56
Identity = 95/234 (40.60%), Postives = 136/234 (58.12%), Query Frame = 3
Query:  405 WTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSI-SYAVQQRTYCELYTHLLIDVGPSP 1103
            W    C   + +K+A+I+PYR+R+  L  LI +L  +L+RQ   ++  + EQ+G   FNKG +MNA F+ A  L   DCV+FHDVD+ P+    PYSC   P HL   +    Y+L Y  +VGGV+ +    +  +NGYSN +W WG EDDD+  RI + N  + RP     R+ MLKH  R+++  +L +KLL  S  R   DGLN    + +++ T   LY HL +DVGP P
Sbjct:  150 WKPDDCQ--ARDKIAVIIPYRERQTHLTRLIDFLIPILQRQRLDFRFIVTEQYGNDLFNKGRIMNAAFIFAESL-GVDCVVFHDVDMFPQDDRNPYSCPPGPRHLGAFVSNLGYQLWYKEIVGGVLAVSMADYRAVNGYSNQFWAWGGEDDDMGQRILSLNYTIERPNPETGRYSMLKHVKRKRTAPKLIYKLLGNSANRVAYDGLNETDKWTIRKVTTRPLYYHLYVDVGPVP 380          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Celegans
Match: bre-4 (Beta-1,4-N-acetylgalactosaminyltransferase bre-4 [Source:UniProtKB/Swiss-Prot;Acc:Q9GUM2])

HSP 1 Score: 172.17 bits (435), Expect = 7.870e-52
Identity = 81/201 (40.30%), Postives = 123/201 (61.19%), Query Frame = 3
Query:  492 LIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPI-ELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDV 1091
            ++  L  LL +Q   Y I+IVEQ     FN+G LMN G+  A +L+ + C +FHDVDL+PE     Y+C   P H+SV+ID F+YKLPYS + GG+  +       +NG+SN +W WG EDDDL  R +   L+V+R P  IAR++M+KH     +P+ + R+K++  +K R+  DGL+++ Y +       LYT  ++D+
Sbjct:    1 MLHNLHSLLAKQQLDYAIFIVEQVANQTFNRGKLMNVGYDVASRLYPWQCFIFHDVDLLPEDDRNLYTCPIQPRHMSVAIDKFNYKLPYSAIFGGISALTKDHLKKINGFSNDFWGWGGEDDDLATRTSMAGLKVSRYPTQIARYKMIKHSTEATNPVNKCRYKIMGQTKRRWTRDGLSNLKYKLVNLELKPLYTRAVVDL 201          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Fly
Match: beta4GalNAcTA (gene:FBgn0027538 transcript:FBtr0087539)

HSP 1 Score: 182.57 bits (462), Expect = 1.750e-53
Identity = 84/207 (40.58%), Postives = 134/207 (64.73%), Query Frame = 3
Query:  423 NLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAV 1043
            N ++ + +AI+VP+RDR   L + ++ +   L +Q   Y+I+IVEQ     FN+  +MN G+LEA+KL+++DC +FHDVDL+P      Y+C   P H+SV+IDT +++LPY  + GGV  M    F  +NG+SN ++ WG EDDD+  R+   NL ++R P +IAR++MLKH+  + +P   R++ L    ++   DG+NSI Y++
Sbjct:  176 NCNAQHHVAIVVPFRDRYAHLLLFLRNIHPFLMKQRIAYRIFIVEQTNGKPFNRAAMMNIGYLEALKLYQWDCFIFHDVDLLPLDDRNLYNCPRQPRHMSVAIDTLNFRLPYRSIFGGVSAMTREHFQAVNGFSNSFFGWGGEDDDMSNRLKHANLFISRYPVNIARYKMLKHQKEKANP--KRYENLQNGMSKIEQDGINSIKYSI 380          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Fly
Match: beta4GalNAcTB (gene:FBgn0039625 transcript:FBtr0085419)

HSP 1 Score: 178.333 bits (451), Expect = 8.558e-53
Identity = 89/215 (41.40%), Postives = 130/215 (60.47%), Query Frame = 3
Query:  447 AIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDV 1091
            AIIVPYR R  QL   + Y+   L +Q+  Y+I++VEQF    FN+ +L N G   A + + F C++ HDVDL+P +    Y+CS  P H+S ++D + ++LPY  L GGV+ + T Q+  +NG SN+Y+ WG EDDDLY R+ A N+ + R     +++ MLKHK  Q+ P   R  LL  +  R   DGLNS+ Y   +R    L+TH+L+D 
Sbjct:  112 AIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQFDHKPFNRAMLFNIGAQVAAE-YGFPCLILHDVDLLPLNSGQIYACSERPRHMSSALDHWRFRLPYRGLFGGVVAINTAQYQQINGMSNLYYGWGGEDDDLYERLQALNIDICRFAMEFSKYTMLKHK--QEQPNANRVALLRSATLRQHADGLNSLVYTEMERRMHSLFTHILVDT 323          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Fly
Match: beta4GalT7 (gene:FBgn0039258 transcript:FBtr0084755)

HSP 1 Score: 105.916 bits (263), Expect = 1.133e-25
Identity = 63/209 (30.14%), Postives = 111/209 (53.11%), Query Frame = 3
Query:  429 SSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRP----PASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAV 1043
            +S +K+A++VP+RDR  +L   + ++   L+RQ   + I+++ Q  + +FN+  L+N GF  A  +  +D +  HDVDL+P + N+ Y   S    L ++      K  Y   VGG+++++   F  +NG SN YW WG EDD+ ++RI    LQVTRP      +   F  + ++  +K   +        ++ R    GL+++ Y +
Sbjct:   72 ASVHKMALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVGFQFASDV--YDYIAMHDVDLLPLNDNLLYEYPSSLGPLHIAGPKLHPKYHYDNFVGGILLVRREHFKQMNGMSNQYWGWGLEDDEFFVRIRDAGLQVTRPQNIKTGTNDTFSHIHNRYHRKRDTQKCFNQKEMTRKRDHKTGLDNVKYKI 278          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Zebrafish
Match: CR318611.2 (si:dkey-199f5.8 [Source:NCBI gene;Acc:556544])

HSP 1 Score: 198.749 bits (504), Expect = 4.265e-60
Identity = 87/225 (38.67%), Postives = 140/225 (62.22%), Query Frame = 3
Query:  423 NLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIEL-RHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            N  + ++ AII+P+R R + L+ L+ YL   L+RQ   Y IYI+ Q G   FN+  LMN GF EAM+   +DC+ FHDVDLIPE     Y C + P H ++++D F YKLPY    GGV  +   Q+L +NG+ N YW WG EDDD+ +R++   + ++RP  ++ R++M+KHK  + + +   R  +L+ ++  ++ DG+N++ Y +  R Y  LY ++ +++G
Sbjct:  120 NCEARHRTAIIIPHRSREHHLKFLLYYLHPFLQRQQLNYGIYIIHQAGNYTFNRAKLMNVGFREAMRDEDWDCLFFHDVDLIPEDDRNTYICDAHPKHAAIAMDKFGYKLPYKMYFGGVSALSPDQYLKMNGFPNNYWGWGGEDDDIGVRVSLGGMVISRPSINVGRYKMIKHKHDKGNEVNPKRFNMLAKTRHTWKEDGMNTVEYEIISRDYQPLYANITVNIG 344          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Zebrafish
Match: si:dkey-199f5.8 (si:dkey-199f5.8 [Source:ZFIN;Acc:ZDB-GENE-030131-4733])

HSP 1 Score: 198.749 bits (504), Expect = 1.203e-59
Identity = 87/225 (38.67%), Postives = 140/225 (62.22%), Query Frame = 3
Query:  423 NLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIEL-RHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            N  + ++ AII+P+R R + L+ L+ YL   L+RQ   Y IYI+ Q G   FN+  LMN GF EAM+   +DC+ FHDVDLIPE     Y C + P H ++++D F YKLPY    GGV  +   Q+L +NG+ N YW WG EDDD+ +R++   + ++RP  ++ R++M+KHK  + + +   R  +L+ ++  ++ DG+N++ Y +  R Y  LY ++ +++G
Sbjct:  152 NCEARHRTAIIIPHRSREHHLKFLLYYLHPFLQRQQLNYGIYIIHQAGNYTFNRAKLMNVGFREAMRDEDWDCLFFHDVDLIPEDDRNTYICDAHPKHAAIAMDKFGYKLPYKMYFGGVSALSPDQYLKMNGFPNNYWGWGGEDDDIGVRVSLGGMVISRPSINVGRYKMIKHKHDKGNEVNPKRFNMLAKTRHTWKEDGMNTVEYEIISRDYQPLYANITVNIG 376          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Zebrafish
Match: si:dkey-199f5.8 (si:dkey-199f5.8 [Source:ZFIN;Acc:ZDB-GENE-030131-4733])

HSP 1 Score: 198.749 bits (504), Expect = 1.203e-59
Identity = 87/225 (38.67%), Postives = 140/225 (62.22%), Query Frame = 3
Query:  423 NLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIEL-RHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            N  + ++ AII+P+R R + L+ L+ YL   L+RQ   Y IYI+ Q G   FN+  LMN GF EAM+   +DC+ FHDVDLIPE     Y C + P H ++++D F YKLPY    GGV  +   Q+L +NG+ N YW WG EDDD+ +R++   + ++RP  ++ R++M+KHK  + + +   R  +L+ ++  ++ DG+N++ Y +  R Y  LY ++ +++G
Sbjct:  152 NCEARHRTAIIIPHRSREHHLKFLLYYLHPFLQRQQLNYGIYIIHQAGNYTFNRAKLMNVGFREAMRDEDWDCLFFHDVDLIPEDDRNTYICDAHPKHAAIAMDKFGYKLPYKMYFGGVSALSPDQYLKMNGFPNNYWGWGGEDDDIGVRVSLGGMVISRPSINVGRYKMIKHKHDKGNEVNPKRFNMLAKTRHTWKEDGMNTVEYEIISRDYQPLYANITVNIG 376          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Zebrafish
Match: b4galt6 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6 [Source:ZFIN;Acc:ZDB-GENE-040426-789])

