Glycine receptor subunit alpha-3

Overview
NameGlycine receptor subunit alpha-3
Smed IDSMED30004877
Length (bp)1654
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycine receptor subunit alpha-3 (SMED30004877) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycine receptor subunit alpha-3 (SMED30004877) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycine receptor subunit alpha-3 (SMED30004877) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycine receptor subunit alpha-3 (SMED30004877) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004877

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30004877SMESG000032691.1 SmedASXL_010264SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30004877SMESG000032691.1 dd_Smed_v4_18238_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30004877SMESG000032691.1 dd_Smed_v6_18238_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30004877SMESG000032691.1 SMED30004877smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30004877SMESG000032691.1 OX_Smed_1.0.22858ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRB (glycine receptor beta [Source:HGNC Symbol;Acc:HGNC:4329])

HSP 1 Score: 243.432 bits (620), Expect = 2.594e-73
Identity = 141/443 (31.83%), Postives = 242/443 (54.63%), Query Frame = 3
Query:  300 IMDKILQNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTK-VETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTV------AQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQI--------------LNRNELEFCEELDILLTAQQY--------ANNYHSQESAHQIKR---QKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYL 1529
            I++++L +Y    RP  +     V+V + + +  S+  + M+Y  +++LRQ W D RL+  +  +F+  ++  V P++   LW PDLFF N K    H +T+ N L+ +F +G+VL S ++++  SC +DL  +PMDTQ C+M + S+GYT D L+F W   +P++L   + +P+F+   + +E  +CT      TG+Y+C++ +F LRRQ+G Y++  + P  LIV++SWL+FW++ +A  AR+ LG+ ++L + ++ + ++  LP+VSY+KA+DVWLIAC++F   +L+E+AV   +       + +K    K+E  D     +++ N         H+ T Q+              L  N+      L        Y         NN   +  A   K+    K +      +ID+Y+R LFP CF+F+N  YW  YL
Sbjct:   59 ILNRLLVSYDPRIRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLKLPS--DFRGSDALTVDPTMYKCLWKPDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSITLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQL-EKIALPQFDIKKEDIEYGNCTKYYKG-TGYYTCVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVPLGIFSVLSLASECTTLAAELPKVSYVKALDVWLIACLLFGFASLVEYAVVQVMLNNPKRVEAEKARIAKAEQADGKGGNVAKKNTVNGTGTPVHISTLQVGETRCKKVCTSKSDLRSNDFSIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPTAAKRIDLYARALFPFCFLFFNVIYWSIYL 497          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRB (glycine receptor beta [Source:HGNC Symbol;Acc:HGNC:4329])

HSP 1 Score: 243.432 bits (620), Expect = 2.594e-73
Identity = 141/443 (31.83%), Postives = 242/443 (54.63%), Query Frame = 3
Query:  300 IMDKILQNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTK-VETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTV------AQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQI--------------LNRNELEFCEELDILLTAQQY--------ANNYHSQESAHQIKR---QKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYL 1529
            I++++L +Y    RP  +     V+V + + +  S+  + M+Y  +++LRQ W D RL+  +  +F+  ++  V P++   LW PDLFF N K    H +T+ N L+ +F +G+VL S ++++  SC +DL  +PMDTQ C+M + S+GYT D L+F W   +P++L   + +P+F+   + +E  +CT      TG+Y+C++ +F LRRQ+G Y++  + P  LIV++SWL+FW++ +A  AR+ LG+ ++L + ++ + ++  LP+VSY+KA+DVWLIAC++F   +L+E+AV   +       + +K    K+E  D     +++ N         H+ T Q+              L  N+      L        Y         NN   +  A   K+    K +      +ID+Y+R LFP CF+F+N  YW  YL
Sbjct:   59 ILNRLLVSYDPRIRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLKLPS--DFRGSDALTVDPTMYKCLWKPDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSITLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQL-EKIALPQFDIKKEDIEYGNCTKYYKG-TGYYTCVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVPLGIFSVLSLASECTTLAAELPKVSYVKALDVWLIACLLFGFASLVEYAVVQVMLNNPKRVEAEKARIAKAEQADGKGGNVAKKNTVNGTGTPVHISTLQVGETRCKKVCTSKSDLRSNDFSIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPTAAKRIDLYARALFPFCFLFFNVIYWSIYL 497          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA2 (glycine receptor alpha 2 [Source:HGNC Symbol;Acc:HGNC:4327])

HSP 1 Score: 240.35 bits (612), Expect = 1.139e-72
Identity = 137/389 (35.22%), Postives = 218/389 (56.04%), Query Frame = 3
Query:  390 AINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLY-------QWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            +  SV  + M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K    H +T  N L+R+  NG+VLYS ++T+  SC MDL+ +PMD Q+C M + S+GYT++ L F W    P+++   + +P+F    + E   CT      TG ++C++  F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q K +       + +++  D+ R+  SR+N +      H +Q                D        AN            ++K +   +  +ID  SR  FP  F+ +N  YWI Y II
Sbjct:   81 SFGSVTETTMDYRVNIFLRQQWNDSRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTKHY--NTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFLRLRRRQKRQNKEEDVTRE--SRFNFS-GYGMGHCLQVK--------------DGTAVKATPANPLPQPPKDGDAIKKKFVDRAK--RIDTISRAAFPLAFLIFNIFYWITYKII 444          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA2 (glycine receptor alpha 2 [Source:HGNC Symbol;Acc:HGNC:4327])

HSP 1 Score: 239.58 bits (610), Expect = 2.147e-72
Identity = 136/389 (34.96%), Postives = 218/389 (56.04%), Query Frame = 3
Query:  390 AINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLY-------QWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            +  S+  + M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K    H +T  N L+R+  NG+VLYS ++T+  SC MDL+ +PMD Q+C M + S+GYT++ L F W    P+++   + +P+F    + E   CT      TG ++C++  F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q K +       + +++  D+ R+  SR+N +      H +Q                D        AN            ++K +   +  +ID  SR  FP  F+ +N  YWI Y II
Sbjct:   81 SFGSIAETTMDYRVNIFLRQQWNDSRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTKHY--NTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFLRLRRRQKRQNKEEDVTRE--SRFNFS-GYGMGHCLQVK--------------DGTAVKATPANPLPQPPKDGDAIKKKFVDRAK--RIDTISRAAFPLAFLIFNIFYWITYKII 444          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA2 (glycine receptor alpha 2 [Source:HGNC Symbol;Acc:HGNC:4327])

HSP 1 Score: 236.884 bits (603), Expect = 2.321e-72
Identity = 135/380 (35.53%), Postives = 214/380 (56.32%), Query Frame = 3
Query:  417 MEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLY-------QWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K    H +T  N L+R+  NG+VLYS ++T+  SC MDL+ +PMD Q+C M + S+GYT++ L F W    P+++   + +P+F    + E   CT    T  G ++C++  F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q K +       + +++  D+ R+  SR+N +      H +Q                D        AN            ++K +   +  +ID  SR  FP  F+ +N  YWI Y II
Sbjct:    1 MDYRVNIFLRQQWNDSRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTKHYNT--GKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFLRLRRRQKRQNKEEDVTRE--SRFNFS-GYGMGHCLQVK--------------DGTAVKATPANPLPQPPKDGDAIKKKFVDRAK--RIDTISRAAFPLAFLIFNIFYWITYKII 355          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: glc-2 (Glutamate-gated chloride channel subunit beta [Source:UniProtKB/Swiss-Prot;Acc:Q17328])

HSP 1 Score: 242.276 bits (617), Expect = 5.388e-74
Identity = 149/435 (34.25%), Postives = 238/435 (54.71%), Query Frame = 3
Query:  288 TRERIMDKILQNYSLNERPIESNQT-------RVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMEL--GNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQ-ELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQY-----ANNYHSQES-AHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIVSN 1544
            + + I++ +L+NY +  RP  +N +       RV + +++L+   ++V NMEYS  L  R+ W+D RL ++NL  F +  + L  P +K  LW+PD FF   K  + H++   N  +R++P+G++LYS +I++  SC M LQ YP+D QSC  ++ SY +T++ + + W  + P++L  G    +P F         DCT  S T TG Y CL+   + +RQ   YLV  + P T+IVIVSW++FW+ + +   R+ LG+ TLL + T  S I+  LP VSY+K +DVWL AC  FV GALLE+A  S        YQ      D VRQ + SR   A   Q+           R +LE       ++ A+ Y      + + ++E+   +++R     +   +KID Y+R++ P  F+ +N  YW+  LI+ +N
Sbjct:   28 SEQEILNALLKNYDMRVRPPPANSSTEGAVNVRVNIMIRMLS--KIDVVNMEYSIQLTFREQWIDPRLAYENLG-FYNPPAFLTVPHVKKSLWIPDTFFPTEKAAHRHLIDMENMFLRIYPDGKILYSSRISLTSSCPMRLQLYPLDYQSCNFDLVSYAHTMNDIMYEWDPSTPVQLKPGVGSDLPNFILKNYTTNADCT--SHTNTGSYGCLRMQLLFKRQFSYYLVQLYAPTTMIVIVSWVSFWIDLHSTAGRVALGVTTLLTMTTMQSAINAKLPPVSYVKVVDVWLGACQTFVFGALLEYAFVS--------YQ------DSVRQNDRSREKAARKAQR----------RREKLE-------MVDAEVYQPPCTCHTFEARETFRDKVRRYFTKPDYLPAKIDFYARFVVPLAFLAFNVIYWVSCLIMSAN 426          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: glc-1 (Glutamate-gated chloride channel alpha [Source:UniProtKB/Swiss-Prot;Acc:G5EBR3])

HSP 1 Score: 236.884 bits (603), Expect = 1.001e-71
Identity = 145/406 (35.71%), Postives = 224/406 (55.17%), Query Frame = 3
Query:  321 NYSLNERPIESNQTRVMVFMKVL--AINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMEL--GNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQ---YANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYW 1517
             Y    RP   N   V+V + +L   I+ ++V NMEYS  L LR+ W+D RL +    + +      V  ++  ++W+PD FF N K+ Y H + KPN L+R+  +G VLYS +I++  SC M LQ YPMD Q C +++ SY YT   +++ W + +P++L  G +  +P F   T   T  CT  S T TG YSCL+    L+R+   YL+  +IP+ ++VIVSW++FW    A+PAR+TLG+ TLL +  Q++GI+  LP VSYIKAIDVW+ AC+ F+  ALLEFA+ + +A        K  V    R E  +  + +  Q  H+   +++ N+ E    +   + L  +Q   + N   ++   + I +          ++D+ SR LFP  F  +N  YW
Sbjct:   74 GYDFRVRPPTDNGGPVVVSVNMLLRTISKIDVVNMEYSAQLTLRESWIDKRLSYGVKGDGQ---PDFVILTVGHQIWMPDTFFPNEKQAYKHTIDKPNVLIRIHNDGTVLYSVRISLVLSCPMYLQYYPMDVQQCSIDLASYAYTTKDIEYLWKEHSPLQLKVGLSSSLPSFQL-TNTSTTYCT--SVTNTGIYSCLRTTIQLKREFSFYLLQLYIPSCMLVIVSWVSFWFDRTAIPARVTLGVTTLLTMTAQSAGINSQLPPVSYIKAIDVWIGACMTFIFCALLEFALVNHIAN-------KQGVERKARTEREKAEIPL-LQNLHNDVPTKVFNQEE----KVRTVPLNRRQMNSFLNLLETKTEWNDISK----------RVDLISRALFPVLFFVFNILYW 451          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: glc-1 (Glutamate-gated chloride channel alpha [Source:UniProtKB/Swiss-Prot;Acc:G5EBR3])

HSP 1 Score: 236.884 bits (603), Expect = 1.001e-71
Identity = 145/406 (35.71%), Postives = 224/406 (55.17%), Query Frame = 3
Query:  321 NYSLNERPIESNQTRVMVFMKVL--AINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMEL--GNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQ---YANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYW 1517
             Y    RP   N   V+V + +L   I+ ++V NMEYS  L LR+ W+D RL +    + +      V  ++  ++W+PD FF N K+ Y H + KPN L+R+  +G VLYS +I++  SC M LQ YPMD Q C +++ SY YT   +++ W + +P++L  G +  +P F   T   T  CT  S T TG YSCL+    L+R+   YL+  +IP+ ++VIVSW++FW    A+PAR+TLG+ TLL +  Q++GI+  LP VSYIKAIDVW+ AC+ F+  ALLEFA+ + +A        K  V    R E  +  + +  Q  H+   +++ N+ E    +   + L  +Q   + N   ++   + I +          ++D+ SR LFP  F  +N  YW
Sbjct:   74 GYDFRVRPPTDNGGPVVVSVNMLLRTISKIDVVNMEYSAQLTLRESWIDKRLSYGVKGDGQ---PDFVILTVGHQIWMPDTFFPNEKQAYKHTIDKPNVLIRIHNDGTVLYSVRISLVLSCPMYLQYYPMDVQQCSIDLASYAYTTKDIEYLWKEHSPLQLKVGLSSSLPSFQL-TNTSTTYCT--SVTNTGIYSCLRTTIQLKREFSFYLLQLYIPSCMLVIVSWVSFWFDRTAIPARVTLGVTTLLTMTAQSAGINSQLPPVSYIKAIDVWIGACMTFIFCALLEFALVNHIAN-------KQGVERKARTEREKAEIPL-LQNLHNDVPTKVFNQEE----KVRTVPLNRRQMNSFLNLLETKTEWNDISK----------RVDLISRALFPVLFFVFNILYW 451          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: glc-3 (Glutamate-gated ChLoride channel; Glutamate-gated chloride channel subunit [Source:UniProtKB/TrEMBL;Acc:G5EEZ3])

