Hsp70-Hsp90 organizing protein 1

Overview
NameHsp70-Hsp90 organizing protein 1
Smed IDSMED30004886
Length (bp)906
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hsp70-Hsp90 organizing protein 1 (SMED30004886) t-SNE clustered cells

Violin plots show distribution of expression levels for Hsp70-Hsp90 organizing protein 1 (SMED30004886) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hsp70-Hsp90 organizing protein 1 (SMED30004886) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hsp70-Hsp90 organizing protein 1 (SMED30004886) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004886

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30004886SMESG000033618.1 SmedASXL_004420SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30004886SMESG000033618.1 dd_Smed_v4_14717_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30004886SMESG000033618.1 dd_Smed_v6_14717_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 2 cellSMED30004886SMESG000033618.1 dd_Smed_v4_14717_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hsp70-Hsp90 organizing protein 1 vs. TrEMBL
Match: A0A2C9KJ06 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106064060 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.255e-15
Identity = 49/141 (34.75%), Postives = 82/141 (58.16%), Query Frame = 1
Query:  193 NEDDTEKIPNLTSEIDELIINCVKTNNCRFLDLLLYEPDSNLDCHYYGENMLMLAIRLGNESVAKFLIENGIDFNFEKKIFYKNLIDDREMIDYFYINCREVAYRHGMFEIVEMIDVLNGKHFRF-YPTPKIRIRDRSEKP 612
            NE D E+   +TS     +   VK+ +  +L+  L + +S+++  ++ ENMLM AIR   E +A+FL++NG+D ++   +         ++++ + + CR++AY HGM  IVE+ID+L G  F F  P P+I  R R  KP
Sbjct:  115 NEPDDEERTEMTSAEKRDMYEAVKSGDIDWLEDCLDKRNSDINMTWFKENMLMTAIRNEQEEMAEFLLDNGVDHSYTASVVNLKDTPKGKILERYDVTCRQLAYDHGMLGIVEIIDILQGNLFPFIRPNPRI-PRLRRPKP 254          
BLAST of Hsp70-Hsp90 organizing protein 1 vs. TrEMBL
Match: A0A1S3K0J3 (uncharacterized protein LOC106177808 OS=Lingula unguis OX=7574 GN=LOC106177808 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 4.330e-13
Identity = 40/124 (32.26%), Postives = 77/124 (62.10%), Query Frame = 1
Query:  232 EIDELIINCVKTNNCRFLDLLLYEPDSNLDCHYYGENMLMLAIRLGNESVAKFLIENGIDFNFEKKIFYKNLIDDREM-IDYFYINCREVAYRHGMFEIVEMIDVLNGKHFRFYPTPKIRIRDR 600
            E  E +   V   +   +++LL + +++++  ++ EN+L+ AIR G E +A+FL++NG+D NFE     +   +  E+ + ++ ++CR++AY  GM ++VE+ID +NG  F+F     I+ R+R