HSP 1 Score: 193.741 bits (491), Expect = 7.796e-59
Identity = 89/220 (40.45%), Postives = 134/220 (60.91%), Query Frame = 3
Query:  441 KLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPS 1100
            K+AI++P+R+R   L IL Q+L  +L+RQ   +  Y++EQ G   FN+ +L N GF EAMK   +DCV+FHDVD IPE+    Y C  +P H +  +D + Y LPY+   GGV  +   QFL +NG+ N +W WG EDDDL+ R++     VTRP   I +++ + H  R +     R+KLL +SK R  LDGLN++ Y+  + +   LY ++ +++ P 
Sbjct:   79 KVAILIPFRNRHEHLPILFQHLTPMLQRQRLQFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDLDWDCVVFHDVDHIPENDRNYYGCGQMPRHFAAKLDKYMYILPYNEFFGGVSGLTVEQFLKINGFPNAFWGWGGEDDDLWNRVHYAGFNVTRPEGDIGKYKSIPHHHRGEVQFLGRYKLLRYSKERQHLDGLNNLQYS-PEISLSNLYKNITVNLNPE 297          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Zebrafish
Match: b4galt3 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-110624-1])

HSP 1 Score: 195.282 bits (495), Expect = 3.284e-58
Identity = 93/221 (42.08%), Postives = 137/221 (61.99%), Query Frame = 3
Query:  447 AIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSL-PTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRH-KLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPSP 1103
            AI+VPYR+R+  L  L+ +L   L+RQ   Y IYIV Q G S FN+  L+N G  E +K   + C+  HDVDL+PE+ +  Y+C    PTHLSV++D F Y+LPYS   GGV  +   Q+L +NG+ N YW WG EDDD+  R+  + +++ RPP +I  ++M+KHK  Q +    R   LL  ++  +R DGLNS++Y +  +    LYT+L +++G  P
Sbjct:  130 AIVVPYRNRQSHLRTLLYHLHPFLQRQQLHYAIYIVHQSGNSTFNRAKLLNVGVREVLKEEDWSCIFLHDVDLLPENDHNTYTCHPQNPTHLSVAMDKFRYRLPYSQYFGGVSAVTPQQYLKMNGFPNQYWGWGGEDDDIAARVRLSGMKIMRPPLAIGHYKMIKHKGDQGNEQNPRRFDLLKRTRLNWRSDGLNSLTYELLSKKLEPLYTNLSVNIGDDP 350          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Xenopus
Match: B4GALT2 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 [Source:NCBI gene;Acc:100492356])

HSP 1 Score: 201.83 bits (512), Expect = 5.320e-61
Identity = 94/252 (37.30%), Postives = 146/252 (57.94%), Query Frame = 3
Query:  351 SILNNKLIEDSTNNLTQIWTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKH-KARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPSP 1103
            S+++ + ++    ++T+       +     K+AII+P+R R + L+  + YL  +LRRQ   Y IYI+ QFG+  FN+  L+N GFLEAMK   +DC +F DVDLIP      Y C   P H ++++D F ++LPY+   GGV  +   QFL +NG+ N YW WG EDDD+Y RI    ++++RP   I R+RM+KH + +   P   R   +  +K   + DG+NS+ Y V       +YT++ +D+G  P
Sbjct:  117 SLMSMERVQRENPDVTEGGRYTPPDCQPKEKVAIIIPFRHREHHLKYWLHYLHPILRRQKVAYGIYIINQFGEDTFNRAKLLNVGFLEAMKEADYDCFIFSDVDLIPMDDRNLYHCYEQPRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLKINGFPNEYWGWGGEDDDIYNRITLNGMKISRPDIRIGRYRMIKHERDKHNEPNPQRFTKIQNTKMTMKKDGINSLHYRVIHSAKYPMYTNITVDIGKPP 368          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Xenopus
Match: ranbp2 (RAN binding protein 2 [Source:Xenbase;Acc:XB-GENE-492821])

HSP 1 Score: 191.815 bits (486), Expect = 2.639e-57
Identity = 89/227 (39.21%), Postives = 139/227 (61.23%), Query Frame = 3
Query:  423 NLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKH---KARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            +  S++K A+I+P+R R   L+ L+ YL   L+RQ   Y IYI+ Q G   FN+  L+N GF EAMK   +DC+ +HDVDLIPE     Y+C   P H S+++D F YKLPY    GGV  +   Q++ +NG+ N YW WG EDDD+ IR+  + + ++RP     R++M+KH   K  +++P   R  +L+ ++  +R DG+NS+ Y +  +    LYT++ +++G
Sbjct:  122 DCESTHKTAVIIPHRGREQHLKYLLYYLHPFLQRQQLNYGIYIIHQAGNFTFNRAKLLNVGFKEAMKDEDWDCLFYHDVDLIPEDDRNIYTCDKFPKHASIAMDKFGYKLPYKSYFGGVSALSPEQYMKMNGFPNNYWGWGGEDDDIGIRVALSGMIISRPSIQHGRYKMIKHGHDKGNEQNP--KRFNMLTKTRRTWRQDGMNSLQYLLLSKELQPLYTNITVNIG 346          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Xenopus
Match: B4GALT3 (beta-1,4-galactosyltransferase 3-like [Source:NCBI gene;Acc:100486704])

HSP 1 Score: 188.348 bits (477), Expect = 1.045e-55
Identity = 94/250 (37.60%), Postives = 150/250 (60.00%), Query Frame = 3
Query:  366 KLIEDSTNNLTQIWTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPES-FNVPYSCSSL-PTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHK--LLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPSP 1103
            K ++D    +T+       N  + ++ AII+P+R+R   L  L+ YL   L+RQ   Y+IYI+ Q G + FN+  L+N G  EA++  ++DC+  HDVDLIPE+ +N+ Y C    P H SV+++ F Y LPY    GGV  +   Q++ +NG+ N YW WG EDDD+  R+    +++TRP  S+  ++M+KHK  Q +  E  H+  LL  ++  ++ DG+NS++Y + +R    LYT++ +DVG  P
Sbjct:   15 KKVQDKNPLVTRGGEYKPPNCEARHRTAIIIPHRNRETHLRHLLYYLHPFLQRQQLHYRIYIINQAGNATFNRAKLLNVGVKEALRDEEWDCLFLHDVDLIPENDYNL-YVCDPWNPKHASVAMNKFSYSLPYPQYFGGVSALTPDQYMKMNGFPNEYWGWGGEDDDIATRVRLAGMKITRPSVSVGHYKMVKHKVDQGN-EENPHRFDLLIRTQRMWKADGMNSLTYTLLERALEPLYTNVTVDVGEDP 262          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Xenopus
Match: nkx6-3 (NK6 homeobox 3 [Source:Xenbase;Acc:XB-GENE-478609])

HSP 1 Score: 187.193 bits (474), Expect = 2.185e-55
Identity = 89/226 (39.38%), Postives = 137/226 (60.62%), Query Frame = 3
Query:  420 CNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKS-PIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            CN  +  K+AII+P+R+R   L+  + Y+  +L+RQ   Y +Y++ Q G   FN+  L+N G++E++K + +DC +F DVDLIP      Y C + P HLS ++D F + LPY+   GGV  +   QFL +NG+ N YW WG EDDD+Y RI +  + ++RP   I R RM++H    K+ P   R  LL+ ++     DG+N++SY V   T   LYT++ +D+G
Sbjct:  136 CN--ALQKVAIIIPFRNRDEHLKYWLYYMHPILKRQQLDYGVYVINQDGDKTFNRAKLLNIGYVESLKDYAYDCFVFSDVDLIPMDDRNTYRCFNQPRHLSAAMDKFGFGLPYNQFFGGVSALSKEQFLKINGFPNNYWGWGGEDDDIYNRIASRGMYISRPDTLIGRCRMIRHNRDDKNDPNPKRFDLLAHTRQTMDSDGINTLSYKVVSTTRFPLYTYITVDIG 359          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Xenopus
Match: b4galt5 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5 [Source:NCBI gene;Acc:548965])

HSP 1 Score: 185.267 bits (469), Expect = 6.306e-55
Identity = 87/222 (39.19%), Postives = 133/222 (59.91%), Query Frame = 3
Query:  441 KLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYA---VQQRTYCELYTHLLIDVGP 1097
            K+AI++P+R+R   L IL ++L  +L++Q   +  Y++EQ G   FN+ +L N GF EAMK  K+DCV+FHDVD IPE+    Y C  +P H +  +D + Y LPY    GGV  +   QF  +NG+ N +W WG EDDDL+ R++     V+RP   I +++ + H  R +     R+KLL +SK R  LDGL+++ YA   + +  Y  +  HL+ ++ P
Sbjct:  120 KVAILIPFRNRHEHLPILFRHLVPMLQKQRLEFAFYVIEQAGTQTFNRAMLFNIGFKEAMKDRKWDCVIFHDVDHIPENDRNYYGCGEMPRHFAAKLDKYMYILPYDEFFGGVSGLTVEQFKKINGFPNAFWGWGGEDDDLWNRVHYAGYNVSRPEGDIGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYLDGLSNLIYAPNIIIEHLYKNITVHLVPELAP 341          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Mouse
Match: B4galt1 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1 [Source:MGI Symbol;Acc:MGI:95705])