HSP 1 Score: 236.113 bits (601), Expect = 3.378e-71
Identity = 166/483 (34.37%), Postives = 256/483 (53.00%), Query Frame = 3
Query:  225 NIFIFLLAIHVGCNSCSVAGITRERIMDKIL-QNYSLNERP------IESNQTRVMVFMKVL--AINSVNVSNMEYSTDLYLRQLWVDVRLRW----DNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMEL--GNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKS--------------------------EVRDIVRQELSRWNLAINRQKTHHMQTSQI---LNRNELEFCEELDILLTAQQYANNYHSQESAHQIK-----RQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYY 1526
            NI + +    VG N C  +  T   I+ K+L + Y    RP      I      V+V++ +L  +I+ ++  NMEYS  L  R+ WVD RL +    D+  +F    +         ++W+PD FF+N K+ + H + KPN L+R+  +G +LYS +I+M  SC M LQ YPMD Q+C +++ SY YT + +++ W +T+P++L  G +  +P F     V+T  CT  S T TG YSCL+ +  LRRQ   YL+  +IP+T++VIVSW++FW+   AVPAR+TLG+ TLL + TQASGI+  LP VSY KAIDVW+ AC+ F+ GALLEFA  + ++ +    + K+                          E  + V   L++      RQ  +    S++   +N N  E  E   I+  A+     +    +   I+     R ++  +    + D+ SR LFP+ F+ +NF YW  Y
Sbjct:    8 NILLIVAFWIVGGN-CDASSDTE--IIKKLLGKGYDWRVRPPGINLTIPGTHGAVIVYVNMLIRSISKIDDVNMEYSVQLTFREEWVDGRLAYGFPGDSTPDFLILTAG-------QQIWMPDSFFQNEKQAHKHDIDKPNVLIRIHRDGRILYSVRISMVLSCPMHLQYYPMDVQTCLIDLASYAYTENDIEYRWKKTDPVQLKKGLHSSLPSFEL-NNVDTTLCT--SKTNTGTYSCLRTVLELRRQFSYYLLQLYIPSTMLVIVSWVSFWLDRGAVPARVTLGVTTLLTMTTQASGINAKLPPVSYTKAIDVWIGACLTFIFGALLEFAWVTYISSRSFYKRNKNCSSRNSLLIETKQALIIPNTVVAQFPEHPEEVEMGLAQAPDVWIRQSGNGKTVSRVNGHINHNNDEAAEL--IIFDAKHKNRRFVWWTNFRNIRLIRWIRNRLNVDDNAKRADLISRVLFPTLFVCFNFVYWTKY 475          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: avr-15 (pep chromosome:WBcel235:V:13498786:13502743:-1 gene:WBGene00000233.1 transcript:R11G10.1b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:avr-15)

HSP 1 Score: 230.72 bits (587), Expect = 4.240e-69
Identity = 146/418 (34.93%), Postives = 225/418 (53.83%), Query Frame = 3
Query:  300 IMDKIL-QNYSLNERP------IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMEL--GNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYY 1526
            I++ +L + Y    RP      I      V V M + +I+ ++  NMEYS  L  R+ WVD RL +    + +      +  +    +W+PD FF+N K+ Y H++ KPN L+R+  +G +LYS +I++  SC M LQ YPMD Q C +++ SY YT   +++ W +  P++L  G +  +P F   T   T  CT  S T TG YSCL+ +  LRRQ   YL+  +IP+ ++VIVSW++FW+   AVPAR+TLG+ TLL + TQ+SGI+  LP V+YIKAIDVW+ AC+ F+  ALLEFA  + +A        K +     R E  +  L   +   + +   + +   E E       ++T +    N     S  +  + K     +  + D+ SR +FP  F+ +N  YW +Y
Sbjct:   75 ILEHLLTRGYDHRVRPPGEDGTIHGGPVVVSVNMLLRSISKIDNVNMEYSVQLTFRESWVDKRLSFGVKGDAQ---PDFLILTAGQEIWMPDSFFQNEKQAYKHMIDKPNVLIRVHKDGTILYSVRISLVLSCPMHLQYYPMDVQQCFIDLASYAYTTKDIEYVWKEETPVQLKAGLSSSLPSFQL-TNTSTTYCT--SKTNTGSYSCLRTIIQLRRQFSYYLLQLYIPSCMLVIVSWVSFWIDRTAVPARVTLGVTTLLTMTTQSSGINAKLPPVAYIKAIDVWIGACMTFIFCALLEFAWVTYIAN-------KQDANKRARTEREKAELPFLQNSHNDVWVPREVAEQERE-------VMTVRM---NRRQTNSVWKWIKTKTEWNDKSKRADLISRVMFPVLFLTFNISYWTHY 469          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0343789)

HSP 1 Score: 246.514 bits (628), Expect = 2.500e-75
Identity = 153/432 (35.42%), Postives = 239/432 (55.32%), Query Frame = 3
Query:  294 ERIMDKILQ--NYSLNERPIESNQT------RVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLA-------INRQKTHHMQTSQILNRNELEFCEEL--DILLTAQQYAN---NYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYL 1529
            ++++D+IL    Y    RP   N T      RV +F++  +I+ ++   MEYS  L  R+ W D RL++D++     +    ++ +  +R+W+PDLFF N KEG+ H +  PN  +R+FPNG VLYS +I++  +C M+L+ YP+D Q C + + SYG+T + L F W + +P+++  N+ +P F    K  T+ C  +S T TG YSCLK   + +R+   YL+  +IP  ++VIVSW++FW+   AVPAR++LG+ TLL + TQ SGI+ +LP VSY KAIDVW   C+ FV GALLEFA+ +  ++  +      E     R++L + +L         +   T  M+       + L   + L  ++ + A +  N    + S+    Q  R K        +IDV SR  FP  F  +N  YW  YL
Sbjct:   34 KKVLDQILGAGKYDARIRPSGINGTDGPAVVRVNIFVR--SISKIDDVTMEYSVQLTFREQWTDERLKFDDIQGRLKY----LTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRFTL-EKFLTDYC--NSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSDRAADMHKENMKKKRRDLEQASLDAASDLLDTDSNATFAMKPLVRHPGDPLALEKRLQCEVHMQAPKRPNCCKTWLSKFPTRQCSRSK--------RIDVISRITFPLVFALFNLVYWSTYL 448          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0335416)

HSP 1 Score: 244.973 bits (624), Expect = 8.974e-75
Identity = 150/424 (35.38%), Postives = 235/424 (55.42%), Query Frame = 3
Query:  294 ERIMDKILQ--NYSLNERPIESNQT------RVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQ--WKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEI--EESKIDVYSRYLFPSCFIFYNFCYWIYYL 1529
            ++++D+IL    Y    RP   N T      RV +F++  +I+ ++   MEYS  L  R+ W D RL++D++     +    ++ +  +R+W+PDLFF N KEG+ H +  PN  +R+FPNG VLYS +I++  +C M+L+ YP+D Q C + + SYG+T + L F W + +P+++  N+ +P F    K  T+ C  +S T TG YSCLK   + +R+   YL+  +IP  ++VIVSW++FW+   AVPAR++LG+ TLL + TQ SGI+ +LP VSY KAIDVW   C+ FV GALLEFA+ +  A +  +++   K + RD+ +  L   +  ++           ++           D L   ++     H Q        +  LS+      +IDV SR  FP  F  +N  YW  YL
Sbjct:   34 KKVLDQILGAGKYDARIRPSGINGTDGPAVVRVNIFVR--SISKIDDVTMEYSVQLTFREQWTDERLKFDDIQGRLKY----LTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRFTL-EKFLTDYC--NSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVN-YASRSDMHKENMKKKRRDLEQASLDAASDLLDTDSNATFAMKPLVRHPG-------DPLALEKRLQCEVHMQAPKRPNCCKTWLSKFPTRSKRIDVISRITFPLVFALFNLVYWSTYL 440          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0335420)

HSP 1 Score: 244.588 bits (623), Expect = 1.092e-74
Identity = 149/424 (35.14%), Postives = 234/424 (55.19%), Query Frame = 3
Query:  294 ERIMDKILQ--NYSLNERP-----IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQ--WKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEI--EESKIDVYSRYLFPSCFIFYNFCYWIYYLI 1532
            ++++D+IL    Y    RP      ++  T V V M + +I+ ++   MEYS  L  R+ W D RL++D++     +    ++ +  +R+W+PDLFF N KEG+ H +  PN  +R+FPNG VLYS +I++  +C M+L+ YP+D Q C + + SYG+T + L F W + +P+++  N+ +P F    K  T+ C  +S T TG YSCLK   + +R+   YL+  +IP  ++VIVSW++FW+   AVPAR++LG+ TLL + TQ SGI+ +LP VSY KAIDVW   C+ FV GALLEFA+ +  A +  +++   K + RD+ +  L   +  ++           ++           D L   ++     H Q        +  LS+      +IDV SR  FP  F  +N  YW  YL 
Sbjct:   34 KKVLDQILGAGKYDARIRPSGINGTDNKATNVSVNMFLRSISKIDDYKMEYSVQLTFREQWTDERLKFDDIQGRLKY----LTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRFTL-EKFLTDYC--NSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVN-YASRSDMHKENMKKKRRDLEQASLDAASDLLDTDSNATFAMKPLVRHPG-------DPLALEKRLQCEVHMQAPKRPNCCKTWLSKFPTRSKRIDVISRITFPLVFALFNLVYWSTYLF 442          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0335417)

HSP 1 Score: 244.202 bits (622), Expect = 2.342e-74
Identity = 154/433 (35.57%), Postives = 243/433 (56.12%), Query Frame = 3
Query:  294 ERIMDKILQ--NYSLNERPIESNQT------RVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQ----QKKLYQ--WKSEVRDIVRQELSRWN--LAINRQKTHHMQTSQILNRNELEFCEEL--DILLTAQQYAN---NYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYL 1529
            ++++D+IL    Y    RP   N T      RV +F++  +I+ ++   MEYS  L  R+ W D RL++D++     +    ++ +  +R+W+PDLFF N KEG+ H +  PN  +R+FPNG VLYS +I++  +C M+L+ YP+D Q C + + SYG+T + L F W + +P+++  N+ +P F    K  T+ C  +S T TG YSCLK   + +R+   YL+  +IP  ++VIVSW++FW+   AVPAR++LG+ TLL + TQ SGI+ +LP VSY KAIDVW   C+ FV GALLEFA+ +  ++    +  +++   K + RD+ +  L   +  L  +   T  M+       + L   + L  ++ + A +  N    + S+    Q  R K        +IDV SR  FP  F  +N  YW  YL
Sbjct:   34 KKVLDQILGAGKYDARIRPSGINGTDGPAVVRVNIFVR--SISKIDDVTMEYSVQLTFREQWTDERLKFDDIQGRLKY----LTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRFTL-EKFLTDYC--NSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSGSNKANMHKENMKKKRRDLEQASLDAASDLLDTDSNATFAMKPLVRHPGDPLALEKRLQCEVHMQAPKRPNCCKTWLSKFPTRQCSRSK--------RIDVISRITFPLVFALFNLVYWSTYL 449          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0335418)

HSP 1 Score: 243.817 bits (621), Expect = 2.701e-74
Identity = 153/432 (35.42%), Postives = 242/432 (56.02%), Query Frame = 3
Query:  294 ERIMDKILQ--NYSLNERP-----IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQ----QKKLYQ--WKSEVRDIVRQELSRWN--LAINRQKTHHMQTSQILNRNELEFCEEL--DILLTAQQYAN---NYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYL 1529
            ++++D+IL    Y    RP      ++  T V V M + +I+ ++   MEYS  L  R+ W D RL++D++     +    ++ +  +R+W+PDLFF N KEG+ H +  PN  +R+FPNG VLYS +I++  +C M+L+ YP+D Q C + + SYG+T + L F W + +P+++  N+ +P F    K  T+ C  +S T TG YSCLK   + +R+   YL+  +IP  ++VIVSW++FW+   AVPAR++LG+ TLL + TQ SGI+ +LP VSY KAIDVW   C+ FV GALLEFA+ +  ++    +  +++   K + RD+ +  L   +  L  +   T  M+       + L   + L  ++ + A +  N    + S+    Q  R K        +IDV SR  FP  F  +N  YW  YL
Sbjct:   34 KKVLDQILGAGKYDARIRPSGINGTDNKATNVSVNMFLRSISKIDDYKMEYSVQLTFREQWTDERLKFDDIQGRLKY----LTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRFTL-EKFLTDYC--NSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSGSNKANMHKENMKKKRRDLEQASLDAASDLLDTDSNATFAMKPLVRHPGDPLALEKRLQCEVHMQAPKRPNCCKTWLSKFPTRQCSRSK--------RIDVISRITFPLVFALFNLVYWSTYL 450          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra3 (glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-020402-1])

HSP 1 Score: 246.128 bits (627), Expect = 4.162e-75
Identity = 143/431 (33.18%), Postives = 236/431 (54.76%), Query Frame = 3
Query:  276 VAGITRERIMDKIL---QNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQ-KKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEE------SKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
             A ++    +DK++     Y    RP  +     V   + + +  S+  + M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K  + H +T  N L+R+F NG VLYS ++T+  SC MDL+ +PMD Q+C M + S+GYT++ L F W +  P+++ + + +P+F    + +   CT      TG ++C++  F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q K+L +++   +   ++E  R                     + L F           + ANN  +  S   +   K   E+ +       KID  SR  FP  F+F+N  YW+ Y I+
Sbjct:   38 AAPMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEKGPVQVADGLTLPQFILKDESDLRYCTKH--YNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRRRKKSGKEEEVR--------------------ESRLSFTPNAGKDGAVPKTANNAATTPSEPAVAPGKSHEEMRKLFIDRAKKIDTVSRAGFPLAFLFFNIFYWVLYKIL 442          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra4b (glycine receptor, alpha 4b [Source:ZFIN;Acc:ZDB-GENE-020402-2])

HSP 1 Score: 242.662 bits (618), Expect = 4.361e-74
Identity = 146/451 (32.37%), Postives = 247/451 (54.77%), Query Frame = 3
Query:  213 QQQSNIFIFLL-----AIHVGCNSCSVAGITRERIMDKIL---QNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESK-IDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            +  SN+ +F+L     +  +   S     ++    +DK++     Y    RP  +     V   + + +  S+  + M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K    H +T  N L+R+F NG VLYS ++T+  SC MDL+ +PMDTQ+C M + S+GYT++ L F W    P+++ +++ +P+F    + +   CT      TG ++C++  F L RQ+G YL+  +IP+ L VI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q K +     +R  +RQE        NR++    Q++  L+     F                     +   I+R+     +E++K ID  SR +FP  F+ +N  YW+ Y ++
Sbjct:    2 KHNSNLVVFVLLWCVFSKELKSPSVRTKPMSPSDFLDKLMGKTSGYDARIRPNFKGPPVNVTCNIFINSFGSITETTMDYRLNVFLRQQWNDPRLAYKEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFQNGNVLYSIRLTLILSCPMDLKNFPMDTQTCTMQLESFGYTMNDLIFQWLDEGPVQVADDLMLPQFVLKEEKDLGYCTKH--YNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLTVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQYKEF---FRLRRKLRQEQR------NRERDPLTQSNGPLSEAAAMFA--------------GLPPGHALFDIRRR----FVEQAKRIDTISRAVFPLSFLVFNVFYWVTYKVL 419          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra4b (glycine receptor, alpha 4b [Source:ZFIN;Acc:ZDB-GENE-020402-2])

