EF-hand calcium-binding domain-containing protein 6

Overview
NameEF-hand calcium-binding domain-containing protein 6
Smed IDSMED30004875
Length (bp)3009
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EF-hand calcium-binding domain-containing protein 6 (SMED30004875) t-SNE clustered cells

Violin plots show distribution of expression levels for EF-hand calcium-binding domain-containing protein 6 (SMED30004875) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EF-hand calcium-binding domain-containing protein 6 (SMED30004875) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EF-hand calcium-binding domain-containing protein 6 (SMED30004875) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004875

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30004875h1SMcG0013776 SmedASXL_013127SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30004875h1SMcG0013776 SmedASXL_013127SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30004875h1SMcG0013776 dd_Smed_v4_20435_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004875h1SMcG0013776 dd_Smed_v4_20435_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004875h1SMcG0013776 dd_Smed_v4_20435_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004875h1SMcG0013776 dd_Smed_v4_20435_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30004875h1SMcG0013776 dd_Smed_v6_20435_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30004875h1SMcG0013776 Contig11541newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30004875h1SMcG0013776 Contig11541uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30004875h1SMcG0013776 Contig55478uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30004875h1SMcG0013776 Contig55478newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Human
Match: EFCAB6 (EF-hand calcium binding domain 6 [Source:HGNC Symbol;Acc:HGNC:24204])

HSP 1 Score: 67.3958 bits (163), Expect = 1.503e-10
Identity = 41/183 (22.40%), Postives = 88/183 (48.09%), Query Frame = 2
Query: 2330 LGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHE-FLKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKL-TVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLL 2872
            +   W  + K+ ++ DV  +  I   +   L+ K    ++ +E + L+  +DLK NG+F Y +F+    L  +  E +   ++H  ++++    ++ G +  +   A   I+  ++  W+ + R F+  D   TG +  +    +L +  I LS+++ +H+   +D  L  KI Y +F+   L
Sbjct: 1169 IQGCWRQLLKECKEKDVARQGDINASDFLALVEKFNLDISKEECQQLIIKYDLKSNGKFAYCDFIQSCVLLLKAKESS---LMHRMKIQNAHKMKEAGAETPSFYSALLRIQPKIVHCWRPMRRTFKSYDEAGTGLLSVADFRTVLRQYSINLSEEEFFHILEYYDKTLSSKISYNDFLRAFL 1348          

HSP 2 Score: 56.225 bits (134), Expect = 3.447e-7
Identity = 44/181 (24.31%), Postives = 80/181 (44.20%), Query Frame = 2
Query: 2342 WVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEF-LKFRPDEGTAKPVL--HFDRVRH----QLLNEKTGGKLTVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNL-DGKIDYIEFI 2860
            W  + K   + D  G   +   ++K  L      LTP E E L   +D +  G   Y EFL +  + + P     +P    +F+ + H    Q L E+        E     R  L+ + + + +AF K D  KT  I   ++ ++L + G  L++ +L H+ + +  +  D  I+Y++F+
Sbjct:  697 WSDLSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQKLGINYSP--AVHRPCAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAARDKLMDRHQDISKAFTKTDQSKTNYISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHDNAINYLDFL 875          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Human
Match: EFCAB6 (EF-hand calcium binding domain 6 [Source:HGNC Symbol;Acc:HGNC:24204])

HSP 1 Score: 67.0106 bits (162), Expect = 1.988e-10
Identity = 41/183 (22.40%), Postives = 88/183 (48.09%), Query Frame = 2
Query: 2330 LGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHE-FLKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKL-TVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLL 2872
            +   W  + K+ ++ DV  +  I   +   L+ K    ++ +E + L+  +DLK NG+F Y +F+    L  +  E +   ++H  ++++    ++ G +  +   A   I+  ++  W+ + R F+  D   TG +  +    +L +  I LS+++ +H+   +D  L  KI Y +F+   L
Sbjct: 1321 IQGCWRQLLKECKEKDVARQGDINASDFLALVEKFNLDISKEECQQLIIKYDLKSNGKFAYCDFIQSCVLLLKAKESS---LMHRMKIQNAHKMKEAGAETPSFYSALLRIQPKIVHCWRPMRRTFKSYDEAGTGLLSVADFRTVLRQYSINLSEEEFFHILEYYDKTLSSKISYNDFLRAFL 1500          

HSP 2 Score: 55.8398 bits (133), Expect = 4.890e-7
Identity = 44/181 (24.31%), Postives = 80/181 (44.20%), Query Frame = 2
Query: 2342 WVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEF-LKFRPDEGTAKPVL--HFDRVRH----QLLNEKTGGKLTVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNL-DGKIDYIEFI 2860
            W  + K   + D  G   +   ++K  L      LTP E E L   +D +  G   Y EFL +  + + P     +P    +F+ + H    Q L E+        E     R  L+ + + + +AF K D  KT  I   ++ ++L + G  L++ +L H+ + +  +  D  I+Y++F+
Sbjct:  849 WSDLSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQKLGINYSP--AVHRPCAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAARDKLMDRHQDISKAFTKTDQSKTNYISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHDNAINYLDFL 1027          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Zebrafish
Match: si:dkey-256e7.5 (si:dkey-256e7.5 [Source:ZFIN;Acc:ZDB-GENE-090313-282])

HSP 1 Score: 50.8322 bits (120), Expect = 4.971e-6
Identity = 51/193 (26.42%), Postives = 92/193 (47.67%), Query Frame = 2
Query: 2273 DFVVDSEKLQKTVEKMSPVLGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEFLKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKLTVVEAY-KEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDY 2848
            D +VD+  L+  VE MS  +  +W     +  ++D  G   +   E KE+L+     L+  E + L   FD+  +G   Y+EFL  FL        ++   H   +   L   +   ++   E   + IRK L ++ K+L +A  ++D+  +G +  ++L  +L   G+  S+++L  VFS   T+  G +DY
Sbjct:  154 DILVDA--LRAKVE-MS--VSELWT----EFSEMDFSGTGFVSSDEFKEILMSLCVHLSQYECDVLARKFDINHDGCVSYLEFLRPFL------SQSQIWKHGSNMAAALQTPRENQEIATPETLNRNIRKKLQRKAKALSKACTRLDSSSSGLLSAAELGAVLQLLGVCQSQEELKSVFSTLHTHPSGCLDY 331          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Xenopus
Match: immp2l (inner mitochondrial membrane peptidase subunit 2 [Source:Xenbase;Acc:XB-GENE-1010851])