HSP 1 Score: 189.504 bits (480), Expect = 5.425e-56
Identity = 89/222 (40.09%), Postives = 136/222 (61.26%), Query Frame = 3
Query:  432 SSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKH-KARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            S +K+AII+P+R+R+  L+  + YL  +L+RQ   Y IY++ Q G + FN+  L+N GF EA+K + ++C +F DVDLIP      Y C S P H+SV++D F + LPY    GGV  +   QFL +NG+ N YW WG EDDD++ R+    + ++RP A + R RM++H + ++  P   R   ++ +K   R DGLNS++Y V       LYT + +D+G
Sbjct:  175 SPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGDTMFNRAKLLNIGFQEALKDYDYNCFVFSDVDLIPMDDRNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLAINGFPNNYWGWGGEDDDIFNRLVHKGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMRFDGLNSLTYKVLDVQRYPLYTQITVDIG 396          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Mouse
Match: B4galt2 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1858493])

HSP 1 Score: 186.037 bits (471), Expect = 4.576e-55
Identity = 83/226 (36.73%), Postives = 136/226 (60.18%), Query Frame = 3
Query:  423 NLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKL-WKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKH-KARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            + + +  +A+I+P+R R + L   + YL  +LRRQ   Y +Y++ Q G+  FN+  L+N GFLEA+K    +DC +F DVDL+P      Y C   P H ++++D F ++LPY+   GGV  +   QFL +NG+ N YW WG EDDD++ RI+ T ++++RP   I R+RM+KH + +   P   R   +  +K   + DG+ S+ Y V + +   L+T++ +D+G
Sbjct:  135 DCTPAQTVAVIIPFRHREHHLRYWLHYLHPMLRRQRLRYGVYVINQHGEETFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYASYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDVRIGRYRMIKHDRDKHNEPNPQRFNKIQNTKMSMKWDGIGSVRYRVLEVSRQPLFTNITVDIG 360          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Mouse
Match: B4galt2 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1858493])

HSP 1 Score: 186.037 bits (471), Expect = 4.576e-55
Identity = 83/226 (36.73%), Postives = 136/226 (60.18%), Query Frame = 3
Query:  423 NLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKL-WKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKH-KARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            + + +  +A+I+P+R R + L   + YL  +LRRQ   Y +Y++ Q G+  FN+  L+N GFLEA+K    +DC +F DVDL+P      Y C   P H ++++D F ++LPY+   GGV  +   QFL +NG+ N YW WG EDDD++ RI+ T ++++RP   I R+RM+KH + +   P   R   +  +K   + DG+ S+ Y V + +   L+T++ +D+G
Sbjct:  135 DCTPAQTVAVIIPFRHREHHLRYWLHYLHPMLRRQRLRYGVYVINQHGEETFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYASYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDVRIGRYRMIKHDRDKHNEPNPQRFNKIQNTKMSMKWDGIGSVRYRVLEVSRQPLFTNITVDIG 360          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Mouse
Match: B4galt2 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1858493])

HSP 1 Score: 186.037 bits (471), Expect = 4.576e-55
Identity = 83/226 (36.73%), Postives = 136/226 (60.18%), Query Frame = 3
Query:  423 NLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKL-WKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKH-KARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            + + +  +A+I+P+R R + L   + YL  +LRRQ   Y +Y++ Q G+  FN+  L+N GFLEA+K    +DC +F DVDL+P      Y C   P H ++++D F ++LPY+   GGV  +   QFL +NG+ N YW WG EDDD++ RI+ T ++++RP   I R+RM+KH + +   P   R   +  +K   + DG+ S+ Y V + +   L+T++ +D+G
Sbjct:  135 DCTPAQTVAVIIPFRHREHHLRYWLHYLHPMLRRQRLRYGVYVINQHGEETFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYASYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDVRIGRYRMIKHDRDKHNEPNPQRFNKIQNTKMSMKWDGIGSVRYRVLEVSRQPLFTNITVDIG 360          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Mouse
Match: B4galt5 (UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5 [Source:MGI Symbol;Acc:MGI:1927169])

HSP 1 Score: 186.422 bits (472), Expect = 5.508e-55
Identity = 92/269 (34.20%), Postives = 146/269 (54.28%), Query Frame = 3
Query:  294 EQMMKIMDPNLLTVEQITDSILNNKLIEDSTNNLTQIWTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPS 1100
            E++  +  P  + + +I    ++     D    L   W    C      K+AI++P+R+R   L +L+++L  +L+RQ   +  Y++EQ G   FN+ +L N GF EAMK   +DC++FHDVD IPES    Y C  +P H +  +D + Y LPY+   GGV  +   QF  +NG+ N +W WG EDDDL+ R+      V+RP     +++ + H  R +     R+ LL  SK R  LDGLN+++Y+    TY  LY ++ +++ P 
Sbjct:  116 ERLPSMKGPIDINMSEIAMDDIHELFSRDPAIKLGGHWKPADC--VPRWKVAILIPFRNRHEHLPVLLRHLLPMLQRQRLQFAFYVIEQVGTQPFNRAMLFNVGFQEAMKDLDWDCLIFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLNYSANV-TYDALYKNITVNLTPE 381          
BLAST of Beta-1,4-galactosyltransferase 4 vs. UniProt/SwissProt
Match: sp|A8Y1P7|BRE4_CAEBR (Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Caenorhabditis briggsae OX=6238 GN=bre-4 PE=3 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 1.417e-59
Identity = 93/221 (42.08%), Postives = 140/221 (63.35%), Query Frame = 3
Query:  432 SSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPI-ELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDV 1091
            + +++AIIVPYRDR   L I++  L  LL +Q   Y I++VEQ     FN+G LMN G+  A +L+ + C +FHDVDL+PE     Y+C   P H+SV+ID F YKLPYS + GG+  +       +NG+SN +W WG EDDDL  R +   L+V+R PA IAR++M+KH     +P+ + R+K++  +K R++ DGL+S+ Y + +     LYT  ++D+
Sbjct:  147 ARHRVAIIVPYRDREAHLRIMLHNLHSLLAKQQLDYAIFVVEQVANQTFNRGKLMNVGYDVASRLYPWQCFIFHDVDLLPEDDRNLYTCPIQPRHMSVAIDKFHYKLPYSAIFGGISALTQEHVKAINGFSNDFWGWGGEDDDLATRTSQAGLKVSRYPAQIARYKMIKHSTEATNPVNKCRYKIMGQTKRRWKTDGLSSLKYKLVKLELKPLYTRAVVDL 367          
BLAST of Beta-1,4-galactosyltransferase 4 vs. UniProt/SwissProt
Match: sp|Q9GUM2|BRE4_CAEEL (Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Caenorhabditis elegans OX=6239 GN=bre-4 PE=1 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 6.053e-58
Identity = 92/221 (41.63%), Postives = 138/221 (62.44%), Query Frame = 3
Query:  432 SSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPI-ELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDV 1091
            + +++AIIVPYRDR   L I++  L  LL +Q   Y I+IVEQ     FN+G LMN G+  A +L+ + C +FHDVDL+PE     Y+C   P H+SV+ID F+YKLPYS + GG+  +       +NG+SN +W WG EDDDL  R +   L+V+R P  IAR++M+KH     +P+ + R+K++  +K R+  DGL+++ Y +       LYT  ++D+
Sbjct:  146 ARHRVAIIVPYRDREAHLRIMLHNLHSLLAKQQLDYAIFIVEQVANQTFNRGKLMNVGYDVASRLYPWQCFIFHDVDLLPEDDRNLYTCPIQPRHMSVAIDKFNYKLPYSAIFGGISALTKDHLKKINGFSNDFWGWGGEDDDLATRTSMAGLKVSRYPTQIARYKMIKHSTEATNPVNKCRYKIMGQTKRRWTRDGLSNLKYKLVNLELKPLYTRAVVDL 366          
BLAST of Beta-1,4-galactosyltransferase 4 vs. UniProt/SwissProt
Match: sp|P08037|B4GT1_BOVIN (Beta-1,4-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=B4GALT1 PE=1 SV=3)