HSP 1 Score: 241.121 bits (614), Expect = 2.868e-73
Identity = 136/383 (35.51%), Postives = 221/383 (57.70%), Query Frame = 3
Query:  390 AINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESK-IDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            +  S+  + M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K    H +T  N L+R+F NG VLYS ++T+  SC MDL+ +PMDTQ+C M + S+GYT++ L F W    P+++ +++ +P+F    + +   CT      TG ++C++  F L RQ+G YL+  +IP+ L VI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q K +     +R  +RQE                       RN  EF     + + A  +A       +   I+R+     +E++K ID  SR +FP  F+ +N  YW+ Y ++
Sbjct:   84 SFGSITETTMDYRLNVFLRQQWNDPRLAYKEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFQNGNVLYSIRLTLILSCPMDLKNFPMDTQTCTMQLESFGYTMNDLIFQWLDEGPVQVADDLMLPQFVLKEEKDLGYCTKH--YNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLTVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQYKEF---FRLRRKLRQE----------------------QRNRFEFSPY--VHMAAAMFA-GLPPGHALFDIRRR----FVEQAKRIDTISRAVFPLSFLVFNVFYWVTYKVL 428          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 241.121 bits (614), Expect = 3.590e-73
Identity = 140/392 (35.71%), Postives = 223/392 (56.89%), Query Frame = 3
Query:  390 AINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSL-VSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIE---------ESKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            +  SV  + M+Y  +++LRQ W D RL +      ++ +SSL + PS+ D +W PDLFF N K    H +T  N L+R+F +G VLYS ++T+  SC MDL+ +PMD Q+C M + S+GYT++ L F W    P+++ + + +P+F    + +   CT      TG ++C++  F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q+K +                  L + R++    Q  + L    L F    +     +  A   ++Q   +QI++  IL   E           +ID  SR  FP  F+ +N  YWI Y II
Sbjct:   79 SFGSVTETTMDYRVNIFLRQKWNDPRLAYS-----EYPDSSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRIFKDGTVLYSIRLTLILSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLDKGPVQVADGLTLPQFLIRDEKDLGYCTKHY--NTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAGVNFVSRQQKEF------------------LRLKRRQ-RRTQKEEDLQDGRLHF-SSYNTTTCVKDGAVVKNTQ--VNQIQQPSILKNTETNRKKFVDRAKRIDTISRAAFPLAFLIFNVFYWITYKII 441          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra1 (glycine receptor, alpha 1 [Source:NCBI gene;Acc:30676])

HSP 1 Score: 238.81 bits (608), Expect = 2.150e-72
Identity = 141/420 (33.57%), Postives = 234/420 (55.71%), Query Frame = 3
Query:  294 ERIMDKILQNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQ-KKLYQWKSEVRDIVRQEL--SRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIVS 1541
            +++M K+   Y    RP  +     V   + + +  S+  + M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K    H +T  N L+R+  NG VLYS +IT+  +C MDL+ +PMD Q+C M + S+GYT++ L F W +   +++ + + +P+F    + +   CT    T  G ++C++A F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + +A+Q K+L +++   R +   E    R++ A        +Q             + + I         + +  E   +  R+  +S  +  +ID  SR  FP  F+ +N  YWI Y II S
Sbjct:   39 DKLMGKV-SGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTKHYNT--GKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFQRRRRHLKEDEAGDGRFSFAAYGMGPACLQAK-----------DGMAIKGNNNNAPTSTNPPEKTVEEMRKLFISRAK--RIDTVSRVAFPLVFLIFNIFYWITYKIIRS 438          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: tal1 (T-cell acute lymphocytic leukemia 1 [Source:Xenbase;Acc:XB-GENE-479827])

HSP 1 Score: 249.98 bits (637), Expect = 2.045e-76
Identity = 140/389 (35.99%), Postives = 222/389 (57.07%), Query Frame = 3
Query:  390 AINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLY-------QWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            +  SV  + M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K    H +T  N L+R+F NG VLYS ++T+  SC MDL+ +PMD Q+C M + S+GYT++ L F W  T+P+++ + + +P+F    + E   CT      TG ++C++  F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q K +       + +S+  D+ R+  SR+N +      H +Q                   + A          + A  IK++ +       +ID  SR  FP  F+ +N  YWI Y II
Sbjct:   79 SFGSVTETTMDYRVNIFLRQTWNDPRLSYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCAMQLESFGYTMNDLIFEWLSTSPVQVADGLTLPQFILKEENELGYCTKH--YNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFLRLRRRQKRQSKEEDVARE--SRFNFS-GYGMGHCLQVKD-------------GTAVKATPPIPPPPQPKDADSIKKKFV---DRAKRIDTISRAAFPLAFLIFNIFYWITYKII 442          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: tal1 (T-cell acute lymphocytic leukemia 1 [Source:Xenbase;Acc:XB-GENE-479827])

HSP 1 Score: 248.825 bits (634), Expect = 3.366e-76
Identity = 139/389 (35.73%), Postives = 222/389 (57.07%), Query Frame = 3
Query:  390 AINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLY-------QWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            +  S+  + M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K    H +T  N L+R+F NG VLYS ++T+  SC MDL+ +PMD Q+C M + S+GYT++ L F W  T+P+++ + + +P+F    + E   CT      TG ++C++  F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q K +       + +S+  D+ R+  SR+N +      H +Q                   + A          + A  IK++ +       +ID  SR  FP  F+ +N  YWI Y II
Sbjct:   65 SFGSIAETTMDYRVNIFLRQTWNDPRLSYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCAMQLESFGYTMNDLIFEWLSTSPVQVADGLTLPQFILKEENELGYCTKH--YNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFLRLRRRQKRQSKEEDVARE--SRFNFS-GYGMGHCLQVKD-------------GTAVKATPPIPPPPQPKDADSIKKKFV---DRAKRIDTISRAAFPLAFLIFNIFYWITYKII 428          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: tal1 (T-cell acute lymphocytic leukemia 1 [Source:Xenbase;Acc:XB-GENE-479827])

HSP 1 Score: 248.825 bits (634), Expect = 3.446e-76
Identity = 139/389 (35.73%), Postives = 222/389 (57.07%), Query Frame = 3
Query:  390 AINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLY-------QWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            +  S+  + M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K    H +T  N L+R+F NG VLYS ++T+  SC MDL+ +PMD Q+C M + S+GYT++ L F W  T+P+++ + + +P+F    + E   CT      TG ++C++  F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q K +       + +S+  D+ R+  SR+N +      H +Q                   + A          + A  IK++ +       +ID  SR  FP  F+ +N  YWI Y II
Sbjct:   57 SFGSIAETTMDYRVNIFLRQTWNDPRLSYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCAMQLESFGYTMNDLIFEWLSTSPVQVADGLTLPQFILKEENELGYCTKH--YNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFLRLRRRQKRQSKEEDVARE--SRFNFS-GYGMGHCLQVKD-------------GTAVKATPPIPPPPQPKDADSIKKKFV---DRAKRIDTISRAAFPLAFLIFNIFYWITYKII 420          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: glrb (glycine receptor beta [Source:NCBI gene;Acc:779708])

HSP 1 Score: 249.595 bits (636), Expect = 3.898e-76
Identity = 147/451 (32.59%), Postives = 249/451 (55.21%), Query Frame = 3
Query:  276 VAGITRERIMDKILQNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTK-VETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQ-KKLYQWKSEVRDIVRQELSRWNLA----INRQKTH-HMQTSQI--------------LNRNELEFCEELDILLTAQQY--------ANNYHSQESAHQIKRQKILSEI---EESKIDVYSRYLFPSCFIFYNFCYWIYYL 1529
            V   +   I++++L +Y    RP  +     V+V + + +  S+  + M+Y  +++LRQ W D RL+  N  +F+  ++  V P++   LW PDLFF N K    H +T+ N L+ +F +G+VL S ++++  SC +DL  +PMDTQ C+M + S+GYT D L+F W   +P+++   + +P+F+  T+ +E  +CT      TG+Y+C++ +F LRRQ+G Y++  + P  LIV++SWL+FW++ +A  AR+ LG+ ++L + ++ + ++  LP+VSY+KAIDVWLIAC++F   +L+E+AV   +    K++   K+++    + E    N A    +N   T  H+ T Q+              L  N+      L        Y         NN   +  A   K+      +   E  +ID+YSR LFP CF+F+N  YW+ YL
Sbjct:   15 VPANSTSNILNRLLVSYDPRVRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQRWNDPRLKLPN--DFRGSDALTVDPTMFKCLWKPDLFFANEKNANFHDVTQENILLFIFRDGDVLLSMRLSITLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQM-EKIALPQFDIKTEDIEYGNCTKYYKG-TGYYTCVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVPLGIFSVLSLASECTTLAQELPKVSYVKAIDVWLIACLLFGFASLVEYAVVQVLLNSPKRIEAEKAKIAKAEQAEGKGANAAKKNTVNGTGTPIHISTLQVGENRCKKVCTSKSDLRSNDFSIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPSEAKRIDLYSRALFPFCFLFFNVIYWLVYL 461          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: glrb (glycine receptor beta [Source:NCBI gene;Acc:779708])

HSP 1 Score: 249.595 bits (636), Expect = 4.693e-76
Identity = 147/451 (32.59%), Postives = 249/451 (55.21%), Query Frame = 3
Query:  276 VAGITRERIMDKILQNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTK-VETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQ-KKLYQWKSEVRDIVRQELSRWNLA----INRQKTH-HMQTSQI--------------LNRNELEFCEELDILLTAQQY--------ANNYHSQESAHQIKRQKILSEI---EESKIDVYSRYLFPSCFIFYNFCYWIYYL 1529
            V   +   I++++L +Y    RP  +     V+V + + +  S+  + M+Y  +++LRQ W D RL+  N  +F+  ++  V P++   LW PDLFF N K    H +T+ N L+ +F +G+VL S ++++  SC +DL  +PMDTQ C+M + S+GYT D L+F W   +P+++   + +P+F+  T+ +E  +CT      TG+Y+C++ +F LRRQ+G Y++  + P  LIV++SWL+FW++ +A  AR+ LG+ ++L + ++ + ++  LP+VSY+KAIDVWLIAC++F   +L+E+AV   +    K++   K+++    + E    N A    +N   T  H+ T Q+              L  N+      L        Y         NN   +  A   K+      +   E  +ID+YSR LFP CF+F+N  YW+ YL
Sbjct:   26 VPANSTSNILNRLLVSYDPRVRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQRWNDPRLKLPN--DFRGSDALTVDPTMFKCLWKPDLFFANEKNANFHDVTQENILLFIFRDGDVLLSMRLSITLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQM-EKIALPQFDIKTEDIEYGNCTKYYKG-TGYYTCVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVPLGIFSVLSLASECTTLAQELPKVSYVKAIDVWLIACLLFGFASLVEYAVVQVLLNSPKRIEAEKAKIAKAEQAEGKGANAAKKNTVNGTGTPIHISTLQVGENRCKKVCTSKSDLRSNDFSIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPSEAKRIDLYSRALFPFCFLFFNVIYWLVYL 472          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra2 (glycine receptor, alpha 2 subunit [Source:MGI Symbol;Acc:MGI:95748])

HSP 1 Score: 240.35 bits (612), Expect = 7.658e-73
Identity = 153/468 (32.69%), Postives = 244/468 (52.14%), Query Frame = 3
Query:  213 QQQSNIFIFLLAIHVGCNSCSVA---------------GITRERIMDKIL---QNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLY-------QWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNY-HSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            +Q  NI   L A  +G N    A                ++    +DK++     Y    RP  +     V   + + +  SV  + M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K    H +T  N L+R+  NG+VLYS ++T+  SC MDL+ +PMD Q+C M + S+GYT++ L F W    P+++   + +P+F    + E   CT      TG ++C++  F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q K +       + +++  D+ R+  SR+N +      H +Q                D        AN      + A  IK++ +       +ID  SR  FP  F+ +N  YWI Y II
Sbjct:    3 RQLVNILTALFAFFLGTNHFREAFCKDHDSRSGKHPSQTLSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTKHY--NTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFLRLRRRQKRQNKEEDVTRE--SRFNFS-GYGMGHCLQMK--------------DGTAVKATPANPLPQPPKDADAIKKKFV---DRAKRIDTISRAAFPLAFLIFNIFYWITYKII 444          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glrb (glycine receptor, beta subunit [Source:MGI Symbol;Acc:MGI:95751])

HSP 1 Score: 238.039 bits (606), Expect = 1.899e-71
Identity = 140/442 (31.67%), Postives = 239/442 (54.07%), Query Frame = 3
Query:  300 IMDKILQNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTK-VETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTV------AQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQI--------------LNRNELEFCEELDILLTAQQY--------ANN--YHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYL 1529
            I++++L +Y    RP  +     V+V + + +  S+  + M+Y  +++LRQ W D RL+  +  +F+  ++  V P++   LW PDLFF N K    H +T+ N L+ +F +G+VL S ++++  SC +DL  +PMDTQ C+M + S+GYT D L+F W   +P++L   + +P+F+   + +E  +CT      TG+Y+C++ +F LRRQ+G Y++  + P  LIV++SWL+FW++ +A  AR+ LG+ ++L + ++ + ++  LP+VSY+KA+DVWLIAC++F   +L+E+AV   +       + +K    K+E  D      ++ N         H+ T Q+              L  N+      L        Y         NN     Q    +    K +      +ID+Y+R LFP CF+F+N  YW  YL
Sbjct:   59 ILNRLLVSYDPRIRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLKLPS--DFRGSDALTVDPTMYKCLWKPDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSITLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQL-EKIALPQFDIKKEDIEYGNCTKYYKG-TGYYTCVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVPLGIFSVLSLASECTTLAAELPKVSYVKALDVWLIACLLFGFASLVEYAVVQVMLNNPKRVEAEKARIAKAEQADGKGGNAAKKNTVNGTGTPVHISTLQVGETRCKKVCTSKSDLRSNDFSIVGSLPRDFELSNYDCYGKPIEVNNGLGKPQAKNKKPPPAKPVIPTAAKRIDLYARALFPFCFLFFNVIYWSIYL 496          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra3 (glycine receptor, alpha 3 subunit [Source:MGI Symbol;Acc:MGI:95749])