HSP 1 Score: 77.7962 bits (190), Expect = 7.983e-14
Identity = 81/349 (23.21%), Postives = 143/349 (40.97%), Query Frame = 2
Query: 1883 VADVLKFRFHAIDKQYKSFPIKEQGTLTKPILFELLNSQKCSLTLQEMEIIWAVVESHPHYSSLHYRQVLKHLMMNLYKRAEEINIENRVTTAEDPNIEVLK---EFKKTHKDDKSQLLDYCDKKIFMALLKK--------------DFVVDSEKLQKTVEKMSPVLGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHE-FLKFRPDEGTAKPVLHFDRVRHQLLNEKTG-GKLTVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLL 2872
            + +V+  RF+ + + + S        ++K    EL N     LT ++ E +W  +  +P Y +L Y + L            +  +     TA D +  + K        H   +SQ       K   A+L K                +V+ E+++    ++   L  +W  + +  R  D      I   +   +L +       +E+E L   +D + NG+F Y +F     L  +P E   K  LH  +V+   +   TG      + A   I+  +L  W+ + RAF   D  +TG I   +  Q+L KSG+ LS+D+ +H+   FD +L  K+ Y +F+   L
Sbjct: 1121 IREVVTARFYTVAQDFISLDYANINAVSKEDFRELFNKDFMLLTDEQFENLWNTLPLNP-YGNLKYHEFLSQFG------GGDALVSPYEKTAGDQSEFIYKPASALAGNHTPPESQA-GIRRPKTAPAILNKPKTDTQRPKTAGASSRLVNCEQIEA---RLRGSLQKVWQEVLRACRDYDPERTGEITTNDFSGVLKQFNAETNEEELERLTVKYDSRNNGKFSYADFFRNIMLGPKPLE---KSPLHRMKVQKTRVPISTGPDGPCFLNAMMRIQPKVLDCWRPMRRAFLSFDEARTGFISVQEFKQVLRKSGLNLSEDEFFHILGFFDKDLKAKVSYNDFLRAFL 1455          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Xenopus
Match: immp2l (inner mitochondrial membrane peptidase subunit 2 [Source:Xenbase;Acc:XB-GENE-1010851])

HSP 1 Score: 77.7962 bits (190), Expect = 8.627e-14
Identity = 81/349 (23.21%), Postives = 143/349 (40.97%), Query Frame = 2
Query: 1883 VADVLKFRFHAIDKQYKSFPIKEQGTLTKPILFELLNSQKCSLTLQEMEIIWAVVESHPHYSSLHYRQVLKHLMMNLYKRAEEINIENRVTTAEDPNIEVLK---EFKKTHKDDKSQLLDYCDKKIFMALLKK--------------DFVVDSEKLQKTVEKMSPVLGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHE-FLKFRPDEGTAKPVLHFDRVRHQLLNEKTG-GKLTVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLL 2872
            + +V+  RF+ + + + S        ++K    EL N     LT ++ E +W  +  +P Y +L Y + L            +  +     TA D +  + K        H   +SQ       K   A+L K                +V+ E+++    ++   L  +W  + +  R  D      I   +   +L +       +E+E L   +D + NG+F Y +F     L  +P E   K  LH  +V+   +   TG      + A   I+  +L  W+ + RAF   D  +TG I   +  Q+L KSG+ LS+D+ +H+   FD +L  K+ Y +F+   L
Sbjct: 1173 IREVVTARFYTVAQDFISLDYANINAVSKEDFRELFNKDFMLLTDEQFENLWNTLPLNP-YGNLKYHEFLSQFG------GGDALVSPYEKTAGDQSEFIYKPASALAGNHTPPESQA-GIRRPKTAPAILNKPKTDTQRPKTAGASSRLVNCEQIEA---RLRGSLQKVWQEVLRACRDYDPERTGEITTNDFSGVLKQFNAETNEEELERLTVKYDSRNNGKFSYADFFRNIMLGPKPLE---KSPLHRMKVQKTRVPISTGPDGPCFLNAMMRIQPKVLDCWRPMRRAFLSFDEARTGFISVQEFKQVLRKSGLNLSEDEFFHILGFFDKDLKAKVSYNDFLRAFL 1507          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Xenopus
Match: immp2l (inner mitochondrial membrane peptidase subunit 2 [Source:Xenbase;Acc:XB-GENE-1010851])

HSP 1 Score: 77.7962 bits (190), Expect = 9.431e-14
Identity = 81/349 (23.21%), Postives = 143/349 (40.97%), Query Frame = 2
Query: 1883 VADVLKFRFHAIDKQYKSFPIKEQGTLTKPILFELLNSQKCSLTLQEMEIIWAVVESHPHYSSLHYRQVLKHLMMNLYKRAEEINIENRVTTAEDPNIEVLK---EFKKTHKDDKSQLLDYCDKKIFMALLKK--------------DFVVDSEKLQKTVEKMSPVLGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHE-FLKFRPDEGTAKPVLHFDRVRHQLLNEKTG-GKLTVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLL 2872
            + +V+  RF+ + + + S        ++K    EL N     LT ++ E +W  +  +P Y +L Y + L            +  +     TA D +  + K        H   +SQ       K   A+L K                +V+ E+++    ++   L  +W  + +  R  D      I   +   +L +       +E+E L   +D + NG+F Y +F     L  +P E   K  LH  +V+   +   TG      + A   I+  +L  W+ + RAF   D  +TG I   +  Q+L KSG+ LS+D+ +H+   FD +L  K+ Y +F+   L
Sbjct: 1197 IREVVTARFYTVAQDFISLDYANINAVSKEDFRELFNKDFMLLTDEQFENLWNTLPLNP-YGNLKYHEFLSQFG------GGDALVSPYEKTAGDQSEFIYKPASALAGNHTPPESQA-GIRRPKTAPAILNKPKTDTQRPKTAGASSRLVNCEQIEA---RLRGSLQKVWQEVLRACRDYDPERTGEITTNDFSGVLKQFNAETNEEELERLTVKYDSRNNGKFSYADFFRNIMLGPKPLE---KSPLHRMKVQKTRVPISTGPDGPCFLNAMMRIQPKVLDCWRPMRRAFLSFDEARTGFISVQEFKQVLRKSGLNLSEDEFFHILGFFDKDLKAKVSYNDFLRAFL 1531          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Mouse
Match: Efcab6 (EF-hand calcium binding domain 6 [Source:MGI Symbol;Acc:MGI:1924877])