HSP 1 Score: 191.045 bits (484), Expect = 8.685e-56
Identity = 97/246 (39.43%), Postives = 149/246 (60.57%), Query Frame = 3
Query:  366 KLIEDSTNN--LTQIWTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKH-KARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            KL+E       L   +T + C   S +K+AII+P+R+R+  L+  + YL  +L+RQ   Y IY++ Q G+S FN+  L+N GF EA+K + ++C +F DVDLIP + +  Y C S P H+SV++D F + LPY    GGV  +   QFL++NG+ N YW WG EDDD+Y R+    + V+RP A I + RM++H + ++  P   R   ++ +K     DGLNS++Y V +     LYT + +D+G
Sbjct:  156 KLVEQQNPKVKLGGRYTPMDC--ISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIG 399          
BLAST of Beta-1,4-galactosyltransferase 4 vs. UniProt/SwissProt
Match: sp|P15535|B4GT1_MOUSE (Beta-1,4-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B4galt1 PE=1 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 3.795e-55
Identity = 89/222 (40.09%), Postives = 136/222 (61.26%), Query Frame = 3
Query:  432 SSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKH-KARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            S +K+AII+P+R+R+  L+  + YL  +L+RQ   Y IY++ Q G + FN+  L+N GF EA+K + ++C +F DVDLIP      Y C S P H+SV++D F + LPY    GGV  +   QFL +NG+ N YW WG EDDD++ R+    + ++RP A + R RM++H + ++  P   R   ++ +K   R DGLNS++Y V       LYT + +D+G
Sbjct:  175 SPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGDTMFNRAKLLNIGFQEALKDYDYNCFVFSDVDLIPMDDRNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLAINGFPNNYWGWGGEDDDIFNRLVHKGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMRFDGLNSLTYKVLDVQRYPLYTQITVDIG 396          
BLAST of Beta-1,4-galactosyltransferase 4 vs. UniProt/SwissProt
Match: sp|Q9Z2Y2|B4GT2_MOUSE (Beta-1,4-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B4galt2 PE=2 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 3.201e-54
Identity = 83/226 (36.73%), Postives = 136/226 (60.18%), Query Frame = 3
Query:  423 NLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKL-WKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKH-KARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            + + +  +A+I+P+R R + L   + YL  +LRRQ   Y +Y++ Q G+  FN+  L+N GFLEA+K    +DC +F DVDL+P      Y C   P H ++++D F ++LPY+   GGV  +   QFL +NG+ N YW WG EDDD++ RI+ T ++++RP   I R+RM+KH + +   P   R   +  +K   + DG+ S+ Y V + +   L+T++ +D+G
Sbjct:  135 DCTPAQTVAVIIPFRHREHHLRYWLHYLHPMLRRQRLRYGVYVINQHGEETFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYASYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDVRIGRYRMIKHDRDKHNEPNPQRFNKIQNTKMSMKWDGIGSVRYRVLEVSRQPLFTNITVDIG 360          
BLAST of Beta-1,4-galactosyltransferase 4 vs. TrEMBL
Match: A0A1I8IRU9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 5.673e-78
Identity = 120/234 (51.28%), Postives = 159/234 (67.95%), Query Frame = 3
Query:  423 NLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMK-LWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPSPF*CSFF 1121
            + S    + I+VPYR R   L  L+ YL  +L+RQ  CY I + EQ+G + FNK  LMNA FLE+++ L +FDCV+FHDVDL+P +  VPY+C + P H+SVSID F Y LPY  LVGGV+ M    FL +NGYSN++W WG EDDD+  RI +  L VTRP   +AR+RM++H+AR++   E+R+KLL  S  RYRLDGLNS+SY++       LYTH LID+G  P   SF+
Sbjct:   29 DCSPGKSVLILVPYRQREQHLAALLSYLHPILQRQQLCYSIVVGEQYGNATFNKAKLMNAAFLESVRQLRRFDCVVFHDVDLLPTNPFVPYNCPAYPRHISVSIDKFGYSLPYKQLVGGVLAMPVRHFLKVNGYSNLFWGWGGEDDDMEARIRSVGLLVTRPNPRLARYRMIRHQARKEILNEVRYKLLYLSSKRYRLDGLNSLSYSLVASESRPLYTHFLIDLGQPPRSSSFY 262          
BLAST of Beta-1,4-galactosyltransferase 4 vs. TrEMBL
Match: E0W2U3 (Xylosylprotein beta4-galactosyltransferase, putative OS=Pediculus humanus subsp. corporis OX=121224 GN=8236822 PE=4 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 2.743e-75
Identity = 115/228 (50.44%), Postives = 161/228 (70.61%), Query Frame = 3
Query:  423 NLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG-PSP 1103
            N  S + +AII+PY+DR + L  L+ +L  LL+RQ   Y++Y+VEQFG   FNKG+LMNAGFLEA+K   + C +FHDVDLIPE+ +  Y+C  +P HLS +++  +YKLPY+ LVGG   +KT  F  +NGYSN YW WG EDDD+ +RI  TN+ + RP  +I R+ M+KH  R+ S +E+RH+LLS SK RYR +GLNS++Y + ++T    +T +LID+G P P
Sbjct:  200 NCLSKHSVAIIIPYKDRWHHLTTLLNFLHPLLQRQEIRYKLYVVEQFGNETFNKGILMNAGFLEALKEEIYHCFIFHDVDLIPENDHNMYTCPEMPRHLSPAVNELNYKLPYAQLVGGAFAIKTDHFFRVNGYSNFYWGWGGEDDDMGLRIEQTNMTIIRPLPNIGRYTMIKHVKRKPSDVEIRHRLLSTSKRRYRYEGLNSVNYKLIKKTQYPWFTTILIDIGKPHP 427          
BLAST of Beta-1,4-galactosyltransferase 4 vs. TrEMBL
Match: A0A2C9K9U5 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106063880 PE=4 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 2.432e-73
Identity = 111/230 (48.26%), Postives = 158/230 (68.70%), Query Frame = 3
Query:  405 WTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            W    C   S +++AII+PYRDR   L++L+ YL   L+RQ   ++I++VEQ+G   FNKG +MNA F EA++L+ F CV FHDVDL+PE     YSC+  P H+S+SID F Y LPY  LVGGV++ +T  F  +NGYSNMYW WGAEDDD+  RI    L++ RPP++IAR++M+KH+ R+ S + +R KLL  +  R +L+GLN++ Y +      EL+TH ++D+G
Sbjct:  283 WRPPSC--ISRHRVAIIIPYRDRWNHLKVLLHYLIPTLKRQQIHFRIFVVEQYGNETFNKGRIMNAAFREALQLFDFQCVTFHDVDLVPEDDRNMYSCTEQPKHMSISIDKFQYTLPYQGLVGGVLMFRTDHFQLVNGYSNMYWGWGAEDDDMTTRILHRGLRIYRPPSNIARYKMVKHEGRKGSEVAVRMKLLRSAARRSKLEGLNNVQYKLVSTQIRELFTHFIVDIG 510          
BLAST of Beta-1,4-galactosyltransferase 4 vs. TrEMBL
Match: T1IG47 (Uncharacterized protein (Fragment) OS=Rhodnius prolixus OX=13249 PE=4 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 4.933e-73
Identity = 117/255 (45.88%), Postives = 166/255 (65.10%), Query Frame = 3
Query:  366 KLIEDSTNNLTQI-----WTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWK----FDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPSP 1103
            K  E+S +N  Q      W+   CN  S + +AIIVPYR+R  QL++LI++L  +L+RQ   Y+I+I+EQ G   FNKG+LMNAGFL A+        ++C +FHDVDL+PE     Y+C   P HLSV+++  +Y+LPY  LVGGV  ++T  FL +NGYSN+YW WG EDDD+ +R+      ++RPP  IAR+ M+KH+ R+    ++RHKLL  S  RYRLDGLN++ Y + + +    YTH+ +DVG  P
Sbjct:   28 KHAEESDDNTMQPHFGGSWSPTDCN--SRHSVAIIVPYRNREKQLKLLIKFLPPVLQRQQISYRIFIIEQLGNETFNKGILMNAGFLTALDNPAHGVLYNCFIFHDVDLLPEDDRNMYTCPQQPRHLSVAVNELNYRLPYRVLVGGVFAIRTDHFLRVNGYSNLYWGWGGEDDDMGLRVEHVLNSISRPPEWIARYTMIKHEKRRPLSYKVRHKLLRTSWRRYRLDGLNTVQYGLGKISEQPGYTHVTVDVGQPP 280          
BLAST of Beta-1,4-galactosyltransferase 4 vs. TrEMBL
Match: A0A2P6KD67 (Bre-4 OS=Nephila clavipes OX=2585209 GN=NCL1_44246 PE=4 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 6.247e-73
Identity = 110/230 (47.83%), Postives = 152/230 (66.09%), Query Frame = 3
Query:  405 WTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            WT   C   + +++A+I+PYRDR   L  L+  L  LL+RQ+  Y++Y+VEQ+G   FNKG+LMNAG  EA++   F C +FHDVD+IPE     YSC  +P HLSV++D F+Y LPY+ LVGGV  ++   FL +NGYSN+YW WG EDDD+  RI    L++ RPP ++AR+ M+KH  R +SP  +R  LL  +K R   DGLN++ Y V  R     YTHL++D+G
Sbjct:   36 WTPRGC--VAQHRVALIIPYRDRVEHLATLLYTLHPLLQRQLLEYRVYVVEQYGNETFNKGVLMNAGVREALRDSDFHCFVFHDVDMIPEDDRNLYSCPEMPRHLSVAVDKFNYTLPYTLLVGGVFSIRLEHFLAVNGYSNLYWGWGGEDDDMAYRIKYRKLEILRPPETLARYSMIKHDHRPESPNAIRTALLRMAKKRSSRDGLNTVKYRVVWRHEHLAYTHLMVDIG 263          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Cavefish
Match: si:dkey-199f5.8 (beta-1,4-galactosyltransferase 3-like [Source:NCBI gene;Acc:103031892])

HSP 1 Score: 201.06 bits (510), Expect = 1.358e-60
Identity = 89/225 (39.56%), Postives = 139/225 (61.78%), Query Frame = 3
Query:  423 NLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIEL-RHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            +  + ++ AII+P+R+R   L+ L+ YL   L+RQ   Y IY++ Q G   FN+  LMN GF EAM+   ++C+ FHDVDLIPE     Y+C   P H ++++D F YKLPY    GGV  +    +L +NG+ N YW WG EDDD+ IR++   + +TRP   + R++M+KHK  Q + +   R  +L+ ++  ++LDG+NS  Y V  R +  LYT++ +++G
Sbjct:  123 DCEARHRTAIIIPHRNRENHLKFLLYYLHPFLQRQQLNYAIYVIHQAGNYTFNRAKLMNVGFREAMREEDWNCLFFHDVDLIPEDDRNTYTCDQNPKHAAIAMDKFGYKLPYKMYFGGVSALSPLHYLKMNGFPNNYWGWGGEDDDIGIRVSLAGMVITRPSVKVGRYKMIKHKLDQGNEVNPKRFNMLAKTRQTWKLDGMNSAEYEVISREHLPLYTNITVNIG 347          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Cavefish
Match: b4galt6 (beta-1,4-galactosyltransferase 6 [Source:NCBI gene;Acc:103035788])