HSP 1 Score: 234.187 bits (596), Expect = 3.087e-70
Identity = 142/431 (32.95%), Postives = 231/431 (53.60%), Query Frame = 3
Query:  279 AGITRERIMDKIL---QNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNL--AINRQKTHHM-QTSQILNRNELEFCE-ELDILLTAQQ----YANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            A ++    +DK++     Y    RP  +     V   + + +  S+  + M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K    H +T  N L+R+F NG VLYS ++T+  SC MDL+ +PMD Q+C M + S+GYT++ L F W    P+++   + +P+F    + +   CT      TG ++C++  F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q K         +++R    R N   A   +K +    T   +  +   F    +   L A+        N+  Q         + +      KID  SR  FP  F+ +N  YW+ Y I+
Sbjct:   55 APMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTKH--YNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK---------ELLRFRRKRKNKTEAFALEKFYRFSDTDDEVRESRFSFTAYGMGPCLQAKDGVVPKGPNHAVQVMPKSPDEMRKVFIDRAKKIDTISRACFPLAFLIFNIFYWVIYKIL 470          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra1 (glycine receptor, alpha 1 subunit [Source:MGI Symbol;Acc:MGI:95747])

HSP 1 Score: 228.794 bits (582), Expect = 1.918e-69
Identity = 133/376 (35.37%), Postives = 213/376 (56.65%), Query Frame = 3
Query:  417 MEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQE---LSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            M+Y  +++LRQ W D RL +   NE+   +S  + PS+ D +W PDLFF N K  + H +T  N L+R+  NG VLYS +IT+  +C MDL+ +PMD Q+C M + S+GYT++ L F W +   +++ + + +P+F    + +   CT    T  G ++C++A F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q K        R   + +     R+N +        +Q    ++       +  +   T         S E   ++  Q+        KID  SR  FP  F+ +N  YWI Y I+
Sbjct:    1 MDYRVNIFLRQQWNDPRLAY---NEYPD-DSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKHYNT--GKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRRHHKDDEGGEGRFNFSAYGMGPACLQAKDGIS------VKGANNNNTTNPPPAPSKSPEEMRKLFIQR------AKKIDKISRIGFPMAFLIFNMFYWIIYKIV 358          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra1 (glycine receptor, alpha 1 subunit [Source:MGI Symbol;Acc:MGI:95747])

HSP 1 Score: 231.106 bits (588), Expect = 2.143e-69
Identity = 134/385 (34.81%), Postives = 217/385 (56.36%), Query Frame = 3
Query:  390 AINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQE---LSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            +  S+  + M+Y  +++LRQ W D RL +   NE+   +S  + PS+ D +W PDLFF N K  + H +T  N L+R+  NG VLYS +IT+  +C MDL+ +PMD Q+C M + S+GYT++ L F W +   +++ + + +P+F    + +   CT      TG ++C++A F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q K        R   + +     R+N +        +Q    ++       +  +   T         S E   ++  Q+        KID  SR  FP  F+ +N  YWI Y I+
Sbjct:   75 SFGSIAETTMDYRVNIFLRQQWNDPRLAY---NEYPD-DSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRRHHKDDEGGEGRFNFSAYGMGPACLQAKDGIS------VKGANNNNTTNPPPAPSKSPEEMRKLFIQR------AKKIDKISRIGFPMAFLIFNMFYWIIYKIV 441          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|Q17328|GLUCB_CAEEL (Glutamate-gated chloride channel subunit beta OS=Caenorhabditis elegans OX=6239 GN=glc-2 PE=1 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 6.854e-73
Identity = 149/435 (34.25%), Postives = 238/435 (54.71%), Query Frame = 3
Query:  288 TRERIMDKILQNYSLNERPIESNQT-------RVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMEL--GNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQ-ELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQY-----ANNYHSQES-AHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIVSN 1544
            + + I++ +L+NY +  RP  +N +       RV + +++L+   ++V NMEYS  L  R+ W+D RL ++NL  F +  + L  P +K  LW+PD FF   K  + H++   N  +R++P+G++LYS +I++  SC M LQ YP+D QSC  ++ SY +T++ + + W  + P++L  G    +P F         DCT  S T TG Y CL+   + +RQ   YLV  + P T+IVIVSW++FW+ + +   R+ LG+ TLL + T  S I+  LP VSY+K +DVWL AC  FV GALLE+A  S        YQ      D VRQ + SR   A   Q+           R +LE       ++ A+ Y      + + ++E+   +++R     +   +KID Y+R++ P  F+ +N  YW+  LI+ +N
Sbjct:   28 SEQEILNALLKNYDMRVRPPPANSSTEGAVNVRVNIMIRMLS--KIDVVNMEYSIQLTFREQWIDPRLAYENLG-FYNPPAFLTVPHVKKSLWIPDTFFPTEKAAHRHLIDMENMFLRIYPDGKILYSSRISLTSSCPMRLQLYPLDYQSCNFDLVSYAHTMNDIMYEWDPSTPVQLKPGVGSDLPNFILKNYTTNADCT--SHTNTGSYGCLRMQLLFKRQFSYYLVQLYAPTTMIVIVSWVSFWIDLHSTAGRVALGVTTLLTMTTMQSAINAKLPPVSYVKVVDVWLGACQTFVFGALLEYAFVS--------YQ------DSVRQNDRSREKAARKAQR----------RREKLE-------MVDAEVYQPPCTCHTFEARETFRDKVRRYFTKPDYLPAKIDFYARFVVPLAFLAFNVIYWVSCLIMSAN 426          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|P91730|GLUCB_HAECO (Glutamate-gated chloride channel subunit beta OS=Haemonchus contortus OX=6289 PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 7.449e-73
Identity = 144/431 (33.41%), Postives = 223/431 (51.74%), Query Frame = 3
Query:  273 SVAGITRERIMDKILQNYSLNERPIESNQTRVM------VFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMEL--GNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIVS 1541
            S  G   + I++++L NY +  RP  SN +  M      V + +  ++ ++V NMEYS  L  R+ W+D RL + +L  + +    L  P +K  LW+PD FF   K  + H++   N  +R+ P+G+VLYS +I++  SC M LQ YP+D Q C+ ++ SY +T+  + + W    P++L  G    +P F        +DCT  S T TG Y+CL+    L+RQ   YLV  + P T+IVIVSW++FW+ + +   R+ LG+ TLL + T  + I+  LP VSY+K +DVWL AC  FV GALLE+A  S    Q++  Q KS      ++  ++  L + R++     T  +    E  F + L    T   Y                        +KID Y+R+  P  F+ +N  YW   L++VS
Sbjct:   25 STGGTQEQEILNELLSNYDMRVRPPPSNYSDPMGPVTVRVNIMIRMLSKIDVVNMEYSMQLTFREQWLDSRLAYAHLG-YHNPPKFLTVPHIKSNLWIPDTFFPTEKAAHRHLIDTDNMFLRIHPDGKVLYSSRISITSSCHMQLQLYPLDLQFCDFDLVSYAHTMKDIVYEWDPLAPVQLKPGVGSDLPNFQLTNITTNDDCT--SHTNTGSYACLRMQLTLKRQFSYYLVQLYGPTTMIVIVSWVSFWIDMHSTAGRVALGVTTLLTMTTMQAAINAKLPPVSYVKVVDVWLGACQTFVFGALLEYAFVSYQDSQRQTEQAKSRAARKAQKRRAKMEL-VEREQYQPPCTCHLYQDYEPSFRDRLRRYFTKPDYL----------------------PAKIDYYARFCVPLGFLAFNAIYWTSCLVMVS 429          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|P48167|GLRB_HUMAN (Glycine receptor subunit beta OS=Homo sapiens OX=9606 GN=GLRB PE=1 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 1.246e-72
Identity = 141/443 (31.83%), Postives = 242/443 (54.63%), Query Frame = 3
Query:  300 IMDKILQNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTK-VETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTV------AQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQI--------------LNRNELEFCEELDILLTAQQY--------ANNYHSQESAHQIKR---QKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYL 1529
            I++++L +Y    RP  +     V+V + + +  S+  + M+Y  +++LRQ W D RL+  +  +F+  ++  V P++   LW PDLFF N K    H +T+ N L+ +F +G+VL S ++++  SC +DL  +PMDTQ C+M + S+GYT D L+F W   +P++L   + +P+F+   + +E  +CT      TG+Y+C++ +F LRRQ+G Y++  + P  LIV++SWL+FW++ +A  AR+ LG+ ++L + ++ + ++  LP+VSY+KA+DVWLIAC++F   +L+E+AV   +       + +K    K+E  D     +++ N         H+ T Q+              L  N+      L        Y         NN   +  A   K+    K +      +ID+Y+R LFP CF+F+N  YW  YL
Sbjct:   59 ILNRLLVSYDPRIRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLKLPS--DFRGSDALTVDPTMYKCLWKPDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSITLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQL-EKIALPQFDIKKEDIEYGNCTKYYKG-TGYYTCVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVPLGIFSVLSLASECTTLAAELPKVSYVKALDVWLIACLLFGFASLVEYAVVQVMLNNPKRVEAEKARIAKAEQADGKGGNVAKKNTVNGTGTPVHISTLQVGETRCKKVCTSKSDLRSNDFSIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPTAAKRIDLYARALFPFCFLFFNVIYWSIYL 497          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|Q94900|GLUCL_DROME (Glutamate-gated chloride channel OS=Drosophila melanogaster OX=7227 GN=GluClalpha PE=1 SV=2)

HSP 1 Score: 241.891 bits (616), Expect = 1.415e-72
Identity = 153/433 (35.33%), Postives = 243/433 (56.12%), Query Frame = 3
Query:  294 ERIMDKILQ--NYSLNERPIESNQT------RVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQ----QKKLYQ--WKSEVRDIVRQELSRWN--LAINRQKTHHMQTSQILNRNELEFCEEL--DILLTAQQYAN---NYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYL 1529
            ++++D+IL    Y    RP   N T      R+ +F++  +I +++   MEYS  L  R+ W D RL++D++     +    ++ +  +R+W+PDLFF N KEG+ H +  PN  +R+FPNG VLYS +I++  +C M+L+ YP+D Q C + + SYG+T + L F W + +P+++  N+ +P F    K  T+ C  +S T TG YSCLK   + +R+   YL+  +IP  ++VIVSW++FW+   AVPAR++LG+ TLL + TQ SGI+ +LP VSY KAIDVW   C+ FV GALLEFA+ +  ++    +  +++   K + RD+ +  L   +  L  +   T  M+       + L   + L  ++ + A +  N    + S+    Q  R K        +IDV SR  FP  F  +N  YW  YL
Sbjct:   34 KKVLDQILGAGKYDARIRPSGINGTDGPAIVRINLFVR--SIMTISDIKMEYSVQLTFREQWTDERLKFDDIQGRLKY----LTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRFTL-EKFLTDYC--NSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSGSNKANMHKESMKKKRRDLEQASLDAASDLLDTDSNATFAMKPLVRHPGDPLALEKRLQCEVHMQAPKRPNCCKTWLSKFPTRQCSRSK--------RIDVISRITFPLVFALFNLVYWSTYL 449          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|Q9GJS9|GLRB_BOVIN (Glycine receptor subunit beta OS=Bos taurus OX=9913 GN=GLRB PE=2 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 5.218e-72
Identity = 141/445 (31.69%), Postives = 243/445 (54.61%), Query Frame = 3
Query:  300 IMDKILQNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTK-VETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQE--------LSRWNLAINRQKTHHMQTSQI--------------LNRNELEFCEELDILLTAQQY--------ANNYHSQESAHQIKR---QKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYL 1529
            I++++L +Y    RP  +     V+V + + +  S+  + M+Y  +++LRQ W D RL+  +  +F+  ++  V P++   LW PDLFF N K    H +T+ N L+ +F +G+VL S ++++  SC +DL  +PMDTQ C+M + S+GYT D L+F W   +P++L   + +P+F+   + +E  +CT      TG+Y+C++ +F LRRQ+G Y++  + P  LIV++SWL+FW++ +A  AR+ LG+ ++L + ++ + ++  LP+VSY+KA+DVWLIAC++F   +L+E+AV   +    K  + ++E   I + E        +++ N         H+ T Q+              L  N+      L        Y         NN   +  A   K+    K +      +ID+Y+R LFP CF+F+N  YW  YL
Sbjct:   59 ILNRLLVSYDPRIRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLKLPS--DFRGSDALTVDPTMYKCLWKPDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSITLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQL-EKIALPQFDIKKEDIEYGNCTKYYKG-TGYYTCVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVPLGIFSVLSLASECTTLAAELPKVSYVKALDVWLIACLLFGFASLVEYAVVQVMLNNPK--RVEAEKARIAKAEQAVGKGGNVAKKNTVNGASTPVHISTLQVGETRCKKVCTSKSDLRSNDFSIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPTAAKRIDLYARALFPFCFLFFNVIYWSIYL 497          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A183SPC0 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS6068 PE=3 SV=1)

HSP 1 Score: 458.373 bits (1178), Expect = 1.674e-153
Identity = 237/427 (55.50%), Postives = 307/427 (71.90%), Query Frame = 3
Query:  276 VAGITRERIMDKILQNYSLNERPIE--SNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELE----FCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIV 1538
             A   R+R++  +  NY  +ERP E     T V V MKVLAI SV+V  M+Y  D  LRQ W D RL WD   EF++F  +LVSP+LK+ LWLPDLFFRNGK+GY+H MT PNYL+R++PNG VLYSQKITMRFSCQMDLQT+PMDTQ C MNIGSYGYTL++LKF W   NP+EL + +QI EFN P+   T DCT  S+T TG Y+CL A F L+RQLGSYLV+T+IPN LI++VSWL+F+VSV+A PAR+ LGLL+LLG+LTQAS ++ NLPRVSYIKAID+WLI  I+FVI  L+E+A+A T+ ++K+   W+++V  IV++EL+RW  A  + +  +MQ       +EL     F  +LD+ LT          +ES  + ++ KI  E  ES+ID YSR+LFP+C+I YN  YW+YYL+IV
Sbjct:   77 TASTLRDRLVGMLFSNYKTHERPTELLDMATVVEVNMKVLAIFSVDVRTMDYYIDALLRQTWTDPRLAWDTSKEFENFTQALVSPTLKESLWLPDLFFRNGKDGYLHKMTLPNYLLRVYPNGNVLYSQKITMRFSCQMDLQTFPMDTQHCHMNIGSYGYTLNELKFAWRPENPVELPDKLQISEFNTPSNFTTIDCTAMSSTSTGNYTCLMAKFALKRQLGSYLVTTYIPNILIIMVSWLSFYVSVDAAPARVPLGLLSLLGLLTQASSVTANLPRVSYIKAIDLWLIFSIIFVISVLVEYAIAITLLRRKRRENWRNDVESIVKEELARWCAACQQTQLANMQLKSGAVGHELSQQFAFYNDLDLFLTRTVI------EESQKKSRKTKI-PEATESEIDAYSRFLFPTCYIMYNVFYWLYYLVIV 496          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A3S5FGS1 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS33396 PE=3 SV=1)