HSP 1 Score: 66.2402 bits (160), Expect = 1.936e-10
Identity = 43/180 (23.89%), Postives = 85/180 (47.22%), Query Frame = 2
Query: 2342 WVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEFLKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKLTVVEAYK---EIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLL 2872
            W  + ++ ++ D   + TI   E   L+ K    ++ +E + L+  +DLK NG+F Y +F+   +        AK      R+R Q  ++     +     Y     I+  ++  W+ + R+F+  D + TG +  +   ++L +  I LS+++ +HV   +D +L  KI Y +F+   L
Sbjct: 1340 WRELLRECKEKDTDKQGTISAAEFLALVEKFKLDISREESQQLIVKYDLKNNGKFAYCDFIQSCVLLL----KAKETSLMRRMRIQNADKMKEAGMETPSFYSALLRIQPKIVHCWRPMRRSFKTYDKNGTGLLSVADFRKVLRQYSINLSEEEFFHVLEYYDKSLSSKISYNDFLRAFL 1515          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. UniProt/SwissProt
Match: sp|Q5THR3|EFCB6_HUMAN (EF-hand calcium-binding domain-containing protein 6 OS=Homo sapiens OX=9606 GN=EFCAB6 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 9.547e-10
Identity = 41/183 (22.40%), Postives = 88/183 (48.09%), Query Frame = 2
Query: 2330 LGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHE-FLKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKL-TVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLL 2872
            +   W  + K+ ++ DV  +  I   +   L+ K    ++ +E + L+  +DLK NG+F Y +F+    L  +  E +   ++H  ++++    ++ G +  +   A   I+  ++  W+ + R F+  D   TG +  +    +L +  I LS+++ +H+   +D  L  KI Y +F+   L
Sbjct: 1321 IQGCWRQLLKECKEKDVARQGDINASDFLALVEKFNLDISKEECQQLIIKYDLKSNGKFAYCDFIQSCVLLLKAKESS---LMHRMKIQNAHKMKEAGAETPSFYSALLRIQPKIVHCWRPMRRTFKSYDEAGTGLLSVADFRTVLRQYSINLSEEEFFHILEYYDKTLSSKISYNDFLRAFL 1500          

HSP 2 Score: 55.8398 bits (133), Expect = 2.349e-6
Identity = 44/181 (24.31%), Postives = 80/181 (44.20%), Query Frame = 2
Query: 2342 WVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEF-LKFRPDEGTAKPVL--HFDRVRH----QLLNEKTGGKLTVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNL-DGKIDYIEFI 2860
            W  + K   + D  G   +   ++K  L      LTP E E L   +D +  G   Y EFL +  + + P     +P    +F+ + H    Q L E+        E     R  L+ + + + +AF K D  KT  I   ++ ++L + G  L++ +L H+ + +  +  D  I+Y++F+
Sbjct:  849 WSDLSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQKLGINYSP--AVHRPCAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAARDKLMDRHQDISKAFTKTDQSKTNYISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHDNAINYLDFL 1027          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. UniProt/SwissProt
Match: sp|Q6P1E8|EFCB6_MOUSE (EF-hand calcium-binding domain-containing protein 6 OS=Mus musculus OX=10090 GN=Efcab6 PE=1 SV=2)

HSP 1 Score: 66.2402 bits (160), Expect = 1.354e-9
Identity = 43/180 (23.89%), Postives = 85/180 (47.22%), Query Frame = 2
Query: 2342 WVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEFLKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKLTVVEAYK---EIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLL 2872
            W  + ++ ++ D   + TI   E   L+ K    ++ +E + L+  +DLK NG+F Y +F+   +        AK      R+R Q  ++     +     Y     I+  ++  W+ + R+F+  D + TG +  +   ++L +  I LS+++ +HV   +D +L  KI Y +F+   L
Sbjct: 1340 WRELLRECKEKDTDKQGTISAAEFLALVEKFKLDISREESQQLIVKYDLKNNGKFAYCDFIQSCVLLL----KAKETSLMRRMRIQNADKMKEAGMETPSFYSALLRIQPKIVHCWRPMRRSFKTYDKNGTGLLSVADFRKVLRQYSINLSEEEFFHVLEYYDKSLSSKISYNDFLRAFL 1515          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. UniProt/SwissProt
Match: sp|Q4R8T1|EFCB6_MACFA (EF-hand calcium-binding domain-containing protein 6 (Fragment) OS=Macaca fascicularis OX=9541 GN=EFCAB6 PE=2 SV=2)

HSP 1 Score: 64.3142 bits (155), Expect = 3.814e-9
Identity = 40/183 (21.86%), Postives = 86/183 (46.99%), Query Frame = 2
Query: 2330 LGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHE-FLKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKLTVV-EAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLL 2872
            +   W  + K+ ++ DV  +  I   E   L+ K    ++ +E + L+  +DLK NG+F Y +F+    L  +  E +   ++   ++++    + +G + +    A   I+  ++  W+ + R F+  D   TG +  +    +L +  I LS+++ +H+   +D  L   I Y +F+   L
Sbjct:  466 IQGCWRQLLKECKEKDVARQGDISASEFLALVEKFNLDISKEECQQLIIKYDLKNNGKFAYCDFIQSCVLLLKAKESS---LMQRMKIQNAHKMKDSGAETSSFYSALLRIQPKIVHCWRPMRRTFKSYDEAGTGLLSVADFRTVLRQYSINLSEEEFFHILEYYDKTLSSNISYNDFLRAFL 645          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. TrEMBL
Match: A0A504Y7V1 (EF-hand calcium-binding domain-containing protein 6 OS=Fasciola gigantica OX=46835 GN=FGIG_06990 PE=4 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 1.305e-103
Identity = 157/501 (31.34%), Postives = 243/501 (48.50%), Query Frame = 3
Query:  186 GLNSFRNIAEEEYKYIFPRDQQGLAIFSKKITPRA--HGDRMTVDEIDLIIREKFINERFSIQELFKVADEHKNGFVTKEALMKIFYTICDGLKVDHFYKLLERYKLNEKPVIAFSDVEKVFGLPPTGKYPAPQIFHGMGHPYNVSAGFGLQLLREXXXXXXXXXXXXXPESCFEEGGVILMAQFREALKKLKITLCAEDFIRLWR-KFDIKGVGSVSQRQLLWILNLQDNGKPMCGIRPTFIPLKR------PKIER-----VVRTKPPLKYKNCYELDNQPPQPDIR-----AGGVSFPLIRIPKWKPKGPGGSDEYEFGKGIQFVKGLQKLRDNRPEFSQIMDRLSYIFEEPFQALFTVFRHYDTKNSGFVSLDTGLKILSEYGFVIEIENLIKFLNKINCLDLNSGMN-------------------------YKRMLTDIQTKGPGTCVNKVISQIIKAESQSTGLKSLRTMSVDEIEQEVYKTLHKDFMSFQSQL 1556
            GL S+R   ++ Y Y  P +   +  F ++   R      R+++DE+DLIIR +   +R+SI+ LF+V   +    V+K AL++IF T+C  L +D F +LLERY L+++  + F   E+ F   P GK   P IF G+G    +S     ++L+E A D  FDLK LLP SCFE  G +L  Q R+AL+ +++ L  E+F RLW  K D+  VGS++ + L  IL L+++G P+ GI  T  PL+       PK+ R       R  PP         +    +  ++     AGG SFPL +   W+ + PGG++   FG G ++ K L+ L ++ P F  +M  L Y  E P+Q++   F+  D K+   V     L +L EYG  I   +L  FL  I      +G                           YKR+L   Q +  G+   +++  +      + G      ++  EIE+E  K LH  +M  +  L
Sbjct:   58 GLMSYRVHDKDTYYYNLPLNSDEIPDFIQEAKCRQVKQKSRLSLDEVDLIIRSELAKKRYSIKRLFEVNSVNNMNSVSKAALLRIFATLCPHLTIDLFCRLLERYGLDKEYAVTFRQFEEAFTAHPLGKREPPVIFEGLGAECYLSVAQTFRMLQEIACDPKFDLKRLLPPSCFEPDGHVLCPQLRKALQLMRLNLTEENFRRLWTDKLDMLKVGSITTKHLCRILGLKEDGTPI-GIHTTVTPLEAVGARGVPKLNRDPRLIEERKWPPFTLIASSSGEENSSKNKLKSELPTAGGTSFPLTKSHDWRAQAPGGANSPLFGCGDRYSKRLRMLEEHNPRFFDVMMCLRYKLENPYQSMLVAFKRQDPKHENRVRETDCLGVLKEYGLPINASDLATFLRGILSSSEATGWGIGRDKPPTTSFEAKDQANIRPGLVPYKRLLLYYQNRAKGSRARQIMKNLATKTVITVGESKAEHLTPAEIEEEFVKILHGSYMRLRKSL 557          