Sbjct:  144 EEKEALYKAVCEGDIDEVEILLDKENADINMEWFSENLLVAAIRHGKEEMAEFLLDNGVDRNFETSRLERAEDETGEVSLSWYSVSCRQMAYDAGMHDLVELIDYMNGDLFKF-----IKPRER 262          
BLAST of Hsp70-Hsp90 organizing protein 1 vs. TrEMBL
Match: A0A2T7NUX0 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_15451 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 4.509e-13
Identity = 46/129 (35.66%), Postives = 75/129 (58.14%), Query Frame = 1
Query:  223 LTSEIDELIINCVKTNNCRFLDLLLYEPDSNLDCHYYGENMLMLAIRLGNESVAKFLIENGIDFNFEKKIFYKNLIDDR-----EMIDYFYINCREVAYRHGMFEIVEMIDVLNGKHFRFYP--TPKIR 588
            +T+E  E + N V+  +   L+  L  P +++   Y+ EN+LM AIR     +A+FL++NG+D NF   +   N+ D R       ++ +  +CR++AY  G+ EIVE+ID+LNG   R +P  TP+ R
Sbjct:  181 MTAEEKEEMRNAVRDGDIDRLEDCLDRPGADIRMIYFKENLLMTAIRADQVHMAEFLLDNGVDHNFSTILL--NMKDTRGASPSHTLECYKYSCRQMAYDKGLLEIVEIIDILNG---RLFPGVTPRSR 304          
BLAST of Hsp70-Hsp90 organizing protein 1 vs. TrEMBL
Match: V4CQ31 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_170654 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.266e-11
Identity = 37/113 (32.74%), Postives = 68/113 (60.18%), Query Frame = 1
Query:  223 LTSEIDELIINCVKTNNCRFLDLLLYEPDSNLDCHYYGENMLMLAIRLGNESVAKFLIENGIDFNFEKKIFYKNLIDDREMIDYFYINCREVAYRHGMFEIVEMIDVLNGKHF 561
            +T +  + + N VK  +   L+ LL   ++++   +Y EN+LM +IR   + +A+FL++NG+D N   K+  +N  +     + +   CR++AY H +F+IVE+IDV+N + F
Sbjct:   40 MTLDEKKAMYNAVKVGDIDILEELLERQNADIKMLWYSENLLMASIRFEQDEMAEFLLDNGVDQNHS-KLLIRNPENGVSNTEQYTYTCRQMAYDHELFDIVEIIDVMNNQLF 151          
BLAST of Hsp70-Hsp90 organizing protein 1 vs. TrEMBL
Match: R7UH54 (ANK_REP_REGION domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_223022 PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.243e-10
Identity = 39/118 (33.05%), Postives = 67/118 (56.78%), Query Frame = 1
Query:  247 IINCVKTNNCRFLDLLLYEPDSNLDCHY----YGENMLMLAIRLGNESVAKFLIENGIDFNFEKKIF-----YKNLIDDREMIDYFYINCREVAYRHGMFEIVEMIDVLNGKHFRFYP 573
            I + V+  N   LD LL  P ++++  +    YGEN+LM+AI+   + +A+FLI+NG+++NF    F     Y     +   +D +   CR++AY   M ++V++ID  NG ++ F P
Sbjct:  136 IYHAVRKGNIEELDDLLDLPKADINMTWVGLMYGENLLMIAIQHRQQEMAEFLIDNGVNWNFTHYAFDMKDDYLRRGGESAELDCYSTTCRQMAYDRKMLDLVDLIDEKNGNYWSFKP 253          
BLAST of Hsp70-Hsp90 organizing protein 1 vs. Planmine SMEST
Match: SMESG000033618.1 (SMESG000033618.1)