HSP 1 Score: 455.677 bits (1171), Expect = 2.972e-153
Identity = 232/418 (55.50%), Postives = 306/418 (73.21%), Query Frame = 3
Query:  288 TRERIMDKILQNYSLNERPIE--SNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            TR+RI++ I +NY  +ERP E  +  T V V M+VLAI S++V NM+Y  D YLRQ+W D RL W +++EF+ +   +VS  LK+ +WLPDLFFRNGKEGY+H MT PNYL+R+ P+G VLYSQKITMRFSCQM+LQ +PMD Q C +NIGSYGYTL++LKF W +   + L   ++I EFN P   +T DCTNSS T TG Y+CL A F L+RQL SYL +T+IPN LI++VSWL+FWV+V+A PAR+ LGLL+LLGILTQAS +S +LPRVSYIKAID+W+I  I+FVIG L+E+A+A T+ ++K+   W  +VR+IVRQEL++W  A  +Q    +Q S  L R +LEFCEEL+ LLT Q      H +E    +K     +   ES+ID YSR+LFP+CF+ YN  YW+YYL++
Sbjct:   32 TRDRIVNHIFRNYLKHERPTELDNTPTEVGVNMRVLAIFSIDVRNMDYYIDAYLRQIWFDKRLAWAHIDEFRQYKQPIVSSKLKNDIWLPDLFFRNGKEGYLHTMTVPNYLLRVMPDGNVLYSQKITMRFSCQMELQNFPMDMQVCGLNIGSYGYTLNELKFVWHE-EKVNLSGRMRISEFNTPETFDTFDCTNSSKTSTGNYTCLNATFKLKRQLSSYLATTYIPNILIIMVSWLSFWVNVDAAPARVPLGLLSLLGILTQASSVSNSLPRVSYIKAIDIWMIFSIIFVIGVLVEYALALTMLRRKRADTWHRDVREIVRQELAKWCTACQQQHLVQLQNSHQLTRGQLEFCEELEALLTNQVID---HQKEKNKAVKP----TTTTESEIDSYSRFLFPACFLLYNCFYWLYYLVL 441          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A0R3UFU9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS6030 PE=3 SV=1)

HSP 1 Score: 457.603 bits (1176), Expect = 4.617e-153
Identity = 224/429 (52.21%), Postives = 312/429 (72.73%), Query Frame = 3
Query:  291 RERIMDKILQNYSLNERPIE--SNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTS-QILNRNELEFCEELDILLTAQQYANNYHSQESAHQIK--------RQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIVSN 1544
            RE I++KI  NY  +ERP E     T V V MK+ +I S++V  M+Y  D  LRQ WVD RL WD + E ++F   +VSP +K++LWLPDLFFRNGKEGY+H MT PNYL+R++PNG+VLYSQKITMRF+CQMDLQT+PMD Q C++NIGSYGYTL +LKF WS+T+P+EL + +Q+ EFNAP    T DCT+ ++T TG Y+CL A F + RQLGSYLV+T+IPN LI++VSWL+FWVSV+A PAR+ LGL++LLGILTQAS +  NLPRVSYIKA+D+WLI  I+FVI  L+E+A+A +  ++ +  QWK ++R IVR+EL+RW  A  +++   M+ +  ++ + + ++  +++ ++T +     YH +  A   K        R K L+ + +S ID YSR+LFP C++ YN CYW+YYL++V +
Sbjct:   84 REDILEKIFLNYKTHERPTELLDTSTVVRVNMKIQSIFSIDVRTMDYYVDALLRQAWVDPRLAWDKMPEHRNFTQPIVSPKMKNQLWLPDLFFRNGKEGYLHKMTLPNYLLRVYPNGQVLYSQKITMRFACQMDLQTFPMDVQECDINIGSYGYTLSELKFMWSETSPIELNDEMQLSEFNAPKHFATFDCTSQASTSTGNYTCLLAKFSIARQLGSYLVTTYIPNILIIMVSWLSFWVSVDAAPARVPLGLMSLLGILTQASSVGSNLPRVSYIKALDLWLIFSIIFVISVLVEYALAISYLRKTRKCQWKDDLRAIVREELARWCSACQQKELESMRAAGAVVPKYQADYYTQMEAMITFRDAIEQYHKKRDARSGKGGISKSTARIKTLTGVTDSVIDGYSRFLFPLCYLAYNICYWLYYLVLVKH 512          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A0R3TPG4 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9358 PE=3 SV=1)

HSP 1 Score: 456.833 bits (1174), Expect = 7.853e-153
Identity = 227/424 (53.54%), Postives = 312/424 (73.58%), Query Frame = 3
Query:  291 RERIMDKILQNYSLNERPIE--SNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILN-RNELEFCEELDILLTAQQYANNYHSQESAHQI-----KRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIV 1538
            R+ I +KI  NY  NERP E     T VMV MK+ +I S++V  M+Y  D  LRQ WVD RL WDN+ E K+F   LVSP++K+ LWLPDLFFRNGKEGY+H MT PNYL+R++PNG+VLYSQKITMRF+CQMDLQT+PMD Q C++NIGSYGYTL +LKF WS++ P+EL  ++Q+ EFN P +  T+DCT++S+T TG Y+CL A F + R+LGSYLV+T+IPN LI++VSWL+FWVS++A PAR+ LGL++LLGILTQAS +  NLPRVSYIKAID+WLI  I+FVI  L+E+A+A T  ++ +  QW+S+VR IVR+EL++W  A  +++   ++ +  L   N  ++  +++ ++  +     YH +  A        +R K+++ + ES ID YSR+LFP C++ YN CYW+YYL+IV
Sbjct:   85 RDAIKEKIFTNYKSNERPTEQLDTSTIVMVNMKIQSIFSIDVRTMDYYVDALLRQAWVDPRLAWDNIPEHKNFTQPLVSPNMKNILWLPDLFFRNGKEGYLHKMTLPNYLLRVYPNGQVLYSQKITMRFACQMDLQTFPMDVQECDINIGSYGYTLSELKFVWSESAPIELNKDMQLSEFNTPKEFFTSDCTSASSTSTGNYTCLLAKFSIARRLGSYLVTTYIPNILIIMVSWLSFWVSIDAAPARVPLGLMSLLGILTQASSMGSNLPRVSYIKAIDLWLIFSIIFVISVLVEYALAITYLRKTRKGQWRSDVRAIVREELAKWCTACQQRELKSLKAAGALAPGNHADYYTQMEAMVAFRDVVELYHKRRLASNGHNGINERIKVITGVTESVIDGYSRFLFPLCYLVYNACYWLYYLVIV 508          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A0R3SRH4 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7771 PE=3 SV=1)

HSP 1 Score: 456.447 bits (1173), Expect = 8.152e-153
Identity = 234/424 (55.19%), Postives = 303/424 (71.46%), Query Frame = 3
Query:  291 RERIMDKILQNYSLNERPIESNQ--TRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINR------QKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIV 1538
            R+R+++ + + Y  NERP E     T V V +KVLAI SV+V  M+Y  D  LRQ WVD RL WD+  +FK++   LVSP+LKD +W+PDLFFRNGK+GY+H MT PN+L+R+ PNGEVLYSQKITMRFSCQMDL T+PMDTQ C MNIGSYGYTL +LKF+W +  P+EL NN+Q+ EFN PT   T DCT  S+T TG Y+CL A F L+RQLGSYLV+T+IPN LI++VSWL+F+VSV+A PAR+ LGLL+LLG+LTQAS I+GNLPRVSYIKAID+WLI  I+FVIG L+E+A+A T+ +QKK   W+ +V  IV++EL+RW  A  +      Q +  M+  Q   + +L +  +LD  LT          +    +  R  + +   ES+ID YSR+LFP+C+I YN  YW YYL IV
Sbjct:   78 RDRLVNMLFKTYRTNERPTEKLDIPTEVSVNIKVLAIFSVDVRTMDYYIDALLRQTWVDPRLAWDHDEDFKNYTQPLVSPTLKDNIWIPDLFFRNGKDGYLHKMTLPNFLLRVHPNGEVLYSQKITMRFSCQMDLATFPMDTQYCHMNIGSYGYTLSELKFFWREKEPVELQNNLQLSEFNTPTNFTTLDCTAQSSTATGNYTCLIAEFSLKRQLGSYLVTTYIPNILIIMVSWLSFYVSVDAAPARVPLGLLSLLGLLTQASSITGNLPRVSYIKAIDLWLIFSIIFVIGVLVEYAIAITMLRQKKKETWRGDVETIVKEELTRWLAACEQGQMASIQGSGGMRGDQAFIQQQLAYFNDLDAFLTQSVVEEARAKKGPGGKKNRIPVAT---ESEIDAYSRFLFPTCYIMYNIFYWTYYLAIV 498          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra3 (glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-020402-1])

HSP 1 Score: 243.047 bits (619), Expect = 6.105e-74
Identity = 135/388 (34.79%), Postives = 220/388 (56.70%), Query Frame = 3
Query:  390 AINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKK------LYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            +  S+  + M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K  + H +T  N L+R+F NG VLYS ++T+  SC MDL+ +PMD Q+C M + S+GYT++ L F W    P+++ + + +P+F    + +   CT      TG ++C++  F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q K        + KS   + VR+    +     +  T    T+   +  +             Q       + +S  +++  KI  +    KID  SR  FP  F+F+N  YW+ Y I+
Sbjct:   79 SFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQANGPVQVADGLTLPQFILKDESDLRYCTKH--YNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRRRKKSTKEEEVRESCLSFTANAGKDGTMTKPTNNAASTPK------------GQPTPTVPQAGKSTEEMR--KIFID-RAKKIDTVSRAGFPLAFLFFNIFYWVLYKIL 445          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:103026517])

HSP 1 Score: 239.965 bits (611), Expect = 8.040e-73
Identity = 141/424 (33.25%), Postives = 237/424 (55.90%), Query Frame = 3
Query:  294 ERIMDKILQNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQ-KKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEE------SKIDVYSRYLFPSCFIFYNFCYWIYYLIIVS 1541
            +++M K+   Y    RP  +     V   + + +  S+  + M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K    H +T  N L+R+  NG VLYS +IT+  +C MDL+ +PMD Q+C M + S+GYT++ L F W +   +++ + + +P+F    + +   CT    T  G ++C++A F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + +A+Q K+L +++   R +   E      +      + M  + +  ++ +                NN ++  S+  I  +K + E+ +       +ID  SR  FP  F+ +N  YWI Y II S
Sbjct:   42 DKLMGKV-SGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTKHYNT--GKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFQRRRRHLKEDEAGEGRFSF---AAYGMGPACLQAKDGMAI------------KGNNNNAPTSS--IPPEKTVEEMRKLFISRAKRIDTVSRVAFPLVFLIFNIFYWIIYKIIRS 441          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 238.81 bits (608), Expect = 1.603e-72
Identity = 137/384 (35.68%), Postives = 221/384 (57.55%), Query Frame = 3
Query:  390 AINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSL-VSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVA-QQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            +  SV  + M+Y  +++LRQ W D RL +      ++ + SL + PS+ D +W PDLFF N K    H +T  N L+R+  +G VLYS ++T+  SC MDL+ +PMD Q+C M + S+GYT++ L F W    P+++   + +P+F    + E   CT      TG ++C++  F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V+ QQK+  + K   +  +++EL        R+   H     +         ++  ++ +A   A    S     +  R+K +   +  +ID  SR  FP  F+ +N  YWI Y II
Sbjct:   69 SFGSVTETTMDYRVNIFLRQKWNDPRLAYS-----EYPDPSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKDGTVLYSIRLTLILSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLDEGPVQVAEGLTLPQFIMREEKELGYCTKHY--NTGKFTCIEVKFKLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAGVNFVSRQQKEFLRLKRRQKRNLKEEL--------REGRFHFSGYSM-----APCMKDGTVVKSATANAIQQPSALRDAEHNRKKFVDRAK--RIDTISRAAFPLAFLIFNIFYWITYKII 430          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:103026517])

HSP 1 Score: 238.81 bits (608), Expect = 2.604e-72
Identity = 135/391 (34.53%), Postives = 224/391 (57.29%), Query Frame = 3
Query:  390 AINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQ-KKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEE------SKIDVYSRYLFPSCFIFYNFCYWIYYLIIVS 1541
            +  S+  + M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K    H +T  N L+R+  NG VLYS +IT+  +C MDL+ +PMD Q+C M + S+GYT++ L F W +   +++ + + +P+F    + +   CT    T  G ++C++A F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + +A+Q K+L +++   R +   E      +      + M  + +  ++ +                NN ++  S+  I  +K + E+ +       +ID  SR  FP  F+ +N  YWI Y II S
Sbjct:   87 SFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTKHYNT--GKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFQRRRRHLKEDEAGEGRFSF---AAYGMGPACLQAKDGMAI------------KGNNNNAPTSS--IPPEKTVEEMRKLFISRAKRIDTVSRVAFPLVFLIFNIFYWIIYKIIRS 454          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra3 (glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-020402-1])