HSP 2 Score: 183.726 bits (465), Expect = 1.305e-103
Identity = 137/451 (30.38%), Postives = 206/451 (45.68%), Query Frame = 2
Query: 1580 ICENEARKIIENIIGHSMTKEQWKELQFQFDYCQPLSGKEEKDVNRLIDFRKFLNKFSKPTGICRYRFKSDLDKPIDWSNRNKKVKEFYDPPRHHAY---------LCRMVADVLKFRFHAIDKQYKSFPIKEQGTLTKPILFELLNSQKCSLTLQEMEIIWAVVESHPHYSSLH-YRQVLKHLMMNLYKRAEEINIENRVTTAEDPNIEVLKEFKKTHKDDKSQLLDYCDK--KIFMALLKKDFV---VDSEKLQKTVEKMSPVLGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEFLKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKLTVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLLDVFAP 2887
            I E   R+II   I   MT EQW+ L+    Y +P          ++I+++ F++ F+ P+G+     K+  D             E + PP    Y         L ++V + L+ R   ID+ YK +  KE   ++K    ELL  Q   L   E+E +W +++       LH YRQVLK       +   E     R  T  DPN++   ++    K+ K+Q L+   K  KI   +  +          +L +   K+  ++   W  +       D  GK  I + + K +  K  F LT  E++ L   F       F YI+F+  F K  P E   K V  FD   H   N KTG  +T VE   EIRK    QW++L  AF K+D  + GKI  +Q++++L K  I LS+DDLYH+ S +D +LDG+I Y EF++  L  F P
Sbjct:  567 IEETAFRRIINETIDFDMTDEQWENLKKHLKYTEP----------KVINWQAFIDAFNHPSGVSEILTKNIFD-----------ASESHCPPTSEKYRGEMRDLTVLLKLVENTLRSRLRHIDRSYKHYDQKELNMISKEDFVELLAVQGLELIPAEVEYLWGLLDQIEPGQELHNYRQVLKFFFNGTGQLITEELRRRRHKTIRDPNLDPFLQWNADFKNQKAQELNNLLKAGKIVKTICPRGPTRPRPSDHRLTELCTKLESLVQKDWDKLHTTFLYADPSGKTKIMWEDFKLIARKFKFPLTEPELQELFLCFQSPEKDYFNYIDFMVHFAKTLPTEKVPKTV--FDERTHTFTNTKTGQAMTFVEVISEIRKACTSQWRTLQEAFGKLDKSRLGKISINQIDEMLRKRDITLSQDDLYHLRSCYDRDLDGEISYHEFLQTTLKSFKP 994          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. TrEMBL
Match: A0A4V3SH74 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000560 PE=4 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 6.222e-102
Identity = 160/456 (35.09%), Postives = 236/456 (51.75%), Query Frame = 3
Query:  306 TVDEIDLIIREKFINERFSIQELFKVADEHKNGFVTKEALMKIFYTICDGLKVDHFYKLLERYKLNEKPVIAFSDVEKVFGLPPTGKYPAPQIFHGMGHPYNVSAGFGLQLLREXXXXXXXXXXXXXPESCFEEGGVILMAQFREALKKLKITLCAEDFIRLWR-KFDIKGVGSVSQRQLLWILNLQDNGKPMCGIRPTFIPLKRPKIE---RVVRTKPPLKYKNCYELDNQPPQPD---------IR----AGGVSFPLIRIPKWKPKGPGGSDEYEFGKGIQFVKGLQKLRDNRPEFSQIMDRLSYIFEEPFQALFTVFRHYDTKNSGFVSLDTGLKILSEYGFVIEIENLIKFLNKINCLDLNSGMN-------------------------YKRMLTDIQTKGPGTCVNKVISQIIKAESQSTGLKSLRTM-SVDEIEQEVYKTLHKDFMSF 1544
            T+DE+DLIIR +   +R +I+ LF+       G V K  L+KI  ++C  + ++ F++LLERY L+++ +++F   E+ F   P G  P P IF G+G   +VS     ++L+E A D  FDLK LLP SCFE  G +L  Q R+A+K ++I L  E+F RLWR KFD++ +GS+    L  ILNL ++G P+ GI+    PL+  KI    ++ R    L        D   P            IR    A G  FPL     W P+GPGG+ E  FG G ++ K L++L  + P F  IMD L Y FE P+QA+   F+ +D K++  VS +  L IL EYG  I  E+L  F+ +I      +G +                         YKR+L   Q +  G+   + + Q +K      G  + + M + DEIE+E+ K LHK++M F
Sbjct:  118 TLDEMDLIIRNQLAKKRHAIKLLFEEHAADTPGSVAKGTLLKIVASLCPRINIELFHRLLERYSLDKEALVSFRQFEEAFTAAPLGSCPPPMIFRGLGAEKSVSVAQAYKMLQEIACDPSFDLKRLLPSSCFEPDGRVLCPQLRQAMKLMRINLIDENFRRLWRDKFDLERLGSIRTSHLCQILNLNEDGTPL-GIQVKVTPLEAAKIRGIPKLNRNPKLLSQPEWPRFDMLLPHSKGKNEGVITLIRELPVAAGTGFPLPEQHTWTPQGPGGAREPVFGCGERYQKRLEELEKHHPRFDSIMDCLCYKFENPYQAMMVSFKRFDPKHNNRVSENECLGILREYGLNINAEDLHTFVRRILSPSEATGWSLGRDRPPETIGEEKAYTRIWPGLIPYKRLLAYYQNRAKGSPAYQRM-QALKLRGAVDGAVNKKMMLNPDEIEEELVKLLHKNYMEF 571          