HSP 1 Score: 192.971 bits (489), Expect = 4.121e-58
Identity = 90/220 (40.91%), Postives = 133/220 (60.45%), Query Frame = 3
Query:  441 KLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPS 1100
            K+AI++P+R+R   L IL Q+L  +L+RQ   +  YI+EQ G   FN+ +L N GF EAMK   +DCV+FHDVD IPE+    Y C  +P H +  +D + Y LPYS   GGV  +   QF  +NG+ N +W WG EDDDL+ R++     VTRP   I +++ + H  R +     R+KLL +SK R  LDGLN++ Y+  + +   LY ++ +++ P 
Sbjct:  117 KVAILIPFRNRHEHLPILFQHLAPMLQRQRLQFAFYIIEQTGTQPFNRAMLFNVGFKEAMKDLDWDCVVFHDVDHIPENDRNYYGCGQMPRHFATKLDKYMYILPYSEFFGGVSGLTVEQFHKINGFPNAFWGWGGEDDDLWNRVHFAGFNVTRPEGEIGKYKSIPHHHRGEVQFLGRYKLLRYSKERQHLDGLNNLQYS-PEISLSSLYKNITVNLSPE 335          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Cavefish
Match: b4galt6 (beta-1,4-galactosyltransferase 6 [Source:NCBI gene;Acc:103035788])

HSP 1 Score: 193.356 bits (490), Expect = 7.699e-58
Identity = 90/220 (40.91%), Postives = 133/220 (60.45%), Query Frame = 3
Query:  441 KLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPS 1100
            K+AI++P+R+R   L IL Q+L  +L+RQ   +  YI+EQ G   FN+ +L N GF EAMK   +DCV+FHDVD IPE+    Y C  +P H +  +D + Y LPYS   GGV  +   QF  +NG+ N +W WG EDDDL+ R++     VTRP   I +++ + H  R +     R+KLL +SK R  LDGLN++ Y+  + +   LY ++ +++ P 
Sbjct:  156 KVAILIPFRNRHEHLPILFQHLAPMLQRQRLQFAFYIIEQTGTQPFNRAMLFNVGFKEAMKDLDWDCVVFHDVDHIPENDRNYYGCGQMPRHFATKLDKYMYILPYSEFFGGVSGLTVEQFHKINGFPNAFWGWGGEDDDLWNRVHFAGFNVTRPEGEIGKYKSIPHHHRGEVQFLGRYKLLRYSKERQHLDGLNNLQYS-PEISLSSLYKNITVNLSPE 374          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Cavefish
Match: b4galt1l (beta-1,4-galactosyltransferase 1-like [Source:NCBI gene;Acc:103039461])

HSP 1 Score: 192.2 bits (487), Expect = 1.344e-57
Identity = 88/222 (39.64%), Postives = 138/222 (62.16%), Query Frame = 3
Query:  441 KLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKH-KARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPSP 1103
            K+AII+P+R R   L+  + YL  +L+RQ   Y +YI+ Q G   FN+  L+N G+ EA+K + ++C +F DVDLIP      Y C S P HLSVS+D F ++LPY+   GGV  M   QFL +NG+ N YW WG EDDD++ R+++  + ++RP  +I + RM++H + +Q  P   R   ++ ++     DG+NS+SY V +    +L+T + +D+G +P
Sbjct:  134 KVAIIIPFRKRDEHLKFWLYYLHPILQRQQLDYGVYIINQDGDETFNRAKLLNVGYAEALKEYGYECFVFSDVDLIPMDDRNTYKCFSQPRHLSVSMDKFGFRLPYNQYFGGVSSMSKEQFLKINGFPNNYWGWGGEDDDIFNRLSSKGMSISRPSGAIGKCRMIRHDRDKQNDPNPQRFDRIAHTRETMHKDGINSLSYKVVKVEKDQLFTKITVDLGEAP 355          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Cavefish
Match: b4galt2 (beta-1,4-galactosyltransferase 2 [Source:NCBI gene;Acc:103033307])

HSP 1 Score: 191.815 bits (486), Expect = 3.712e-57
Identity = 90/245 (36.73%), Postives = 141/245 (57.55%), Query Frame = 3
Query:  372 IEDSTNNLTQIWTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKH-KARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPSP 1103
            ++    N+T+       +     K+AII+P+R R + L+  + YL  +LRRQ   Y IYI+ Q G+  FN+  L+N G+ EA+K  ++DC +F DVDLIP      Y C   P H ++++D F ++LPY+   GGV  +   QFL +NG+ N YW WG EDDD+Y RI    ++V+RP   I R+RM+KH + +   P   R   +  +K   R DG++S++Y +       LYT++ +++G  P
Sbjct:  131 VQRENPNVTEGGKYTPTDCRPKQKVAIIIPFRHRDHHLKYWLHYLHPILRRQKIDYGIYIINQLGEDTFNRAKLLNVGYTEALKDAEYDCFIFSDVDLIPMDDRNLYHCYDQPRHFAIAMDKFGFRLPYAGYFGGVSGLSKKQFLKINGFPNEYWGWGGEDDDIYNRITLNGMKVSRPDVRIGRYRMIKHERDKHNEPNPQRFNKIQNTKNTMRKDGISSLTYRLASVKKYPLYTNISVEIGKPP 375          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Sea Lamprey
Match: B4GALT1 (beta-1,4-galactosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:924])

HSP 1 Score: 191.045 bits (484), Expect = 1.292e-58
Identity = 91/226 (40.27%), Postives = 135/226 (59.73%), Query Frame = 3
Query:  420 CNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKH-KARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
             N  S  K+AII+P+R R   L+  + YL  +L+RQ   Y IYIV QFG+  FN+  LMN G++EA+K   +DC +F DVDL+P      Y C   P H SV++D F + LPY+   GGV  +   QF  +NG+ N YW WG EDDD+Y R++   + ++RP   I R RM++H   +   P   R  L+  +++    DG+NS+ Y++ ++T   LYT+L ++VG
Sbjct:   75 ANCISKQKVAIIIPFRHRDEHLKYWLYYLHPILQRQTIEYGIYIVNQFGEGVFNRAKLMNIGYVEALKDAPYDCFIFSDVDLVPMDDRNLYRCYDNPRHFSVAMDKFGFHLPYNSYFGGVSGLSKAQFEKINGFPNNYWGWGGEDDDIYTRVSLAGMHISRPSGEIGRCRMIRHTNDKNNEPNPQRFNLIQSTRSTMWKDGINSLQYSLVEKTLYPLYTNLTVNVG 300          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Sea Lamprey
Match: b4galt2 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-070912-258])

HSP 1 Score: 184.496 bits (467), Expect = 3.544e-55
Identity = 88/225 (39.11%), Postives = 135/225 (60.00%), Query Frame = 3
Query:  432 SSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKS-PIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPSP 1103
            SS K+AII+P+R R   L+  + YL  +L+RQ   Y +Y++ QFG+  FN+  LMN G++EA+K   +DC +F DVDL+P      Y C   P H SV++D F ++LPY+   GGV  +   Q+L +NG+ N YW WG EDDD+Y R+    ++++RP  S+ R+RM+KH    K+ P   R   +  ++     DG+N++ Y   +     LYT++ +DVG  P
Sbjct:  140 SSQKVAIIIPFRHRDEHLKHWLYYLHPVLQRQRVEYGVYVLNQFGEGMFNRAKLMNIGYVEALKDAPYDCFIFSDVDLVPMDDRNLYRCYDNPRHFSVAMDKFSFRLPYNSYFGGVSGLSKAQYLKINGFPNEYWGWGGEDDDIYNRVVVQGMRLSRPDGSLGRYRMVKHARDAKNEPNPKRFTQIKNTRHNMGRDGINTLKYRHVETVRQPLYTNVTVDVGKMP 364          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Sea Lamprey
Match: B4GALT1 (beta-1,4-galactosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:924])

HSP 1 Score: 178.333 bits (451), Expect = 1.191e-53
Identity = 96/267 (35.96%), Postives = 147/267 (55.06%), Query Frame = 3
Query:  321 NLLTVEQITDSILNN----KLIEDSTNNLTQIWTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKA---RQKSPIELRHKLLSFSKARYRL--DGLNSISYAVQQRTYCELYTHLLIDVG 1094
            +LLTV  +  S +      + IE S  N+         +   S K+AIIVP+R R   L+  + YL  +L+RQ   Y +YIV QFG+  FN+  LMN G++EA+K   +DC +F DVDL+P      Y C   P H SV++D F++ LPY    GGV  +   QF  +NG+ N YW WG EDDD+Y RI    + ++RP  +I R+RM++H      + +P     +    +K  + +  DG+N++ Y + +     LYT ++++VG
Sbjct:   25 SLLTVGAMNVSFVKTPQSLEAIEKSNPNVELGGQFHPSDCIPSQKVAIIVPFRHRDEHLKHWLYYLHPILQRQRVEYGVYIVNQFGEGVFNRAKLMNIGYVEALKDAPYDCFIFSDVDLVPMDDRNLYRCYDNPRHFSVAVDKFNFSLPYKECFGGVSGLTKKQFEKINGFPNNYWGWGGEDDDIYNRIRKVGMNISRPDMTIGRYRMIRHNRDAHNENNPF----RSWQITKTAFTMWRDGINTLEYKLIKAERWPLYTKVIVEVG 287          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Sea Lamprey
Match: B4GALT1 (beta-1,4-galactosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:924])