HSP 1 Score: 489.96 bits (1260), Expect = 1.475e-177
Identity = 240/240 (100.00%), Postives = 240/240 (100.00%), Query Frame = 1
Query:  142 MEYNYDNLSTLNGREINNEDDTEKIPNLTSEIDELIINCVKTNNCRFLDLLLYEPDSNLDCHYYGENMLMLAIRLGNESVAKFLIENGIDFNFEKKIFYKNLIDDREMIDYFYINCREVAYRHGMFEIVEMIDVLNGKHFRFYPTPKIRIRDRSEKPGMFYDVVSLGEEFFTGNYPKEVLSEAVKPYNNLDQNFIVSKRSKSALPTLSYFHYKNKENKSSFLRQRFSSGKNKLKNRTSQC 861
            MEYNYDNLSTLNGREINNEDDTEKIPNLTSEIDELIINCVKTNNCRFLDLLLYEPDSNLDCHYYGENMLMLAIRLGNESVAKFLIENGIDFNFEKKIFYKNLIDDREMIDYFYINCREVAYRHGMFEIVEMIDVLNGKHFRFYPTPKIRIRDRSEKPGMFYDVVSLGEEFFTGNYPKEVLSEAVKPYNNLDQNFIVSKRSKSALPTLSYFHYKNKENKSSFLRQRFSSGKNKLKNRTSQC
Sbjct:    1 MEYNYDNLSTLNGREINNEDDTEKIPNLTSEIDELIINCVKTNNCRFLDLLLYEPDSNLDCHYYGENMLMLAIRLGNESVAKFLIENGIDFNFEKKIFYKNLIDDREMIDYFYINCREVAYRHGMFEIVEMIDVLNGKHFRFYPTPKIRIRDRSEKPGMFYDVVSLGEEFFTGNYPKEVLSEAVKPYNNLDQNFIVSKRSKSALPTLSYFHYKNKENKSSFLRQRFSSGKNKLKNRTSQC 240          
The following BLAST results are available for this feature:
BLAST of Hsp70-Hsp90 organizing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hsp70-Hsp90 organizing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hsp70-Hsp90 organizing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hsp70-Hsp90 organizing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hsp70-Hsp90 organizing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hsp70-Hsp90 organizing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hsp70-Hsp90 organizing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hsp70-Hsp90 organizing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9KJ061.255e-1534.75Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A1S3K0J34.330e-1332.26uncharacterized protein LOC106177808 OS=Lingula un... [more]
A0A2T7NUX04.509e-1335.66Uncharacterized protein OS=Pomacea canaliculata OX... [more]
V4CQ313.266e-1132.74Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
R7UH541.243e-1033.05ANK_REP_REGION domain-containing protein OS=Capite... [more]
back to top
BLAST of Hsp70-Hsp90 organizing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hsp70-Hsp90 organizing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hsp70-Hsp90 organizing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hsp70-Hsp90 organizing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hsp70-Hsp90 organizing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hsp70-Hsp90 organizing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000033618.11.475e-177100.00SMESG000033618.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004886 ID=SMED30004886|Name=Hsp70-Hsp90 organizing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=906bp
AAATGCCTTAAACTAATTAACCAATGCAATTAACCAATGCGATGCTTGTA
AACACACCTTTCCATTGTTTAAAGGTTGCACGTAGCGTTAATGAAATAAA
TTAAATGAAGCATATGATTGATTGTTAAATTCCATCAATCAATGGAATAT
AATTATGACAATTTATCAACTTTGAATGGTCGGGAAATTAACAATGAAGA
TGACACAGAAAAGATACCTAATTTGACCAGTGAAATAGATGAATTGATCA
TTAATTGTGTTAAAACTAATAATTGTCGTTTTCTCGATTTATTATTGTAT
GAACCGGATTCGAATTTGGATTGCCATTATTATGGGGAAAATATGCTGAT
GTTAGCAATTAGATTAGGAAATGAATCTGTTGCTAAATTTCTAATAGAAA
ATGGAATTGATTTCAATTTTGAAAAGAAAATTTTCTACAAAAATCTAATC
GATGATCGAGAAATGATAGATTATTTTTACATTAACTGCCGAGAAGTTGC
TTATCGACATGGAATGTTTGAAATTGTGGAAATGATTGATGTTTTGAATG
GAAAACATTTCCGTTTTTATCCAACACCGAAAATACGAATTCGTGATCGA
TCTGAGAAACCGGGAATGTTTTATGATGTCGTTTCATTGGGTGAAGAATT
TTTTACCGGAAACTATCCGAAGGAAGTGTTATCTGAAGCAGTGAAACCTT
ACAATAATCTGGATCAGAATTTCATTGTTAGTAAAAGATCTAAGTCTGCA
CTTCCTACTTTGTCATATTTTCACTATAAAAATAAAGAAAATAAATCATC
ATTTCTAAGACAAAGATTTTCATCTGGTAAAAATAAACTCAAAAATCGAA
CAAGTCAGTGTTAAATCTAGTTTAAGAATTAGTTTTATAGCTACCAAAAG
AAGCAT
back to top

protein sequence of SMED30004886-orf-1

>SMED30004886-orf-1 ID=SMED30004886-orf-1|Name=SMED30004886-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=241bp
MEYNYDNLSTLNGREINNEDDTEKIPNLTSEIDELIINCVKTNNCRFLDL
LLYEPDSNLDCHYYGENMLMLAIRLGNESVAKFLIENGIDFNFEKKIFYK
NLIDDREMIDYFYINCREVAYRHGMFEIVEMIDVLNGKHFRFYPTPKIRI
RDRSEKPGMFYDVVSLGEEFFTGNYPKEVLSEAVKPYNNLDQNFIVSKRS
KSALPTLSYFHYKNKENKSSFLRQRFSSGKNKLKNRTSQC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000028Category 2 cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 64..93
e-value: 0.0056
score: 25.9
IPR002110Ankyrin repeatPFAMPF13606Ank_3coord: 64..92
e-value: 2.3E-5
score: 24.4
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 64..96
score: 10.392
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 12..132
e-value: 1.9E-6
score: 29.6
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 33..131
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 64..96
score: 10.365