HSP 2 Score: 170.244 bits (430), Expect = 6.222e-102
Identity = 133/459 (28.98%), Postives = 216/459 (47.06%), Query Frame = 2
Query: 1559 ASATSNLICENEARKIIENIIGHSMTKEQWKELQFQFDYCQPLSGKEEKDVNRLIDFRKFLNKFSKPTGICRYRFKSDLDKPIDWSNRNKKVKEFYDPPRHHAYLCRMVADVLKFRFHAIDKQYKSFPIKEQGTLTKPILFELLNSQKCSLTLQEMEIIWAVVES-HPHYSSLHYRQVLKHLMMNLYKRAEEINIE-------NRVTTAEDPNIEVL----KEFKKTHKDDKSQLLDYCDKKIFMALLKKDFVV---DSEKLQKTVEKMSPVLGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEFLKFRPDEGTAKPVLH-FDRVRHQLLNEKTGGKLTVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLLDVFAP 2887
            +S+    I E + R+I+   +G   +++QW+E +    Y          D  R + + +FL KF+ P  I   +  +  D   +          ++   R  A L R+V   ++ R H ID  YK +  KE+  ++K    ELL  Q   +  +E++ +W++++   P     +YRQV+       + R   I  E        R    +DPN++ L    K+FK+   ++++QLL     +I   L  +D V     +E+L     K+SPV+ + W  ++  L + D  G   I +   K +  +  F L   E+  L + FD K      Y  F+  F +   +E   KPV   FD   +Q  N   G KLT V    EIRK  L Q ++L+ AFRK+DT + G +   Q+ Q+L K  I+LS+DDLYH+ S FD+++ G I + +F    L VF P
Sbjct:  578 SSSPDGEIDEQKLREIVNQTVGFVASEDQWEEFKRHLPY---------NDTGR-VKWGRFLAKFNHPKNIASEKTTALFDYKKNQCP--PSTDHYHGDVRDKATLLRLVEHTVRTRLHHIDMIYKQYDRKEENMISKEDFGELLAGQGLDIIPEELDYLWSLLQQIEPGREIHNYRQVMNFF----FNRTRSIVAEFGRLKRYGRFQAIKDPNLQQLVAWRKDFKQFRAENEAQLLK--GARIATTLGPRDLVPVKPTTERLISLCNKISPVVSTNWNALQHALIESDPSGSTKILWDNFKNIARRFNFPLNESELNELCHGFDSKEKDFVNYHRFMKHFSENLQEE---KPVPTLFDERLYQFTNLNNGEKLTFVHVLGEIRKACLDQSRTLLEAFRKLDTKRQGILTVQQIEQLLQKRNIKLSEDDLYHLQSSFDSHMRGCITFEDFKRTALKVFKP 1015          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. TrEMBL
Match: A0A4E0RNG0 (EF-hand calcium-binding domain-containing protein 6 OS=Fasciola hepatica OX=6192 GN=D915_006523 PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 1.295e-92
Identity = 150/501 (29.94%), Postives = 234/501 (46.71%), Query Frame = 3
Query:  186 GLNSFRNIAEEEYKYIFPRDQQGLAIFSKKITPRA--HGDRMTVDEIDLIIREKFINERFSIQELFKVADEHKNGFVTKEALMKIFYTICDGLKVDHFYKLLERYKLNEKPVIAFSDVEKVFGLPPTGKYPAPQIFHGMGHPYNVSAGFGLQLLREXXXXXXXXXXXXXPESCFEEGGVILMAQFREALKKLKITLCAEDFIRLWR-KFDIKGVGSVSQRQLLWILNLQDNGKPMCGIRPTFIPLKR------PKIERVVRTKPPLKYKNCYELDNQPPQPDIR----------AGGVSFPLIRIPKWKPKGPGGSDEYEFGKGIQFVKGLQKLRDNRPEFSQIMDRLSYIFEEPFQALFTVFRHYDTKNSGFVSLDTGLKILSEYGFVIEIENLIKFLNKINCLDLNSGMN-------------------------YKRMLTDIQTKGPGTCVNKVISQIIKAESQSTGLKSLRTMSVDEIEQEVYKTLHKDFMSFQSQL 1556
            GL S+R   ++ Y Y  P +   +  F ++   R      R+++DE           +R+SI+ LF+V        V+K AL++IF T+C  L +D F +LLERY L+++  + F   E+ F   P GK   P IF G+G    +S     ++L+E A D  FDLK LLP SCFE  G +L  Q R+AL+ +++ L  E+F RLW  K D+  VGS++ + L  IL L+++G P+ GI     PL+       PK+ R  R     K+     + +   + +            AGG SFPL +   W+ + PGG++   FG G ++ K L+ L ++ P F  +M  L Y  E P+Q++   F+  D K+   V     L +L EYG  I   +L  FL  I      +G                           YKR+L   Q +  G+   +++  +      + G      ++  EIE+E  K LH  +M  +  L
Sbjct:   58 GLMSYRVHDKDTYYYNLPLNSDEIPDFIQEAKCRQVQQKSRLSLDE-----------KRYSIKRLFEVNSVKNMNSVSKGALLRIFATLCPHLTIDLFCRLLERYGLDKEYAVTFRQFEEAFTAHPLGKREPPVIFEGLGAECYLSVAQTFRMLQEIACDPKFDLKRLLPPSCFEPDGHVLCPQLRKALQLMRLNLTEENFRRLWTDKLDMLKVGSITTKHLCRILGLKEDGTPI-GIHTPVTPLEAVGARGVPKLNRDPRLIEERKWPQFTLIASSSGEENSSKNKLKSELPTAGGTSFPLTKSHDWRAQAPGGANSPLFGCGDRYSKRLRMLEEHNPRFFDVMMCLRYKLENPYQSMLVAFKRQDPKHENRVRETDCLGVLREYGLPINASDLATFLRGILSSSEATGWGIGRDKPPTTSFEAKDQANIRPGLVPYKRLLLYYQNRAKGSRARQIMKNLATKTVITVGESKAEYLTPAEIEEEFVKILHGSYMRLRKSL 546          