HSP 1 Score: 170.629 bits (431), Expect = 3.759e-52
Identity = 81/178 (45.51%), Postives = 111/178 (62.36%), Query Frame = 3
Query:  564 GQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKA-RQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            G   FN+  LMN G++EA++   FDC +F DVDLIP      Y C   P HLSV++D FD++LPY    GGV  +   QF T+NG+SN+YW WG EDDD + R  A+ L V+RP A I R+ M+KHKA     P   R  L+  + +R + DGLNS+ Y + +RT   LYT+L +++G
Sbjct:    1 GNGIFNRAKLMNVGYVEALRDAPFDCFIFSDVDLIPLDDRNLYRCGEQPQHLSVAVDKFDFRLPYLQSFGGVSALSRAQFKTINGFSNLYWGWGGEDDDFFRRTVASGLHVSRPRAGIGRYTMVKHKADAHNEPNPQRFHLIRRAVSRMKWDGLNSLHYLLVKRTMSPLYTNLTVNIG 178          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004173.1 (pep scaffold:Pmarinus_7.0:GL478483:39914:44753:1 gene:ENSPMAG00000003809.1 transcript:ENSPMAT00000004173.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.145 bits (261), Expect = 4.736e-27
Identity = 55/148 (37.16%), Postives = 90/148 (60.81%), Query Frame = 3
Query:  423 NLSSSNKLAIIVPYRDR-RYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSL--PTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDD 857
            N  + ++ A++VP   R R +L +L++ L  +L+RQ   Y +Y+V+Q     F +  L+N G  EA+   +F+C++ HDVDL+PE+    Y+C     P HL+V+ID F YKLPY    GGV  +   Q++ +NG+ + +W  GA+D+
Sbjct:   51 NCEARHRTAVVVPSGSRDRVRLRVLLRRLHGVLQRQQLEYTVYVVQQVTDGPFYRAWLLNVGVREALSDAEFECLVMHDVDLLPENDRNLYTCEPQLGPKHLAVAIDKFRYKLPYESYFGGVAALTPGQYMRINGFPSNHWGRGADDE 198          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Nematostella
Match: EDO48920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHV5])

HSP 1 Score: 194.126 bits (492), Expect = 4.990e-60
Identity = 95/230 (41.30%), Postives = 136/230 (59.13%), Query Frame = 3
Query:  405 WTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIEL-RHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDV 1091
            W   +C   +  K+A+IVP+R R  QL I ++++  +L+RQ   Y+I IVEQ G + FN+ +L N G+ E++K   FDC +FHDVDLIPE     YSC + P H+S ++D F+Y LPY+ + GG    K   F  +NG+SN +W WG EDDDLY RI A    +TRP   I R++M++    Q S  +  R  LL     R   DGLN+++Y + +     LYT + I V
Sbjct:   22 WKPTEC--KARTKVALIVPFRKRYEQLGIFVRHMHPMLKRQNVEYRIIIVEQSGDTPFNRAILFNIGYKESLKFNNFDCFIFHDVDLIPEDDRNEYSCPTSPRHMSAAVDKFNYHLPYASIFGGAGSFKRKDFEEINGFSNKFWGWGGEDDDLYQRITAKGFHLTRPSLQIGRYKMVRTHHHQSSKADPNRFALLQNPVERMPRDGLNTLAYKLLEVKEESLYTIITIHV 249          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Nematostella
Match: EDO37163 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGJ5])

HSP 1 Score: 159.073 bits (401), Expect = 1.539e-47
Identity = 77/173 (44.51%), Postives = 101/173 (58.38%), Query Frame = 3
Query:  576 FNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            FN+G+LMN GF EAMK   +DC +FHD+DLIPE     YSC S P H+S ++DT  YKL Y  L GGV       +  +NG+ N YW WG EDDDLY+RI   +L +TRP   I R+ MLKH  ++      RH  L  S+   + DGL+ + Y V       LYT + + +G
Sbjct:    3 FNRGMLMNVGFQEAMKADIYDCAIFHDIDLIPEDDRNDYSCPSSPRHMSTAVDTMKYKLGYKKLFGGVEAFWPEHYRKVNGFPNRYWGWGGEDDDLYVRIVEHSLTLTRPAHQIGRYTMLKHGHKKSDKNPDRHAQLQQSQTHLKTDGLSVLKYDVISSMEHPLYTMIGVKLG 175          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Nematostella
Match: EDO48803 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIF8])

HSP 1 Score: 99.3673 bits (246), Expect = 3.729e-24
Identity = 67/224 (29.91%), Postives = 111/224 (49.55%), Query Frame = 3
Query:  444 LAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYS-CSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPP--ASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLD---GLNSISYAVQQRTYCELYTHLLIDVGP 1097
            L ++VPYR+R  +L   + +++K L  +   ++I+I+ Q  + +FN+  L+N G+L A    + D ++ HDVDL+P +  + Y      P H+S        K  Y   VGG+++M   QF  +NG SN +W WG EDD+LY R+    L + R    A    +   KH    +       +L +  K  +R D   G +++ Y +Q +        L+ID  P
Sbjct:   15 LGVVVPYRNRFEELLEFVPHMNKFLSEKKIRHRIFIMNQVDKHRFNRASLLNVGYLVARN--ECDYIVMHDVDLLPLNSKLFYGYPEKGPFHISSP--HLHPKYHYRTFVGGILMMTLEQFEKVNGLSNKFWGWGREDDELYQRMMEAGLTLYRHGKNAITTGYNTFKHDHDPQLRKRDYARLYNQKKESFRRDRDTGADTVEYTIQSK------RQLMIDGTP 228          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Medaka
Match: si:dkey-199f5.8 (beta-1,4-galactosyltransferase 3 [Source:NCBI gene;Acc:101162708])

HSP 1 Score: 202.216 bits (513), Expect = 2.715e-61
Identity = 90/223 (40.36%), Postives = 140/223 (62.78%), Query Frame = 3
Query:  429 SSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIEL-RHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
             + +K AII+P+R+R + L+ L+ +L   L+RQ   Y IYI+ Q G   FN+  LMN GF EAM+   +DC+ FHDVDLIPE     Y C + P H ++++D F YKLPY+   GGV  +   Q+L +NG+ N YW WG EDDD+ IR++   + ++RPP    R++M+KH   Q + +   R  +L+ ++  ++LDG+NS+ Y +  R Y  LY ++ +++G
Sbjct:  125 EARHKTAIIIPHRNREHHLKYLLYFLHPFLQRQQLNYGIYIIHQAGNYTFNRAKLMNIGFREAMREEDWDCLFFHDVDLIPEDDRNTYICDANPKHAAIAMDKFGYKLPYNMYFGGVSALSPLQYLKMNGFPNNYWGWGGEDDDIGIRVSLAGMHISRPPLKHGRYKMIKHNLDQGNDVNPKRFNMLAKTRQTWKLDGMNSLEYELVSRQYLPLYANITVNIG 347          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Medaka
Match: b4galt6 (beta-1,4-galactosyltransferase 6 [Source:NCBI gene;Acc:101160972])

HSP 1 Score: 194.512 bits (493), Expect = 1.175e-58
Identity = 91/220 (41.36%), Postives = 136/220 (61.82%), Query Frame = 3
Query:  441 KLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPS 1100
            K+AI++P+R+R   L IL Q+L  +L+RQ   +  Y++EQ G   FN+ +L N GFLEAMK   +DC++FHDVD IPE+    Y C  +P H +  +D + Y LPY    GGV  +   QF  +NG+ N +W WG EDDDL+ R++  +L VTRP   I R++ + H  R +     R+KLL +S+ R +LDGLN++ Y+    +   LYT++ +D+ P 
Sbjct:  117 KVAILIPFRNRHEHLPILFQHLIPMLQRQRLQFGFYVIEQSGSQPFNRAMLFNVGFLEAMKDLDWDCLIFHDVDHIPENDRNYYGCGRMPRHFAAKLDKYMYILPYHEFFGGVSGLTVDQFRKINGFPNAFWGWGGEDDDLWNRVHFADLNVTRPEGEIGRYKSIPHHHRGEVQFLGRYKLLRYSRERQQLDGLNNLHYSPHT-SISSLYTNISVDLYPE 335          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Medaka
Match: b4galt6 (beta-1,4-galactosyltransferase 6 [Source:NCBI gene;Acc:101160972])

HSP 1 Score: 194.897 bits (494), Expect = 1.940e-58
Identity = 91/220 (41.36%), Postives = 136/220 (61.82%), Query Frame = 3
Query:  441 KLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPS 1100
            K+AI++P+R+R   L IL Q+L  +L+RQ   +  Y++EQ G   FN+ +L N GFLEAMK   +DC++FHDVD IPE+    Y C  +P H +  +D + Y LPY    GGV  +   QF  +NG+ N +W WG EDDDL+ R++  +L VTRP   I R++ + H  R +     R+KLL +S+ R +LDGLN++ Y+    +   LYT++ +D+ P 
Sbjct:  156 KVAILIPFRNRHEHLPILFQHLIPMLQRQRLQFGFYVIEQSGSQPFNRAMLFNVGFLEAMKDLDWDCLIFHDVDHIPENDRNYYGCGRMPRHFAAKLDKYMYILPYHEFFGGVSGLTVDQFRKINGFPNAFWGWGGEDDDLWNRVHFADLNVTRPEGEIGRYKSIPHHHRGEVQFLGRYKLLRYSRERQQLDGLNNLHYSPHT-SISSLYTNISVDLYPE 374          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Medaka
Match: b4galt1l (beta-1,4-galactosyltransferase 1 [Source:NCBI gene;Acc:101171148])

HSP 1 Score: 191.43 bits (485), Expect = 2.712e-57
Identity = 89/219 (40.64%), Postives = 135/219 (61.64%), Query Frame = 3
Query:  441 KLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKH-KARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            K+AII+P+R+R   L+  + YL  +L+RQ   Y +Y++ Q G   FN+  L+N G+ EA+K + +DC +F DVDLIP      Y C S P HLSVS+D F ++LPY+   GGV  +   QFL +NG+ N YW WG EDDD+Y R+ +  + V+RP   + + RM++H + ++  P   R   ++ +K     DG+NS+SY V +    +LYT + +DVG
Sbjct:  137 KVAIIIPFRNRDEHLKYWLYYLHPILQRQQLDYGVYVINQDGDVTFNRAKLLNVGYTEALKEYDYDCFVFSDVDLIPMDDRNTYKCFSQPRHLSVSMDKFGFRLPYNQFFGGVSSLSKEQFLKINGFPNNYWGWGGEDDDIYNRVVSRGMSVSRPSGEVGKCRMIRHNRDKKNEPNPQRFDRINHTKETMNKDGINSLSYQVVKVEKFDLYTKITVDVG 355          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Medaka
Match: b4galt1l (beta-1,4-galactosyltransferase 1 [Source:NCBI gene;Acc:101171148])