HSP 1 Score: 238.81 bits (608), Expect = 5.882e-72
Identity = 143/412 (34.71%), Postives = 226/412 (54.85%), Query Frame = 3
Query:  390 AINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDI--------VRQELSRWNLAINRQKTHHM------QTSQILNRNE------LEFCEELDILLTAQQYANNYHS----QESAHQIKRQKILSEIEE------SKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            +  S+  + M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K  + H +T  N L+R+F NG VLYS ++T+  SC MDL+ +PMD Q+C M + S+GYT++ L F W    P+++ + + +P+F    + +   CT      TG ++C++  F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q K        R            +ELS    ++N  ++         Q S+  +R E      L F        T  +  NN  S    Q +    +  K   E+ +       KID  SR  FP  F+F+N  YW+ Y I+
Sbjct:   79 SFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQANGPVQVADGLTLPQFILKDESDLRYCTKH--YNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRRRKKSTKLHDRSFEEELSESLQSVNGLRSADPVYGSMDQMSESNDREEEVRESCLSFTANAGKDGTMTKPTNNAASTPKGQPTPTVPQAGKSTEEMRKIFIDRAKKIDTVSRAGFPLAFLFFNIFYWVLYKIL 484          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 230.72 bits (587), Expect = 1.362e-70
Identity = 132/385 (34.29%), Postives = 212/385 (55.06%), Query Frame = 3
Query:  390 AINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNR------NELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYY 1526
            +  S+  + M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K    H +T  N L+R+F +G VLYS ++T+  SC MDL+ +PMD Q+C M + S+GYT++ L F W Q   +++   + +P+F    + +   CT      TG ++C++  F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q K        R   + +L+   L  N        +  I N       NE    ++   +              +   IK++ +       +ID  SR  FP  F+ +N  YWI Y
Sbjct:   16 SFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKDGNVLYSIRLTLTLSCPMDLKNFPMDVQTCAMQLESFGYTMNDLIFEWKQEGAVQVAEGLTLPQFVLKDEKDLVYCTKHY--NTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKELLRIRRRRQRNQIDLTSLILICNIFTYFINSSVPIFNMFKRVEGNERALTKDSVSVKGVNATNAAPAPAPTQDAIKKKFV---DRAKRIDTISRAAFPLAFLIFNIFYWIIY 391          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008467.1 (pep scaffold:Pmarinus_7.0:GL477211:8305:20106:1 gene:ENSPMAG00000007648.1 transcript:ENSPMAT00000008467.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 225.713 bits (574), Expect = 5.391e-68
Identity = 133/438 (30.37%), Postives = 231/438 (52.74%), Query Frame = 3
Query:  261 CNSCSVAGITRERIMDKIL---QNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLN-EFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVR----DIVRQELSRWNLAINRQKTHHMQ-TSQILNRNELEFCEELD--ILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIV 1538
             +S +   ++   ++DK+L     Y+   RP        V   + + +  S+  +  +Y   +YLRQ W D RL + +      H + S +       +W PDLFF N K  + H +T  N ++R+  NG V Y+ ++T+  SC MDL  +PMDTQ C M + S+GYT   + F+W+   P+ L   + +P+F    K+ T  CT   T  TG ++C+ A F L R++G YL+  ++P+ LIVI+SW++FW+++EA PAR+ LG+ T+L + TQ++G   +LP+VSYIKA+D+W+  C++FV  ALLE+A  +  ++Q + +  K        D++  +   W   +       +  T  I   N L    +    +++  +   +    QE+  +++++ +        ID  SR  FP  F+ +N  YW  + +++
Sbjct:   32 ADSTTGPNLSPSEVLDKLLGPSSGYNHRVRPNFGGPAVNVSCGVFIRSFGSIQEATSDYRMTVYLRQRWTDPRLAYSHYPVPLLHLDQSNIK-----HIWKPDLFFDNEKSAHFHEITTDNKMLRIANNGVVDYAMRLTLTLSCPMDLHNFPMDTQMCSMYLESFGYTTADIVFHWNGPTPVSLFEGLTLPQFVLSNKISTGSCTK--TYSTGSFTCIFAKFTLHREMGFYLIQLYVPSILIVILSWVSFWINMEAAPARVALGITTVLTLTTQSTGARASLPKVSYIKAMDIWMATCLLFVFAALLEYAAVNVTSRQSQGFMKKGRGNQKPIDLLVHKKMFWKFLVAENDNDLLYFTITIFTLNGLLPVSDSKKPVIVCIKPLLS---LQETKEKMRKKYVAC---AQTIDNISRLFFPISFLIFNVVYWFAFKVML 456          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: glra4a (glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GENE-010410-3])

HSP 1 Score: 209.534 bits (532), Expect = 6.220e-62
Identity = 137/425 (32.24%), Postives = 212/425 (49.88%), Query Frame = 3
Query:  303 MDKILQN--YSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFK--HFNSSLV--SPSLKDRLWLPDLFFRNGKEGYVH---IMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSE-------IEESKIDVYSRYLFPSCFIFYNFCYWIYY 1526
            MD ++++  Y    RP ++     V   + V     V  + M+YS +++LRQ W D R+    LN  K   +N+  +    S  D +W PDLFF N K        ++T   Y+             ++++  +C M L+ YPMD Q C + + SYGYT + L F W+ T P+  G  V  P+F    +    +CT   T   G +SC+KA F L R +G YL+  +IP+ L+VI+SWL+FW++VEA PAR+ LG+ T+L + TQ +  +  LP+VSYIKAIDVW+ AC VFV  ALLEFA  +   ++  +     +     + E     L I  ++  H   S +  R       E D     +    + +S+   +   R  +  E       +   +ID  SR +FP+ F+ +N  YW+ Y
Sbjct:   47 MDNVIRDTGYDSRMRPNVDGPPVVVNCSILVKGFGPVEEATMDYSINIFLRQTWNDPRI----LNVLKSIEYNTDFLDLGNSFVDSVWKPDLFFENEKSAAFQMYQLVTGFKYMYTFAMWITCFLCFRLSLVLACPMSLEVYPMDAQYCSIYLESYGYTTNDLIFQWNDTEPVSFGAGVSTPKFTLSNETFLGECTKEYTY--GTFSCVKATFFLDRDMGYYLIQVYIPSCLLVIISWLSFWLNVEAAPARVGLGITTILTVTTQMTSANAALPKVSYIKAIDVWMGACQVFVFSALLEFAAVNMATRRHGISPSHHDGDHGTKGE-----LPIEWKRHRHANVSSV--RRPQRHRPERDCRSQGKPGVFHTNSRRDENNATRVHVSDEEWRYQSLLHARRIDYISRVIFPTVFMIFNIFYWVIY 458          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002305.1 (pep scaffold:Pmarinus_7.0:GL478144:76380:93696:1 gene:ENSPMAG00000002075.1 transcript:ENSPMAT00000002305.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 201.06 bits (510), Expect = 6.580e-59
Identity = 125/395 (31.65%), Postives = 205/395 (51.90%), Query Frame = 3
Query:  384 VLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLV--SPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNL---------AINRQKT---HHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYY 1526
            V +   +  + M+Y   +YL+Q W+D R+  +++    H+    +  + +  D +W PDLFF N K    H +     ++    N +  +S  +++  +C M+L+ YP+DTQ C +N+ S+GYT   L F W +  P+ +  N+  P+F      E  DC  S    TG +SC+ A F L R +G YL+  + P+ L+VI+SWL+FW+SVE+ PAR++LG+ T+L + TQ +  +  LP++SYIKA+DVW+ AC VFV  ALLE  V S   Q   +   K+E RD  ++  + W+L           NR ++      +T+ ++N+    F  +                   +  + R++ L  +   +ID  SR LFP  F+ +   YW  Y
Sbjct:   65 VKSFGPIEENTMDYMMLIYLQQSWIDSRI--ESIYSAGHYQKDFLDLANNYIDTVWTPDLFFENEKSAAFHEIHCRFSIIVHATNNKTCFSLVLSLTLACPMNLEYYPLDTQECRINLESFGYTTQDLIFQWDENEPLVVATNLYTPKFKLSNHTELGDC--SKEYLTGTHSCINATFYLHRDMGYYLIQVYFPSCLLVIISWLSFWLSVESTPARVSLGITTILTVTTQMTSANAALPKMSYIKAMDVWMAACQVFVFAALLESTVVSVTKQH--VVSGKAETRD--QKNNNVWDLFFNPLYDVVGYNRSRSLGRAAKRTTSVVNQPHGWFISQ----------------PTDSDGMARERSL--VRSRQIDYISRVLFPLAFVIFLTIYWFSY 433          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: glra1 (glycine receptor, alpha 1 [Source:NCBI gene;Acc:30676])

HSP 1 Score: 196.052 bits (497), Expect = 6.641e-59
Identity = 99/278 (35.61%), Postives = 168/278 (60.43%), Query Frame = 3
Query:  285 ITRERIMDKILQNYSLNERPIESN----QTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNE-FKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVS 1103
            I     +DK+L   S  +  I  N       V   + + +  S+  + M+Y   ++LRQ W+D RL + +  E +   + S +       +W PDLFF N K  Y H +T  N ++R+F NG VL++ ++T+  SC MDL+ +PMDTQ C M + S+GYT+  L F+W +  P+ +   + +P+F   +K++T+ C    ++ TG +SC+ A F+L R++G YL+  ++P+ LIVI+SW++FW+++EA PAR+ LG+ T+L + TQ++G   +LP+V+
Sbjct:    1 IAPTEFLDKLLGPTSGYDHRIRPNFGGPTVNVNCSVYIKSFGSIEETTMDYQVTIFLRQKWIDPRLTYSHYPEPYLDLDQSNIQ-----YIWRPDLFFDNEKSAYFHEVTTDNKMLRIFKNGLVLFTVRLTLTLSCPMDLRNFPMDTQMCYMFLESFGYTMADLSFHWDEEEPVIISKELVLPQFVLSSKIDTDSCDKLYSSGTGHFSCISARFVLHREMGFYLIQLYVPSALIVIISWVSFWINMEAAPARVALGITTVLTMTTQSTGARASLPKVT 273          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO37555 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG6])

HSP 1 Score: 194.897 bits (494), Expect = 1.662e-56
Identity = 124/426 (29.11%), Postives = 225/426 (52.82%), Query Frame = 3
Query:  300 IMDKILQNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSL-VSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCE------------ELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            ++D ++Q Y    RP    +   V V   VL+I+++NV +M+Y  D +LRQLW D RL+         F+ +L +S ++ D++W+PD +F N K    H +T  N ++ + P+G V Y+ ++T++ SC M+L+ +P D Q+C ++I SYGY+ D +++ W   +   +  N +I +       + N   + +    G +S L A F  RR+ G +++  + P  LIVI+SW++F +  E+  ARI LG+ ++L I T  + ++ ++P+VSY+KA+D +LI C +FV   LLE+     +   +++ ++K ++ +   + +       +R   H M  S     +   F E              D++L  +++ ++Y          R K  + I+   ID ++R LFP  FI +N  Y+I +  I
Sbjct:    9 LLDNLIQGYDPRLRPDFGGDPVTVTVGFWVLSIDAINVIDMDYRMDFFLRQLWRDPRLK-------HRFDDTLALSNTMLDKIWVPDTYFVNSKMSKFHSVTTINKMLSISPDGLVHYNSRVTVKASCAMNLRMFPKDVQNCNIDIESYGYSADNVQYQWENRSDNGIAVNKKIRDMPQYNLSDINVSRHFTMYVAGNWSGLTATFRFRRRSGYFIIHIYAPCALIVILSWISFCIPPESTAARIALGITSVLTITTILNMLNNSMPKVSYVKAVDWYLIGCFLFVFAVLLEYTFVLYI-DNEEVTEYKKDLVNYSSESVK------HRSPAHAMNGSIPNGYSPAVFSEHGKKCGHNCHHAHHDVVLKREKHKSSYEQLGGCR--PRLKFPAVIDTECIDEFARVLFPFIFIAFNVIYFIVFFFI 418          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO35410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK4])

HSP 1 Score: 188.348 bits (477), Expect = 3.316e-55
Identity = 100/300 (33.33%), Postives = 182/300 (60.67%), Query Frame = 3
Query:  300 IMDKILQNYSLNERPIESNQTRVM-VFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQ----TNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVAS 1184
            ++  +L+ Y    RP    +  V+ V M V  I ++   NM+++ D+YLRQ W D RL+++            +S  +  ++W+P  +F   K+ Y H +T  NYL+++ P+G + YS ++T+  SC++DL+ +P DTQSC +++ SYGY    + + W++    T+ + + +++++P+F     +  +     +    G +S L A F ++R++G +L+ T+IP+T+IVI+SW++FW+  E  PAR+ LG+ T+L + T  S    NLP+VSY+KAID +L+ C++FV G++LE+   +
Sbjct:   25 VLKNLLEGYDRRIRPGSKGEPVVVYVDMYVSNIWAMQEMNMDFTIDIYLRQYWRDERLQFETQTPGAMLT---LSSDINKQIWVPSTYFLATKKAYFHDVTTDNYLLQVKPDGSLFYSIRLTITTSCRLDLRDFPHDTQSCSLSLESYGYQSTDVLYVWNERLDNTSAIYIHDDLELPQFEV---LGVSRSAKMNKYNIGNHSSLVANFRMKRRIGYFLIDTYIPSTIIVIISWISFWIDPETAPARVALGITTVLTMTTLISSARANLPKVSYVKAIDWYLLLCLIFVFGSILEYTCVT 318          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO30047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1W8])

HSP 1 Score: 182.956 bits (463), Expect = 2.103e-53
Identity = 110/303 (36.30%), Postives = 183/303 (60.40%), Query Frame = 3
Query:  297 RIMDKIL--QNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELG----NNVQIPEFN-APTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVA 1181
            RI+D IL  + Y    RP   +    V V   VL+I+++NV +M+Y+ D++LRQ WVD RL  D LN      +  +S ++ D++WLPD +F N K+G  H +TK N ++ + P+G+V Y+ ++T+R SC M+L+ +PMDTQ C + + SYGY+ D + F W   +   LG    +   +P++  AP +  +  C        G +S +KALF   R    +++  + P  LIV+VSW++F +  E  PARITLG+ ++L ++T  + ++ ++P+V+Y+K ID +LI C +FV   L+E+++ 
Sbjct:    3 RILDSILTAEKYDKRLRPNYGAGPVIVTVGFWVLSIDTINVVDMDYTLDIFLRQSWVDERLSHD-LN-----TTMFLSNTVMDKIWLPDSYFVNAKQGSFHKVTKDNMMVMIQPDGQVQYNARVTIRASCPMNLRKFPMDTQHCPLTLESYGYSSDHIVFKWEIEDGDGLGFVPESLKMLPQYKLAPNEPRSELC----FVIPGNWSGIKALFTFERMYSYFVIHVYGPCALIVVVSWVSFLLPKEQAPARITLGVTSVLTVVTILNMLNNSMPKVNYVKTIDKYLIGCFLFVFATLVEYSLV 295          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO34692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNK5])