HSP 2 Score: 172.17 bits (435), Expect = 1.295e-92
Identity = 134/454 (29.52%), Postives = 206/454 (45.37%), Query Frame = 2
Query: 1580 ICENEARKIIENIIGHSMTKEQWKELQFQFDYCQPLSGKEEKDVNRLIDFRKFLNKFSKPTGICRYRFKSDLDKPIDWSNRNKKVKEFYDPPRHHAY---------LCRMVADVLKFRFHAIDKQYKSFPIKEQGTLTKPILFELLNSQKCSLTLQEMEIIWAVVESHPHYSSLH-YRQVLKHLMMNLYKR-AEEINIEN--RVTTAEDPNIEVLKEFKKTHKDDKSQLLDYCDK--KIFMALLKKDFV---VDSEKLQKTVEKMSPVLGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEFLKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKLTVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLLDVFAP 2887
            I E   R+II   I   MT EQW+ L+    Y +          +++I+++ F++ F+ P+G+     K+  D             E + PP    Y         L ++V + L+ R   ID+ YK +  KE   ++K    ELL  Q   L   E+E +W +++       LH YRQVLK       +   EE+      +     DPN++   ++    K+ K+Q  +   K  KI   +  +          +L +   K+  ++   W  +       D  GK  I + + K +  K  F LT  E++ L   F       F YI+F+  F K  P E   K V  FD   H   N KTG  +T VE   EIRK    QW++L  AF K+D  + GKI  +Q++++L K  I LS+DDLYH+ S +D +LDG+I Y EF++  L  F P
Sbjct:  556 IEETAFRRIINETIDFDMTDEQWENLKKHLKYTE----------SKVINWQAFIDAFNHPSGVSEILTKNVFD-----------ASESHCPPTSEKYRGEMRDLTVLLKLVENTLRSRLRHIDRSYKHYDQKELNMISKEDFVELLAVQGLELIPAEVEYLWGLLDQIEPGQELHNYRQVLKFFFNGTRQLITEELRRRRHKKFQIIRDPNLDPFLQWSADFKNQKAQERNNLLKAGKIVKTICPRGPTRPRPSDHRLTELCTKLESLVQKDWDRLHTTFLYADPSGKTKIMWEDFKLVARKFKFPLTEPELQELFLCFQSPEKDYFNYIDFMVHFAKTLPTEKVPKTV--FDERTHTFTNTKTGQAMTFVEVISEIRKACTSQWRTLQEAFGKLDKSRLGKISINQIDEMLRKRDIALSQDDLYHLRSCYDRDLDGEISYHEFLQTTLKSFKP 986          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. TrEMBL
Match: A0A5K3FBQ1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 1.118e-83
Identity = 163/523 (31.17%), Postives = 258/523 (49.33%), Query Frame = 3
Query:   78 PNV-TPSKTWAMKTAKIYPTIDRCDRVKGFRDI----DYKPGLNSFRNIAEEEYKYIFPRDQQGLAIFSKKITPRAHGDRMTVDEIDLIIREKFINERFSIQELFKVADEHKNGFVTKEALMKIFYTICDGLKVDHFYKLLERYKLNEKPVIAFSDVEKVFGLPPTGKYPAPQIFHGMGHPYNVSAGFGLQLLREXXXXXXXXXXXXXPESCFEEGGVILMAQFREALKKLKITLCAEDFIRLW-RKFDIKGVGSVSQRQLLWILNLQDNGKPMC-GIRPT---FIPLKRPKIERVVRTKPPLKYKNCYELDNQP-------PQPDIRAGGVSFPLIRIPKWKPKGPGGSDEYEFGKGIQFVKGLQKLRDNRPEFSQIMDRLSYIFEEPFQALFTVFRHYDTKNSGFVSLDTGLKILSEYGFVIEIENLIKFLNKINCLDLNS------------GMNYKRMLTDIQTKGPGTCVNKVISQIIKAESQSTGLKSLRTMSVDEIEQEVYKTLHKDFMSFQSQLE 1559
            PNV TP++       ++ P + +C      R +    + K G  SFR +  E+Y Y  P ++  L  +  K        R ++DEID ++R K    R+ I+ LF+ AD  K GFVTK  L++IF+ IC  +++D F+++ ERY LNE P+++FSD E +FGLPP GK   P I +G G  + +S  F L+ +   A  K F+LK +LP SCFE+ G IL  Q RE L +++I L  E+F RLW +KFD++G+GS+  +QL+  L L  +G P    ++ +   F    R K +    + P  K   C  +   P         P  +      P  ++P  +              GI++   L ++  NRP    I+ +L YIFE  ++AL  VF   D    G V  D  L +L E G  +E E L +F  +++     S            GMNY ++L  ++   P   +N  I+++ +         S R  S   +E E++  ++K+++ F  +LE
Sbjct:   28 PNVYTPAEGLTNGIFEVRP-LTKCSDADTIRTLREKNNIKVGFQSFRPLENEKYHYTLPSNKDDLGKWILKPFELKPFKRPSLDEIDTVLRCKLQRRRYYIKRLFQDADCLKRGFVTKAELLRIFHVICPEMQMDQFHRICERYCLNETPILSFSDFEAMFGLPPIGKTEGPDINNGPGFDHKLSVAFALETIIRGAKVKGFNLKEILPTSCFEQNGRILKPQMREMLARMRIQLTDENFRRLWEQKFDLEGIGSIPTKQLIDQLGLTPDGTPKSEDVKVSDYRFPDQHRAKYKSFNGSAPLSKPNPCPPMVMDPIPVKATSETPAPKQEAKEEPTNQLPVLE----------SLPHGIRYKDQLLRVLQNRPRSRNIILQLKYIFEARYKALTQVFELLDKDRKGSVPEDQLLVVLRECGLSVEPEELRRFALRLSLFADASVGACENPKTKGIGMNYIKLLRQLKCAPPSKNLNN-INRVNRGPDNDPCSWSNRAKSNRYLEDEIFNAVYKEYLYFVERLE 538          