HSP 1 Score: 191.43 bits (485), Expect = 2.712e-57
Identity = 89/219 (40.64%), Postives = 135/219 (61.64%), Query Frame = 3
Query:  441 KLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKH-KARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVG 1094
            K+AII+P+R+R   L+  + YL  +L+RQ   Y +Y++ Q G   FN+  L+N G+ EA+K + +DC +F DVDLIP      Y C S P HLSVS+D F ++LPY+   GGV  +   QFL +NG+ N YW WG EDDD+Y R+ +  + V+RP   + + RM++H + ++  P   R   ++ +K     DG+NS+SY V +    +LYT + +DVG
Sbjct:  137 KVAIIIPFRNRDEHLKYWLYYLHPILQRQQLDYGVYVINQDGDVTFNRAKLLNVGYTEALKEYDYDCFVFSDVDLIPMDDRNTYKCFSQPRHLSVSMDKFGFRLPYNQFFGGVSSLSKEQFLKINGFPNNYWGWGGEDDDIYNRVVSRGMSVSRPSGEVGKCRMIRHNRDKKNEPNPQRFDRINHTKETMNKDGINSLSYQVVKVEKFDLYTKITVDVG 355          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Planmine SMEST
Match: SMESG000002057.1 (SMESG000002057.1)

HSP 1 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 318/320 (99.38%), Postives = 319/320 (99.69%), Query Frame = 3
Query:  147 MVIFLYFGSVFQPKXXXXXXXXXXXXXXXFYGVLLSYLDDANGFEKIVYEQMMKIMDPNLLTVEQITDSILNNKLIEDSTNNLTQIWTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPSPF 1106
            MVIFLYFGSVFQPKCILVLCLLNFLFLVIFYGVLLSYLDDANGFEKIVYEQMMKIMDPNLLTVEQITDSILNNKLIEDSTNNLTQIWTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLD+LLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRP ASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPSPF
Sbjct:    1 MVIFLYFGSVFQPKCILVLCLLNFLFLVIFYGVLLSYLDDANGFEKIVYEQMMKIMDPNLLTVEQITDSILNNKLIEDSTNNLTQIWTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDELLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPAASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPSPF 320          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Planmine SMEST
Match: SMESG000071011.1 (SMESG000071011.1)

HSP 1 Score: 215.312 bits (547), Expect = 5.021e-68
Identity = 103/249 (41.37%), Postives = 159/249 (63.86%), Query Frame = 3
Query:  366 KLIEDSTNNLTQIWTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPT-HLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIE--LRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPSP 1103
            K  E++       W + KC   + N +AII+P+R R  Q   L+  L ++L++Q  CY+I+I+EQ G   FNKG + NAGFLE + ++ F+CV+FHD DLIPES  +PY C      H++ ++D  +Y LPYS L+GGVI  + +Q+L++NGYSN YW WG EDDD+ IR+  T +   R P ++ R++ +KH+   +  I+   R+ LL+ ++ R   DGLNS+ Y + ++T   LYTH+++D+G  P
Sbjct:    8 KFAEETEIKYGGYWVQSKC--ITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNT-IGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQP 253          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Planmine SMEST
Match: SMESG000071011.1 (SMESG000071011.1)

HSP 1 Score: 196.823 bits (499), Expect = 2.273e-61
Identity = 90/207 (43.48%), Postives = 139/207 (67.15%), Query Frame = 3
Query:  492 LIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPT-HLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPIE--LRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPSP 1103
            L+  L ++L++Q  CY+I+I+EQ G   FNKG + NAGFLE + ++ F+CV+FHD DLIPES  +PY C      H++ ++D  +Y LPYS L+GGVI  + +Q+L++NGYSN YW WG EDDD+ IR+  T +   R P ++ R++ +KH+   +  I+   R+ LL+ ++ R   DGLNS+ Y + ++T   LYTH+++D+G  P
Sbjct:    3 LLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNT-IGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQP 208          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Planmine SMEST
Match: SMESG000064462.1 (SMESG000064462.1)

HSP 1 Score: 197.978 bits (502), Expect = 4.795e-60
Identity = 88/214 (41.12%), Postives = 142/214 (66.36%), Query Frame = 3
Query:  414 LKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMK--LWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPI-ELRHKLLSFSKARYRLDGLNSISYAVQ 1046
            L  N   + K+AII+PYR+R   L I ++++   L++Q+  Y I+++EQ   ++FN+  L N G+ EA+K  L +FDC +FHDVDL+P + N  Y C   P H+SV+ID F+YKLPY+ + GG + +   QF+ +NG+SN+++ WG EDDD+  RI+A    + R P S+AR+ M++H +   +P+ E R KLL  S  RY+ DG++++ Y+++
Sbjct:  111 LPPNCLPTEKVAIIIPYRNREKHLNIFLKHMHPFLQKQLISYGIFVIEQAPGTRFNRAALFNVGYQEALKDQLIQFDCFIFHDVDLLPTNENNLYKCGKNPMHMSVAIDKFNYKLPYNAIFGGAVALNKEQFVKVNGFSNIFYGWGGEDDDMSSRISAVKYSIARYPDSVARYVMIRHTSDSGNPVNEARWKLLKDSHTRYKFDGISTLVYSIE 324          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Planmine SMEST
Match: SMESG000008535.1 (SMESG000008535.1)