HSP 1 Score: 177.178 bits (448), Expect = 1.560e-51
Identity = 97/263 (36.88%), Postives = 163/263 (61.98%), Query Frame = 3
Query:  423 YSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLK--DRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNP----MELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVA 1193
            ++ D+YLRQ W D RL +D +      N+ +++ + +  D +W+P  +F N K+ Y H +T  NYL+ + PNG+V YS ++T+  +C++ LQ +P D Q CEM + SYGY    + + W+  N     + +  ++++P+F   T V+  + TN      G +S L A F   R+LG Y++ T+IP+ L V +SW +FW+S ++ PAR+ LG+ T+L ++T ++     LP+VSY KAID +L+ C+V+V GAL+E+A+ +  A
Sbjct:    2 FTIDMYLRQYWRDPRLIFDPVP----VNTDVLTLNRQTIDEIWIPSTYFFNAKKAYFHDVTTENYLLMIKPNGDVFYSVRLTITMACKLTLQMFPHDVQVCEMMLESYGYQATDVYYRWNSRNSTGDVVYISEDLEMPQFKI-TNVKLEERTN--IYNIGPHSALIAKFTFHRRLGYYMIQTYIPSMLTVTISWFSFWISPDSPPARVGLGITTVLTMITISNSARAPLPKVSYTKAIDWFLLMCLVYVFGALMEYAIVNFYA 257          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO40478 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S763])

HSP 1 Score: 175.252 bits (443), Expect = 7.474e-51
Identity = 97/273 (35.53%), Postives = 166/273 (60.81%), Query Frame = 3
Query:  378 MKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSL-VSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQ---TNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVAS 1184
            M VL I  ++ ++ME+    + RQ W D RL +D    +  +N  L ++  + D +W+PD++F N K G  H +TK N ++R++P+G V +S +++M  SC M L +YPMD Q+C+++  S+ Y   +L F W++      +++ + +QIP+F       T++  N +   TG YS L  LF   R +G +L+ T+IP  LIV++SW+ FW++  + PARI LG+ T+L + T  +    +LP+VSY+K+I+ +LI C ++V  +L+E+   S
Sbjct:   12 MFVLDIGDISEADMEFRVMFFYRQYWQDTRLAYD----YTGYNKRLALNARMVDYMWIPDIYFVNEKSGIKHDLTKQNEVVRVWPDGRVFHSIRLSMTASCPMKLHSYPMDKQTCKLSFESFSYPSTELIFKWNKNRGNKEVQVSDELQIPQFILTEYKTTSEFANFT---TGSYSRLTVLFRFERSIGFFLIQTYIPAYLIVMLSWIAFWINHTSTPARIGLGITTVLTMTTLTNSARASLPKVSYVKSIEWFLIMCFLYVFMSLVEYGCVS 277          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: ENSORLT00000025211.2 (glycine receptor subunit alpha-3 [Source:NCBI gene;Acc:101174559])

HSP 1 Score: 245.743 bits (626), Expect = 5.186e-75
Identity = 140/424 (33.02%), Postives = 237/424 (55.90%), Query Frame = 3
Query:  279 AGITRERIMDKIL---QNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQ-KKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            A ++    +DK++     Y    RP  +     V   + + +  S+  + M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K  + H +T  N L+R+F NG VLYS ++T+  SC MDL+ +PMD Q+C M + S+GYT++ L F W +  P+++   + +P+F    + +   CT      TG ++C++  F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q K+L +++   +   ++E+    L      T  M ++  ++++         +   A    N   +       +  + L      KID  SR  FP  F+F+N  YW+ Y I+
Sbjct:   31 APMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYAEYPD----DSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFQWQENGPVQVAEGLTLPQFILKDESDLRYCTKH--YNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRH-KSKTKEEVGESKLT----STAVMTSTPSISKDSKASVNNA-VAPAANTTQNAPAAGGGGRSTEEMRKLFIDRAKKIDTVSRAGFPLAFLFFNIFYWVLYKIL 442          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra4a (glycine receptor subunit alpha-4-like [Source:NCBI gene;Acc:101156095])

HSP 1 Score: 241.506 bits (615), Expect = 2.720e-73
Identity = 147/450 (32.67%), Postives = 240/450 (53.33%), Query Frame = 3
Query:  231 FIFLLAIHVGCNSC-------SVAG--ITRERIMDKIL---QNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLY--QWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            F F     +  +SC       S AG  ++    +DK++     Y    RP  +     V   + + +  S+  + M+Y  +++LRQ W D RL +    +    NS  + PS+ D +W PDLFF N K    H +T  N L+R+F +G VLYS ++T+  SC MDL+ +PMD Q+C M + S+GYT++ L F W   NP+++ +++ +P+F    + +   CT      TG ++C++  F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q K +    K + +  + +EL R +     +        Q  +   LE             Y     S+    + KR           ID  SR +FP  F+ +N  YW+ Y ++
Sbjct:   14 FCFFQGSFIRLSSCKEEIKPASRAGPQLSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSITETTMDYRLNVFLRQNWNDPRLAYSEYPD----NSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFQDGSVLYSIRLTLILSCPMDLKNFPMDIQTCTMQLESFGYTMNDLIFEWLSDNPVQVADDLTLPQFVLKEEKDLGYCTKH--YNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFIRLRKKQRQQRIEEELVRESRGFYFRGYGLGHCLQTKDGAPLEGATVFSPPPPMTMYDGEVFSKRFVDRAKR-----------IDTISRAVFPLSFLIFNIFYWLTYKVL 446          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:101173557])

HSP 1 Score: 236.884 bits (603), Expect = 7.934e-72
Identity = 142/421 (33.73%), Postives = 233/421 (55.34%), Query Frame = 3
Query:  294 ERIMDKILQNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQ-KKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESA---HQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIVS 1541
            +++M K+   Y    RP  +     V   + + +  S+  + M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K    H +T  N L+R+  NG VLYS +IT+  +C MDL+ +PMD Q+C M + S+GYT++ L F W +   +++ + + +P+F    + +   CT      TG ++C++A F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + +A+Q K+L +++   R +   E             + M  + +  ++ +                NN ++  SA     I+  K L      +ID  SR  FP  F+ +N  YWI Y II S
Sbjct:   32 DKLMGKV-SGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLILACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFRRRRRHMKEDETGDGRFGF---PGYGMGPACLQAKDGMAI------------KGNNNNAPTSAAPEKSIEEMKKLFIGRAKRIDTVSRVAFPLVFLIFNIFYWITYKIIRS 430          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra2 (glycine receptor alpha 2 [Source:NCBI gene;Acc:101169154])

HSP 1 Score: 236.113 bits (601), Expect = 2.858e-71
Identity = 135/395 (34.18%), Postives = 228/395 (57.72%), Query Frame = 3
Query:  390 AINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSL-VSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLY----------QWKSEVRDIVRQELSRWNLA--INRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLII 1535
            +  S+  + M+Y  +++LRQ W D RL +      K+ +SSL + PS+ D +W PDLFF N K    H +T  N L+R+F +G VLYS ++T+  SC MDL+ +PMD Q+C M + S+GYT++ L F W +   +++   + +P+F    + E   CT      TG ++C++  F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + V++Q+K +          Q + ++RD  R   + +N++  ++ + +  ++ +      +    +++D +                    R+K +   +  +ID  SR  FP  F+ +N  YWI Y II
Sbjct:   82 SFGSIAETTMDYRVNIFLRQKWNDPRLAYS-----KYPDSSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRIFKDGTVLYSIRLTLILSCPMDLKNFPMDVQTCTMQLESFGYTMNDLVFEWLEYGAVQVSEGLTLPQFIMKEEKELGYCTKH--YNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAGVNFVSRQQKEFLRLRRRQRRNQKEEDMRD-GRFNYASYNISQCLSTKNSSAVKNTTPAPNPQPPTPKDIDAM--------------------RKKFVDRAK--RIDTISRAAFPLAFLIFNVFYWITYKII 446          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:101173557])

HSP 1 Score: 235.343 bits (599), Expect = 3.764e-71
Identity = 136/388 (35.05%), Postives = 220/388 (56.70%), Query Frame = 3
Query:  390 AINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQ-KKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESA---HQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIVS 1541
            +  S+  + M+Y  +++LRQ W D RL +    +    +S  + PS+ D +W PDLFF N K    H +T  N L+R+  NG VLYS +IT+  +C MDL+ +PMD Q+C M + S+GYT++ L F W +   +++ + + +P+F    + +   CT      TG ++C++A F L RQ+G YL+  +IP+ LIVI+SW++FW++++A PAR+ LG+ T+L + TQ+SG   +LP+VSY+KAID+W+  C++FV  ALLE+A  + +A+Q K+L +++   R +   E             + M  + +  ++ +                NN ++  SA     I+  K L      +ID  SR  FP  F+ +N  YWI Y II S
Sbjct:   77 SFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLILACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTKH--YNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFRRRRRHMKEDETGDGRFGF---PGYGMGPACLQAKDGMAI------------KGNNNNAPTSAAPEKSIEEMKKLFIGRAKRIDTVSRVAFPLVFLIFNIFYWITYKIIRS 443          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000032691.1 (SMESG000032691.1)

HSP 1 Score: 899.042 bits (2322), Expect = 0.000e+0
Identity = 447/448 (99.78%), Postives = 447/448 (99.78%), Query Frame = 3
Query:  201 MTIKQQQSNIFIFLLAIHVGCNSCSVAGITRERIMDKILQNYSLNERPIESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIVSN 1544
            MTIKQQQSNIFIFLLAIHVGCNSCSVAGITRERIMDKILQNYSLNERPIESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVD RLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARITLGLLTLLGILTQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIVSN
Sbjct:    1 MTIKQQQSNIFIFLLAIHVGCNSCSVAGITRERIMDKILQNYSLNERPIESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDARLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARITLGLLTLLGILTQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIVSN 448          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000041885.1 (SMESG000041885.1)

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 261/415 (62.89%), Postives = 327/415 (78.80%), Query Frame = 3
Query:  294 ERIMDKILQNYSLNERPIESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIV 1538
            ERI+DK  + Y  +ERP E  QT V+V+MKVLAINSV+V+ MEYSTD+YLRQ W D RL W+NL EF+ FN+++VSPSLK  LWLPDLFFRNGKEGYVH MT PNYLMRL PNG +LYSQKITMRFSC+M+LQT+PMD+Q C M+IGSYGYTLD+LKF W + +P+ +   +QI EFN+P +V T DCTN S+T TG Y+CLKA F+L+RQLGSYLVSTF+P+ LIV+VSWLNFW++V++VPAR+TLGL+TLLG+LTQA+GIS  LPRVSYIKAIDVW+IACI+FVIGALLE+ VAS +A++KK   W+ +VR+IVR EL+RW  A  RQ+  H+Q    L+RN LEFC EL+ LL              AH+ K+    +  E+S ID YSR+LFP+CF+ YN  YW+YYL++V
Sbjct:   37 ERIVDK--KRYKKDERPSEIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARVTLGLVTLLGMLTQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHAL--------DAHKGKKTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYLVLV 441          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000041886.1 (SMESG000041886.1)

HSP 1 Score: 498.049 bits (1281), Expect = 1.488e-173
Identity = 250/444 (56.31%), Postives = 330/444 (74.32%), Query Frame = 3
Query:  222 SNIFIFLLAIHVGCNSCSVAGITRERIMDKILQNYSLNERPIESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWN---LAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILS-EIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIVS 1541
             N+  ++L + +           +E+I + I  NY+  + P+ SNQTRVMV+MK+L+I+SVNVSNM+YSTDLYLRQ WVD RLRWD+L +  HFNS++V+P+LKD++WLPDLFFRNGK GYVH MT+ NYLMRL P GE+LYSQKITM FSCQMDL+T+PMDTQ CEM+IGSYGYT+D+LKF+W  ++P+ +G  VQIPEFN+PTKV+T DCT++S T TG Y+CLK +F L+RQLGSYLVSTFIPN+LIV+VSWLNFW+ V+A PAR+TLGLLTLLGILTQASGI+  LPRVSYIKAIDVW+IACI+FVIGAL+E+ +AST  Q +K  QW  +V  +V +E+ R +   L +N               N+  F  +   ++  +   N    ++    +K+ +  S EI +S +D YSR++FP+CFI YN  +W YYL++V+
Sbjct:    8 GNLGTYILVLMLFVAEIQTKNNDQEKIFEIIFTNYTNTDLPLHSNQTRVMVYMKLLSIDSVNVSNMDYSTDLYLRQQWVDPRLRWDDLQDLNHFNSNIVTPALKDKVWLPDLFFRNGKFGYVHKMTRSNYLMRLNPKGEILYSQKITMGFSCQMDLKTFPMDTQHCEMDIGSYGYTIDELKFFWRASDPINIGKTVQIPEFNSPTKVDTLDCTSASKTTTGSYTCLKVVFTLKRQLGSYLVSTFIPNSLIVVVSWLNFWIRVDAAPARVTLGLLTLLGILTQASGITKTLPRVSYIKAIDVWMIACIMFVIGALIEYILASTAMQNRKTKQWNQDVNLVVHREIERMDRLFLKVNLSVV-----------NDETFTNDFRSMVKEK---NVLKYRDKVRFMKKNRPFSVEITDSDVDRYSRFIFPACFILYNVFFWYYYLVLVN 437          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000037124.1 (SMESG000037124.1)

HSP 1 Score: 485.723 bits (1249), Expect = 1.973e-168
Identity = 256/436 (58.72%), Postives = 332/436 (76.15%), Query Frame = 3
Query:  291 RERIMDKILQNYSLNERPIESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWN-LAINRQKT------HHMQTSQILNRNEL-----------EFCEELDILLTAQ--QYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIV 1538
            RE+I + I + Y  NERP E+ QT V V+MKVLAINSV+V  MEYSTD+YLRQ W+D RL WD++ +F+ +N++LVSP  K+++WLPDLFFRNGK+GYVH MT PNYL+RL PNGEVLYSQKITM+FSCQMDLQT+PMDTQ C M+IGSYGYTLDQLKF W    PM L   +QIPEFN PT V+T DC+  S+T TG Y+C+KA F L+RQLGSYL ST+IPN LIV+VSWLNFWVS++AVPARITLGLLTLLGILTQA+G+S NLPRVSYIKAIDVW+IACI+FVIGAL+EFA+AS ++++ K   W+ +V++IV QEL +W+ +A+ +Q++      H M T +  +   L           EF  +L++ LTAQ  + + N   ++S  + +  +   +I +S+ID YS++LFP+ F+ YN  YW+YYLI+V
Sbjct:   14 REQIQNHIFKGYKSNERPSENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARITLGLLTLLGILTQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQI-DSEIDGYSQFLFPAFFMLYNCFYWLYYLILV 448          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000077704.1 (SMESG000077704.1)