HSP 2 Score: 124.79 bits (312), Expect = 1.118e-83
Identity = 112/443 (25.28%), Postives = 208/443 (46.95%), Query Frame = 2
Query: 1598 RKIIENIIGHSMTKEQWKELQFQFDYCQPLSGKEEKDVNRLIDFRKFLNKFSKPTGICRYRFKSDLDKP-IDWSNRNKKVK-EFYDPPRHHAYLCRMVADVLKFRFHAIDKQYKSFPIKEQGTLTKPILFELLNSQKCSLTLQEMEIIWAVV-ESHPHYSSLH-YRQVLKHLMMNLYKRAEEINIENRVTTAEDPNIEVLKEFKKTHKDDKSQ------LLDYCDKKIFMALLKKDFVVDSEKLQKTVEKMSPVLGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEFLKFRPDEGTAKPVLH--FDRVRHQLLNEKTGGKLTVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGK-IDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLLDVFAP 2887
            R+I+E+ +G +M + QW+E+  Q    +P +          +D   FL  FSK   +C+      L+ P I   +  ++ + E+   PR    +   +  ++  +F  IDK YK F       + K     +L      L   E++ IW+++ E  P  + LH YR+V++ L+     R  + ++  R     DPN+  +K+F +  +  K +       L    K+I     +K+    +E++++  +K+ PV+ + W  ++      D  G  ++   + +++     F L+ +E+  L +  D K +G   Y++FL  F K     G   P +   FD V H+L N+K G ++ + E   ++R+  L ++ +L+  FR I   +    I    L   L K GI L++D LYH+ + +D +  G I Y +F++Q +DV  P
Sbjct:  552 REIVESTVGFTMNECQWEEVNRQLRI-RPRN---------TVDMHHFLAHFSK---MCKESPWEVLETPQIRQLDEEQQARLEYAGEPRDINLVLFALEKLISEKFCKIDKIYKHFDHCSSSAVDKNDFGMVLKKIGFGLCPVELDAIWSLLDEREPSTNGLHNYRKVIRFLLETGGIRFYQ-SMARRNKRLHDPNLVKMKDFWRCQRKYKKEHTKEVLALGKAAKEIKYVRKQKE-KPSAERVEQLCQKIRPVVVANWTDLRNGFLWQDPNGWGSMLRKDFRKVCAAFNFPLSQEELCELAHGLDKKNDGYVQYVDFLGRFAK-----GYVPPKIGYKFDIVHHKLKNKKDGKEIGIREVMDKLRQICLSEYNTLLAGFRAIAGSRHADCIKAKDLGAFLKKHGIDLAEDCLYHLCTAYDKHRRGYITYTDFLQQTMDVTKP 974          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. TrEMBL
Match: G7YFU6 (EF-hand calcium-binding domain-containing protein 6 OS=Clonorchis sinensis OX=79923 GN=CLF_106852 PE=4 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.208e-77
Identity = 129/452 (28.54%), Postives = 207/452 (45.80%), Query Frame = 2
Query: 1559 ASATSNLICENEARKIIENIIGHSMTKEQWKELQFQFDYCQPLSGKEEKDVNRLIDFRKFLNKFSKPTGICRYRFKSDLDKPIDWSNRNKKVKEFYDPPRHHAYLCRMVADVLKFRFHAIDKQYKSFPIKEQGTLTKPILFELLNSQKCSLTLQEMEIIWAVVES-HPHYSSLHYRQVLKHLMMNLYKRAEEINIENRVTTAEDPNIEVL----KEFKKTHKDDKSQLLDYCDKKIFMALLKKDFVV---DSEKLQKTVEKMSPVLGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEFLKFRPDEGTAKPVLH-FDRVRHQLLNEKTGGKLTVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLLDVFAP 2887
             S     I E   R+I+  I+G   ++EQW+E +    Y          D  R I + +FL KF+ P  I   +  +  D   +          ++   R  A L RMV   ++ R H ID  YK +  KE+  ++K    ELL  Q   +  +E++ +W++++   P     +YRQV+            E     R  T  D N++ L    K+ K+  + +++ +L     +I   L  +D +     +E+L     K+SPV+ + W  ++  L + D  G   I +   K +  +  F L+  E+  L   FD K      Y  F+  F +  P+E   KPV   FD   +   N   G KLT V    EIRK  L Q ++L+ AFRK+DT + G +   ++ Q+L K  I+LS+DDLYH+ S FD+++ G I + +F    L  F P
Sbjct:  351 GSGPDGKIDEQTLREIVNQIVGFVTSEEQWEEFKRHLPYT---------DTGR-IKWGRFLAKFNHPKNIASEKTTALFDYKKNQCP--PSTDHYHGDVRDKATLLRMVEHTVRTRLHHIDMIYKQYDRKEENMISKEEFGELLAGQGLDIIPEELDYLWSLLQQIEPGREIHNYRQVMNFFFNRTRPTVAEFGRLKRYGTITDANLQQLVAWRKDLKQLREVNEAHVLK--GARIATTLGPRDPLPVKPTTERLISLCNKISPVVSTSWDALQHALIESDPSGSEKISWDNFKNIARRFNFPLSERELTELCRGFDSKEKDFINYHRFMKHFSENLPEE---KPVPTLFDERLYHFTNLNNGEKLTFVHVLGEIRKACLDQSRTLLEAFRKLDTKRQGILTVQKIEQLLQKRNIKLSEDDLYHLQSSFDSHMRGCITFEDFKRTALKAFKP 785          