HSP 1 Score: 183.341 bits (464), Expect = 9.243e-55
Identity = 90/225 (40.00%), Postives = 138/225 (61.33%), Query Frame = 3
Query:  381 STNNLTQIWTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGF-LEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPPASIARFRMLKHKARQKSPI-ELRHKLLSFSKARYRLDGLNSISYAVQQ 1049
            +T+ +   W+   C    +  +AII+PYR+R   L  L+ +L   L+RQ   YQI+++EQ     +NKG + N+GF +      KFDC +FHDVD++P      Y CS  P HL  ++D F+YKL Y  +VGGV+ +   QF+ +NGYSN++  WG EDDD+  RI   N +V R P  I ++ M+KH+  + +PI E R K+L+ +K RY+ DGLN++ Y +++
Sbjct:   82 ATDVVNGYWSPTNC--LKNYTIAIIIPYREREQHLRKLLSHLHPFLQRQNAKYQIFVIEQSSLGIYNKGAISNSGFDIANSSDRKFDCFIFHDVDMLPIKNQNIYQCSEQPLHLGAAVDKFNYKLVYGTIVGGVLALNREQFVKVNGYSNIFEGWGGEDDDMAERIKLENYKVFRYPIEIGQYMMIKHQHDKGNPINEKRVKMLTETKNRYKTDGLNTLKYKIKE 304          
The following BLAST results are available for this feature:
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B4GALT22.095e-5536.68beta-1,4-galactosyltransferase 2 [Source:HGNC Symb... [more]
B4GALT28.251e-5536.60beta-1,4-galactosyltransferase 2 [Source:HGNC Symb... [more]
B4GALT28.251e-5536.60beta-1,4-galactosyltransferase 2 [Source:HGNC Symb... [more]
B4GALT58.733e-5534.94beta-1,4-galactosyltransferase 5 [Source:HGNC Symb... [more]
B4GALT12.122e-5440.09beta-1,4-galactosyltransferase 1 [Source:HGNC Symb... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bre-44.758e-5941.63Beta-1,4-N-acetylgalactosaminyltransferase bre-4 ... [more]
bre-44.758e-5941.63Beta-1,4-N-acetylgalactosaminyltransferase bre-4 ... [more]
W02B12.111.687e-5640.60N-acetyllactosamine synthase [Source:UniProtKB/Tr... [more]
W02B12.111.687e-5640.60N-acetyllactosamine synthase [Source:UniProtKB/Tr... [more]
bre-47.870e-5240.30Beta-1,4-N-acetylgalactosaminyltransferase bre-4 ... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
beta4GalNAcTA1.750e-5340.58gene:FBgn0027538 transcript:FBtr0087539[more]
beta4GalNAcTB8.558e-5341.40gene:FBgn0039625 transcript:FBtr0085419[more]
beta4GalT71.133e-2530.14gene:FBgn0039258 transcript:FBtr0084755[more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR318611.24.265e-6038.67si:dkey-199f5.8 [Source:NCBI gene;Acc:556544][more]
si:dkey-199f5.81.203e-5938.67si:dkey-199f5.8 [Source:ZFIN;Acc:ZDB-GENE-030131-4... [more]
si:dkey-199f5.81.203e-5938.67si:dkey-199f5.8 [Source:ZFIN;Acc:ZDB-GENE-030131-4... [more]
b4galt67.796e-5940.45UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
b4galt33.284e-5842.08UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B4GALT25.320e-6137.30UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
ranbp22.639e-5739.21RAN binding protein 2 [Source:Xenbase;Acc:XB-GENE-... [more]
B4GALT31.045e-5537.60beta-1,4-galactosyltransferase 3-like [Source:NCBI... [more]
nkx6-32.185e-5539.38NK6 homeobox 3 [Source:Xenbase;Acc:XB-GENE-478609][more]
b4galt56.306e-5539.19UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B4galt15.425e-5640.09UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
B4galt24.576e-5536.73UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
B4galt24.576e-5536.73UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
B4galt24.576e-5536.73UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
B4galt55.508e-5534.20UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase,... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8Y1P7|BRE4_CAEBR1.417e-5942.08Beta-1,4-N-acetylgalactosaminyltransferase bre-4 O... [more]
sp|Q9GUM2|BRE4_CAEEL6.053e-5841.63Beta-1,4-N-acetylgalactosaminyltransferase bre-4 O... [more]
sp|P08037|B4GT1_BOVIN8.685e-5639.43Beta-1,4-galactosyltransferase 1 OS=Bos taurus OX=... [more]
sp|P15535|B4GT1_MOUSE3.795e-5540.09Beta-1,4-galactosyltransferase 1 OS=Mus musculus O... [more]
sp|Q9Z2Y2|B4GT2_MOUSE3.201e-5436.73Beta-1,4-galactosyltransferase 2 OS=Mus musculus O... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IRU95.673e-7851.28Uncharacterized protein OS=Macrostomum lignano OX=... [more]
E0W2U32.743e-7550.44Xylosylprotein beta4-galactosyltransferase, putati... [more]
A0A2C9K9U52.432e-7348.26Uncharacterized protein OS=Biomphalaria glabrata O... [more]
T1IG474.933e-7345.88Uncharacterized protein (Fragment) OS=Rhodnius pro... [more]
A0A2P6KD676.247e-7347.83Bre-4 OS=Nephila clavipes OX=2585209 GN=NCL1_44246... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-199f5.81.358e-6039.56beta-1,4-galactosyltransferase 3-like [Source:NCBI... [more]
b4galt64.121e-5840.91beta-1,4-galactosyltransferase 6 [Source:NCBI gene... [more]
b4galt67.699e-5840.91beta-1,4-galactosyltransferase 6 [Source:NCBI gene... [more]
b4galt1l1.344e-5739.64beta-1,4-galactosyltransferase 1-like [Source:NCBI... [more]
b4galt23.712e-5736.73beta-1,4-galactosyltransferase 2 [Source:NCBI gene... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B4GALT11.292e-5840.27beta-1,4-galactosyltransferase 1 [Source:HGNC Symb... [more]
b4galt23.544e-5539.11UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
B4GALT11.191e-5335.96beta-1,4-galactosyltransferase 1 [Source:HGNC Symb... [more]
B4GALT13.759e-5245.51beta-1,4-galactosyltransferase 1 [Source:HGNC Symb... [more]
ENSPMAT00000004173.14.736e-2737.16pep scaffold:Pmarinus_7.0:GL478483:39914:44753:1 g... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO489204.990e-6041.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371631.539e-4744.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488033.729e-2429.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-199f5.82.715e-6140.36beta-1,4-galactosyltransferase 3 [Source:NCBI gene... [more]
b4galt61.175e-5841.36beta-1,4-galactosyltransferase 6 [Source:NCBI gene... [more]
b4galt61.940e-5841.36beta-1,4-galactosyltransferase 6 [Source:NCBI gene... [more]
b4galt1l2.712e-5740.64beta-1,4-galactosyltransferase 1 [Source:NCBI gene... [more]
b4galt1l2.712e-5740.64beta-1,4-galactosyltransferase 1 [Source:NCBI gene... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002057.10.000e+099.38SMESG000002057.1[more]
SMESG000071011.15.021e-6841.37SMESG000071011.1[more]
SMESG000071011.12.273e-6143.48SMESG000071011.1[more]
SMESG000064462.14.795e-6041.12SMESG000064462.1[more]
SMESG000008535.19.243e-5540.00SMESG000008535.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004897 ID=SMED30004897|Name=Beta-1,4-galactosyltransferase 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1123bp
CTGGGAGAATGTACAAATGTGAACAGCGATTTCATAACCGTAACAACAGC
ATATAATGGATATTTCTACTGGTGCACATGTAGCAATTTCGTCCATCTAT
TTCTGTTTAGATTTTATACACAGATTCCTGACAAGTCAACATATCGATGG
TGATCTTTCTTTATTTCGGATCAGTTTTTCAACCGAAATGTATTCTCGTT
CTATGTTTGTTGAATTTCCTTTTTCTCGTGATTTTTTATGGAGTCCTCCT
ATCGTATCTGGATGACGCAAACGGCTTCGAGAAAATTGTCTACGAGCAAA
TGATGAAGATCATGGATCCCAACCTCTTGACGGTCGAGCAAATTACGGAT
TCCATTCTCAATAATAAATTAATTGAGGACAGCACAAATAATTTAACTCA
GATCTGGACCAAGCTTAAATGTAACCTTTCAAGCTCAAACAAACTAGCAA
TAATAGTTCCCTACCGTGACCGAAGATATCAACTAGAGATATTAATACAA
TATTTAGACAAATTGTTGAGGAGACAGATGCAATGCTATCAGATTTATAT
TGTGGAACAATTTGGTCAAAGCAAATTCAATAAAGGTTTGCTGATGAATG
CAGGATTCCTCGAGGCCATGAAACTGTGGAAATTTGACTGCGTCATGTTT
CATGATGTAGATTTGATTCCAGAAAGTTTCAACGTCCCTTATTCGTGCTC
GAGCCTCCCGACCCACCTCAGTGTCAGCATAGATACATTCGACTACAAAT
TACCGTACTCATATCTTGTTGGTGGCGTCATTGTGATGAAGACCTATCAA
TTTCTCACACTTAATGGGTATTCAAATATGTATTGGGACTGGGGAGCTGA
GGATGATGATCTTTATATTAGAATCAACGCAACAAATCTGCAGGTCACTC
GGCCCCCCGCCTCAATCGCCAGGTTCAGAATGCTCAAGCACAAAGCCAGG
CAAAAATCTCCTATAGAATTAAGACATAAGCTGTTGTCCTTCAGTAAGGC
TAGGTACAGACTCGACGGACTGAATAGCATCTCATATGCAGTTCAACAGA
GGACTTATTGTGAGTTGTATACTCATTTATTAATTGATGTTGGACCCAGC
CCTTTTTGATGTAGTTTTTTTGT
back to top

protein sequence of SMED30004897-orf-1

>SMED30004897-orf-1 ID=SMED30004897-orf-1|Name=SMED30004897-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=321bp
MVIFLYFGSVFQPKCILVLCLLNFLFLVIFYGVLLSYLDDANGFEKIVYE
QMMKIMDPNLLTVEQITDSILNNKLIEDSTNNLTQIWTKLKCNLSSSNKL
AIIVPYRDRRYQLEILIQYLDKLLRRQMQCYQIYIVEQFGQSKFNKGLLM
NAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPTHLSVSIDTFDY
KLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQV
TRPPASIARFRMLKHKARQKSPIELRHKLLSFSKARYRLDGLNSISYAVQ
QRTYCELYTHLLIDVGPSPF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR003859Galactosyl_T
IPR029044Nucleotide-diphossugar_trans
IPR027995Galactosyl_T_N
IPR027791Galactosyl_T_C
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0002064epithelial cell development
GO:0002526acute inflammatory response
GO:0005989lactose biosynthetic process
GO:0006012galactose metabolic process
GO:0006486protein glycosylation
GO:0006487protein N-linked glycosylation
GO:0007155cell adhesion
GO:0007339binding of sperm to zona pellucida
GO:0007341penetration of zona pellucida
GO:0008285negative regulation of cell proliferation
GO:0009101glycoprotein biosynthetic process
GO:0009312oligosaccharide biosynthetic process
GO:0030198extracellular matrix organization
GO:0030879mammary gland development
GO:0042060wound healing
GO:0042125protein galactosylation
GO:0042127regulation of cell proliferation
GO:0043065positive regulation of apoptotic process
GO:0045136development of secondary sexual characteristics
GO:0048754branching morphogenesis of an epithelial tube
GO:0050900leukocyte migration
GO:0051270regulation of cellular component movement
GO:0060046regulation of acrosome reaction
GO:0060054positive regulation of epithelial cell proliferation involved in wound healing
GO:0060055angiogenesis involved in wound healing
GO:0060058positive regulation of apoptotic process involved in mammary gland involution
Vocabulary: molecular function
TermDefinition
GO:0016757transferase activity, transferring glycosyl groups
GO:0003831beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity
GO:0003945N-acetyllactosamine synthase activity
GO:0004461lactose synthase activity
GO:0005515protein binding
GO:0008092cytoskeletal protein binding
GO:0008378galactosyltransferase activity
GO:0016740transferase activity
GO:0030145manganese ion binding
GO:0035250UDP-galactosyltransferase activity
GO:0042803protein homodimerization activity
GO:0043014alpha-tubulin binding
GO:0046872metal ion binding
GO:0048487beta-tubulin binding
Vocabulary: cellular component
TermDefinition
GO:0000138Golgi trans cisterna
GO:0005576extracellular region
GO:0005615extracellular space
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0009897external side of plasma membrane
GO:0009986cell surface
GO:0016020membrane
GO:0016021integral component of membrane
GO:0016323basolateral plasma membrane
GO:0030057desmosome
GO:0030112glycocalyx
GO:0030175filopodium
GO:0031526brush border membrane
GO:0032580Golgi cisterna membrane
GO:0042995cell projection
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003859Beta-1,4-galactosyltransferasePRINTSPR02050B14GALTRFASEcoord: 134..153
score: 41.85
coord: 165..184
score: 47.27
coord: 224..242
score: 59.76
coord: 202..223
score: 37.59
IPR003859Beta-1,4-galactosyltransferasePANTHERPTHR19300BETA-1,4-GALACTOSYLTRANSFERASEcoord: 95..317
IPR029044Nucleotide-diphospho-sugar transferasesGENE3DG3DSA:3.90.550.10coord: 51..318
e-value: 2.0E-86
score: 291.8
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILYSSF53448Nucleotide-diphospho-sugar transferasescoord: 93..316
IPR027995Galactosyltransferase, N-terminalPFAMPF13733Glyco_transf_7Ncoord: 76..185
e-value: 1.5E-36
score: 125.0
IPR027791Galactosyltransferase, C-terminalPFAMPF02709Glyco_transf_7Ccoord: 190..266
e-value: 9.8E-26
score: 89.2
NoneNo IPR availablePANTHERPTHR19300:SF52BETA4GALNACTAcoord: 95..317
NoneNo IPR availableTMHMMTMhelixcoord: 15..37