HSP 1 Score: 481.1 bits (1237), Expect = 7.390e-167
Identity = 253/441 (57.37%), Postives = 324/441 (73.47%), Query Frame = 3
Query:  234 IFLLA-IHVGCN----SCSVAGITRERIMDKILQNYSLNERPIESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARXXXXXXXXXXXXXQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIVS 1541
            IFLLA I   C+    S S     R  I  +I   Y   +RP E  QT V V+MK+LAINSV+V+ MEYSTD+YLRQ WVD RL W+NL++FK +N+++VSPSLK  LWLPDLFFRNGKEGYVH MT PNYLMRL PNG +LYSQKITMRFSCQMDL+T+PMDTQ CEM+IGSYGYTLD+L+F W   + + +   +QI EFN+P K  T DCT  S+T TG YSCLKA F+L+RQLGSY+VSTF+P+ LIV+VSWLNFW+ V++VPAR+ LGL+TLLG+LTQA GIS  LPRVSYIKAID+W+I CI+FVI ALLE+AVA++V  +      ++EV+ IV++EL  W  A +R +  HMQ    L+R+ L+FC +L+ LL  +  A + H        K+   +   E S +DVYSR+LFP+ F+FYN  YW+Y+L++V+
Sbjct:    8 IFLLASIVFQCSQSLGSGSEKADQRSLIRAEIFSKYLKEDRPKEEEQTEVTVYMKILAINSVSVTQMEYSTDVYLRQEWVDSRLAWNNLDKFKSYNANIVSPSLKKVLWLPDLFFRNGKEGYVHKMTLPNYLMRLSPNGLILYSQKITMRFSCQMDLKTFPMDTQICEMDIGSYGYTLDELRFNWRVNDSISIATGMQISEFNSPGKFTTRDCTKLSSTSTGQYSCLKAEFVLQRQLGSYIVSTFVPSILIVMVSWLNFWIHVDSVPARVMLGLVTLLGMLTQAIGISSTLPRVSYIKAIDIWVIWCIIFVICALLEYAVANSVVARNYSNNMENEVKLIVQRELMNWCTAFDRLQISHMQVHNSLDRDRLQFCHDLENLLIEK--AIDSH--------KKVIKVRPPENSIVDVYSRFLFPALFLFYNCFYWVYFLVLVN 438          
The following BLAST results are available for this feature:
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLRB2.594e-7331.83glycine receptor beta [Source:HGNC Symbol;Acc:HGNC... [more]
GLRB2.594e-7331.83glycine receptor beta [Source:HGNC Symbol;Acc:HGNC... [more]
GLRA21.139e-7235.22glycine receptor alpha 2 [Source:HGNC Symbol;Acc:H... [more]
GLRA22.147e-7234.96glycine receptor alpha 2 [Source:HGNC Symbol;Acc:H... [more]
GLRA22.321e-7235.53glycine receptor alpha 2 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glc-25.388e-7434.25Glutamate-gated chloride channel subunit beta [So... [more]
glc-11.001e-7135.71Glutamate-gated chloride channel alpha [Source:Un... [more]
glc-11.001e-7135.71Glutamate-gated chloride channel alpha [Source:Un... [more]
glc-33.378e-7134.37Glutamate-gated ChLoride channel; Glutamate-gated ... [more]
avr-154.240e-6934.93pep chromosome:WBcel235:V:13498786:13502743:-1 gen... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GluClalpha2.500e-7535.42gene:FBgn0024963 transcript:FBtr0343789[more]
GluClalpha8.974e-7535.38gene:FBgn0024963 transcript:FBtr0335416[more]
GluClalpha1.092e-7435.14gene:FBgn0024963 transcript:FBtr0335420[more]
GluClalpha2.342e-7435.57gene:FBgn0024963 transcript:FBtr0335417[more]
GluClalpha2.701e-7435.42gene:FBgn0024963 transcript:FBtr0335418[more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glra34.162e-7533.18glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra4b4.361e-7432.37glycine receptor, alpha 4b [Source:ZFIN;Acc:ZDB-GE... [more]
glra4b2.868e-7335.51glycine receptor, alpha 4b [Source:ZFIN;Acc:ZDB-GE... [more]
glra23.590e-7335.71glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra12.150e-7233.57glycine receptor, alpha 1 [Source:NCBI gene;Acc:30... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tal12.045e-7635.99T-cell acute lymphocytic leukemia 1 [Source:Xenbas... [more]
tal13.366e-7635.73T-cell acute lymphocytic leukemia 1 [Source:Xenbas... [more]
tal13.446e-7635.73T-cell acute lymphocytic leukemia 1 [Source:Xenbas... [more]
glrb3.898e-7632.59glycine receptor beta [Source:NCBI gene;Acc:779708... [more]
glrb4.693e-7632.59glycine receptor beta [Source:NCBI gene;Acc:779708... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Glra27.658e-7332.69glycine receptor, alpha 2 subunit [Source:MGI Symb... [more]
Glrb1.899e-7131.67glycine receptor, beta subunit [Source:MGI Symbol;... [more]
Glra33.087e-7032.95glycine receptor, alpha 3 subunit [Source:MGI Symb... [more]
Glra11.918e-6935.37glycine receptor, alpha 1 subunit [Source:MGI Symb... [more]
Glra12.143e-6934.81glycine receptor, alpha 1 subunit [Source:MGI Symb... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q17328|GLUCB_CAEEL6.854e-7334.25Glutamate-gated chloride channel subunit beta OS=C... [more]
sp|P91730|GLUCB_HAECO7.449e-7333.41Glutamate-gated chloride channel subunit beta OS=H... [more]
sp|P48167|GLRB_HUMAN1.246e-7231.83Glycine receptor subunit beta OS=Homo sapiens OX=9... [more]
sp|Q94900|GLUCL_DROME1.415e-7235.33Glutamate-gated chloride channel OS=Drosophila mel... [more]
sp|Q9GJS9|GLRB_BOVIN5.218e-7231.69Glycine receptor subunit beta OS=Bos taurus OX=991... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183SPC01.674e-15355.50Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A3S5FGS12.972e-15355.50Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A0R3UFU94.617e-15352.21Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3TPG47.853e-15353.54Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A0R3SRH48.152e-15355.19Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glra36.105e-7434.79glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra18.040e-7333.25glycine receptor alpha 1 [Source:NCBI gene;Acc:103... [more]
glra21.603e-7235.68glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra12.604e-7234.53glycine receptor alpha 1 [Source:NCBI gene;Acc:103... [more]
glra35.882e-7234.71glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glra21.362e-7034.29glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000008467.15.391e-6830.37pep scaffold:Pmarinus_7.0:GL477211:8305:20106:1 ge... [more]
glra4a6.220e-6232.24glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000002305.16.580e-5931.65pep scaffold:Pmarinus_7.0:GL478144:76380:93696:1 g... [more]
glra16.641e-5935.61glycine receptor, alpha 1 [Source:NCBI gene;Acc:30... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO375551.662e-5629.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354103.316e-5533.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO300472.103e-5336.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346921.560e-5136.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404787.474e-5135.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000025211.25.186e-7533.02glycine receptor subunit alpha-3 [Source:NCBI gene... [more]
glra4a2.720e-7332.67glycine receptor subunit alpha-4-like [Source:NCBI... [more]
glra17.934e-7233.73glycine receptor alpha 1 [Source:NCBI gene;Acc:101... [more]
glra22.858e-7134.18glycine receptor alpha 2 [Source:NCBI gene;Acc:101... [more]
glra13.764e-7135.05glycine receptor alpha 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032691.10.000e+099.78SMESG000032691.1[more]
SMESG000041885.10.000e+062.89SMESG000041885.1[more]
SMESG000041886.11.488e-17356.31SMESG000041886.1[more]
SMESG000037124.11.973e-16858.72SMESG000037124.1[more]
SMESG000077704.17.390e-16757.37SMESG000077704.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004877 ID=SMED30004877|Name=Glycine receptor subunit alpha-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1654bp
GGAAGATTAATGCGAAACATATCCATTTATAATCAAATCGTGATTGCGTC
ATTAGAGAGAATGATTGAATGAATAAATTCTTCGACAGATATGGGAGAAT
ATTACTGGCGTTTCAACAAAACACCTTGAGTATTTAAATATTCACAAAAA
AAAATTCATTTTTTATGTCGTTTTCATCCCAGTCTCATGTCTCGCTATAG
ATGACAATAAAGCAACAACAGTCAAATATATTTATCTTTTTGCTGGCAAT
CCATGTCGGATGCAATAGTTGTTCTGTTGCTGGAATTACTCGAGAGAGAA
TTATGGATAAAATCCTTCAAAATTACAGTTTGAATGAAAGACCCATTGAA
AGTAATCAAACCAGAGTAATGGTCTTTATGAAGGTTTTAGCTATCAATTC
TGTGAACGTTAGTAATATGGAATATTCAACAGATCTTTATCTTCGTCAAC
TTTGGGTTGACGTTCGCCTTCGATGGGACAATTTGAATGAATTTAAACAT
TTTAATTCAAGCTTAGTGTCTCCGTCTTTAAAAGACCGTCTATGGCTTCC
AGATTTGTTTTTTAGAAATGGAAAAGAAGGCTATGTACATATAATGACCA
AACCCAATTATTTGATGAGACTTTTTCCAAATGGAGAAGTTTTGTATAGT
CAAAAAATAACGATGCGATTTTCTTGCCAAATGGATTTACAGACTTATCC
TATGGACACACAAAGTTGTGAAATGAATATAGGAAGCTACGGTTATACAT
TAGACCAATTAAAGTTCTATTGGAGTCAAACAAATCCAATGGAATTAGGA
AACAATGTCCAAATCCCTGAATTTAATGCACCAACTAAAGTAGAAACAAA
CGATTGCACAAATAGCTCTACAACCGAAACCGGGTTTTATTCTTGCTTGA
AAGCATTGTTCATACTTAGAAGACAATTAGGTTCGTATTTAGTAAGCACA
TTCATTCCAAATACATTGATAGTCATTGTATCTTGGCTCAATTTCTGGGT
GAGTGTTGAAGCAGTTCCTGCTCGTATTACATTAGGTTTATTAACTCTTC
TCGGAATTTTAACACAGGCTTCAGGGATCTCAGGAAATCTACCAAGAGTC
AGCTATATAAAAGCGATTGATGTCTGGTTGATTGCTTGTATAGTTTTTGT
TATTGGTGCTCTATTAGAATTCGCTGTCGCGAGCACAGTAGCTCAACAAA
AGAAACTTTATCAATGGAAGTCAGAAGTTCGAGATATCGTCCGCCAAGAA
TTATCAAGATGGAATTTAGCAATTAATCGTCAAAAGACCCATCACATGCA
AACTTCACAGATCCTTAATCGAAACGAATTAGAATTTTGCGAGGAGCTTG
ATATCCTATTGACCGCTCAACAGTATGCTAACAACTACCACAGCCAGGAA
TCTGCACATCAAATAAAACGACAAAAAATTCTTTCAGAAATTGAAGAATC
AAAAATAGATGTTTACAGTAGATATTTATTCCCTTCTTGCTTCATTTTCT
ATAATTTTTGTTATTGGATCTATTACTTAATAATTGTCAGCAATTAGGTA
ACCGACTAGAATTATTGTGAGTTCTGCATGACCACTTCCATAAGCACTAT
TTTTTGGATGAAATTGATTACATAACATGTAAGTAGCAACATAAGTAGCT
AGAT
back to top

protein sequence of SMED30004877-orf-1

>SMED30004877-orf-1 ID=SMED30004877-orf-1|Name=SMED30004877-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=449bp
MTIKQQQSNIFIFLLAIHVGCNSCSVAGITRERIMDKILQNYSLNERPIE
SNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDVRLRWDNLNEFKH
FNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYS
QKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELG
NNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVST
FIPNTLIVIVSWLNFWVSVEAVPARITLGLLTLLGILTQASGISGNLPRV
SYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQE
LSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQE
SAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIVSN*
back to top
Aliases
The feature 'Glycine receptor subunit alpha-3' has the following synonyms
Synonym
Smed_13405
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR006201Neur_channel
IPR006028GABAA/Glycine_rcpt
IPR006029Neurotrans-gated_channel_TM
IPR006202Neur_chan_lig-bd
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0030054cell junction
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 159..173
score: 46.82
coord: 76..92
score: 40.54
coord: 113..124
score: 44.53
coord: 237..249
score: 33.31
IPR006201Neurotransmitter-gated ion-channelTIGRFAMTIGR00860TIGR00860coord: 29..442
e-value: 7.5E-101
score: 336.0
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 24..442
IPR006028Gamma-aminobutyric acid A receptor/Glycine receptor alphaPRINTSPR00253GABAARECEPTRcoord: 272..293
score: 41.19
coord: 306..327
score: 45.82
coord: 422..442
score: 45.09
coord: 246..266
score: 43.07
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 25..240
e-value: 3.7E-64
score: 217.9
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 31..242
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 251..405
e-value: 2.1E-22
score: 80.4
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 32..242
e-value: 5.1E-46
score: 156.8
NoneNo IPR availablePANTHERPTHR18945:SF455GLYCINE RECEPTOR SUBUNIT ALPHA-3coord: 24..442
NoneNo IPR availableCDDcd19049LGIC_TM_anioncoord: 246..330
e-value: 4.5844E-30
score: 110.619
NoneNo IPR availableCDDcd18987LGIC_ECD_anioncoord: 54..242
e-value: 1.23224E-69
score: 217.161
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.548
NoneNo IPR availableTMHMMTMhelixcoord: 271..293
NoneNo IPR availableTMHMMTMhelixcoord: 425..447
NoneNo IPR availableTMHMMTMhelixcoord: 244..266
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 308..330
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 159..173
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 246..444