HSP 2 Score: 156.762 bits (395), Expect = 1.208e-77
Identity = 109/335 (32.54%), Postives = 160/335 (47.76%), Query Frame = 3
Query:  687 PESCFEEGGVILMAQFREALKKLKITLCAEDFIRLWR-KFDIKGVGSVSQRQLLWILNLQDNGKPMCGIRPTFIPLKRPKIERVVRTKPPLKYKNCYELDNQPPQPDIR----------------------AGGVSFPLIRIPKWKPKGPGGSDEYEFGKGIQFVKGLQKLRDNRPEFSQIMDRLSYIFEEPFQALFTVFRHYDTKNSGFVSLDTGLKILSEYGFVIEIENLIKFLNKINCLDLNSGMN-------------------------YKRMLTDIQTKGPGTCVNKVISQIIKAESQSTGLKSLRTM-SVDEIEQEVYKTLHKDFMSF 1544
            P SCFE  G +L  Q R+A+K ++I L  E+F RLWR K D++ +GS+    L  ILNL+++G P+ GI+    PL+  KI  +       K      L +QP  P                         AGG  FPL     W P+GPGG+ E  FG G ++ K L+KL  + P F  IMD L Y FE P+QA+   F+ +D K++  V  +  L IL EYG  I  E+L  F+ +I      +G +                         YKR+L   Q +  G+  ++ + Q +K      G  + + M + DE+E+E+ K LHK++M F
Sbjct:   18 PSSCFEPNGRVLCPQLRQAMKLMRINLIDENFRRLWRDKLDLERLGSIKTSHLCQILNLKEDGTPL-GIQVKVTPLEAAKICGIP------KLNRNPRLLSQPEWPRFEMLLPHSKGKKEGVVTLIRELPVAGGTGFPLPEQHTWSPQGPGGATEPVFGCGDRYQKRLEKLEKHYPRFDNIMDCLHYKFENPYQAMMVSFKRFDPKHNNRVRENECLGILREYGLNINAEDLHTFVRRILSPSEATGCSLGRDQPPETIGEEKAYTRIRPGFIPYKRLLAYYQNRAKGSPAHQRL-QALKIRGAIDGAVNKKMMLNPDEVEEELVKLLHKNYMEF 344          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Cavefish
Match: ENSAMXT00000045911.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:36828479:36830332:-1 gene:ENSAMXG00000039191.1 transcript:ENSAMXT00000045911.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 4.725e-17
Identity = 54/176 (30.68%), Postives = 85/176 (48.30%), Query Frame = 2
Query: 2336 SMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEF-LKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKLTVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFI 2860
            S W  I+++ ++ D      IE       ++K   V TP + E L   ++LK  GR  Y EFL  F L  +P+  T          R +L   KT       +A   +   +  +WKS+ RAF   D ++TGKI   +  ++L +  + LS++D +H+ S FD N+ G I Y EF+
Sbjct:   85 SCWREIQRRCKEADTQRTGGIEIEAFLGNVVK--MVTTPSQFEQLSEKYNLKNKGRLSYPEFLQNFVLMLKPNAPTFT-------ERRRLHLPKTPVSRQCTDALLRLCSPIQLRWKSIKRAFVFYDKERTGKIPLQEFRKVLRQHNVNLSEEDFFHLASFFDKNISGNISYNEFL 251          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Cavefish
Match: ENSAMXT00000025429.2 (pep primary_assembly:Astyanax_mexicanus-2.0:22:22005497:22012905:-1 gene:ENSAMXG00000024706.2 transcript:ENSAMXT00000025429.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 2.649e-6
Identity = 26/64 (40.62%), Postives = 36/64 (56.25%), Query Frame = 2
Query: 2672 KQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIE 2863
            K  + L   FR  D +K G ID  +L  +L  +G  +S+DD+  +    D N DGKIDY EF+E
Sbjct:   88 KSEEELADLFRMFDKNKDGYIDMEELRAMLTSTGESISEDDVEELMKDGDKNNDGKIDYDEFLE 151          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004536.1 (pep scaffold:Pmarinus_7.0:GL477109:94389:131012:-1 gene:ENSPMAG00000004110.1 transcript:ENSPMAT00000004536.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 3.368e-14
Identity = 91/445 (20.45%), Postives = 171/445 (38.43%), Query Frame = 2
Query: 1574 NLICENEARKIIENIIGHSMTKEQWKELQFQFDYCQPLSGKEEKDVNRLIDFRKFLNKFSKPTGICRYRFKSDLDKPIDWSNRNKKV-----KEFYDPPRHHAYLCRMVADVLKFRFHAIDKQYKSFPIKEQGTLTKPILFELLNSQKCSLTLQEMEIIWA--VVESHPHYSSLHYRQVLKHLMMNLYKRAEEINIENRVTTAEDPNIEVLKEFKKTHKDDKSQLLDYCDKKIFMALLKKDFVVDSEKLQKTV-EKMSPVLGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFL-HEFLKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKL---TVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLL 2872
             L+ E E R++++N             L+      Q L  + ++  +  +D++ FL  FS           SD  +  DW     +      +   D       + R + DV+  RF+A+ +      +   G LT+    ++++     L+ ++ E +WA   V+         YR+ LK         A         T++  P + + K  +  +   +   +    +      ++   +VD E L+  + E++S      W  I ++ R  D      I   ++  +L      L+ DE+  L   F     G   Y  FL H  L  RP +          R R Q  +   GG       +EA   +R+ +L  W+ + RAFR +D   +G +      Q+L +  I L++D+ + + + +D  L  ++ Y  F+   L
Sbjct: 1123 GLVKEEEFRRVLDNFC-----------LKLDGPQFQHLLKRLKRGGDGTVDWQDFLEAFS---------LLSDKTEGADWQREVARAALAGHRGAGDHALSAGGVLRRLRDVVSARFYAVARALVCADLPGVGRLTREQFRQVVHRHFLRLSDKQFEELWAQLPVDECDKLDYRDYREFLKRFCDGTALPAAAF------TSSAPPALGIYKPPQSLNTGHRPASVAGSVRGGTARAVRSTPLVDCEALESRLRERVS----RRWQEILRECRLKDPTASGEIGANDLLGVLRTFDVWLSEDELAGLASKFAAHSTGHVAYRAFLRHLVLTLRPRQHGL-----LQRQRLQQPSFTPGGTAPNDAFLEAMLHLREQVLPNWRPMRRAFRAVDPSASGFLSAPDFRQVLKQFAINLTEDEFFQILNYYDGQLHNRVPYNAFLRTFL 1532          

HSP 2 Score: 58.151 bits (139), Expect = 1.102e-8
Identity = 42/173 (24.28%), Postives = 73/173 (42.20%), Query Frame = 2
Query: 2357 KQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEFLK--FRPDEGTAKPVLHFDRVRHQLLNEKTGGKLTVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQL 2869
            +  R +D     T+   E++ +L      LT  +   L       RNG   Y++FL  FL    RP   +++             +    G+    E    +RK L +  K ++R FR  D +  G++ + +L  +L   G RLS+     +++  D +  G + Y EF+E L
Sbjct:   83 RAFRALDPGRAGTVSHGELRRVLDLFVLPLTDPQFGALFSMVPAGRNGNIPYLQFLEHFLGQPTRPSTASSRQK-----------STPPAGRGINEETDLLLRKKLGRDLKGVVRTFRLFDYNGDGRVQRHELRGVLESHGARLSESQFSKLWARHDVHQGGTVAYQEFLESL 244          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004557.1 (pep scaffold:Pmarinus_7.0:GL477109:94389:108111:-1 gene:ENSPMAG00000004110.1 transcript:ENSPMAT00000004557.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 8.063e-13
Identity = 86/407 (21.13%), Postives = 154/407 (37.84%), Query Frame = 2
Query: 1721 IDFRKFLNKFSKPTGICRYRFKSDLDKPIDWSNRNKKV-----KEFYDPPRHHAYLCRMVADVLKFRFHAIDKQYKSFPIKEQGTLTKPILFELLNSQKCSLTLQEMEIIWA--VVESHPHYSSLHYRQVLKHLMMNLYKRAEEINIENRVTTAEDPNIEVLKEFKKTHKDDKS---QLLDYCDKKIFMA---------LLKKDFVVDSEKLQKTVEKMSPVLGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFL-HEFLKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKL---TVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLL 2872
            +D++ FL  FS           SD  +  DW     +      +   D       + R + DV+  RF+A+ +      +   G LT+    ++++     L+ ++ E +WA   V+         YR+ LK         A         T++  P IE      ++     S   Q L+   +   +A          ++   +VD E L+    ++   +   W  I ++ R  D      I   ++  +L      L+ DE+  L   F     G   Y  FL H  L  RP +          R R Q  +   GG       +EA   +R+ +L  W+ + RAFR +D   +G +      Q+L +  I L++D+ + + + +D  L  ++ Y  F+   L
Sbjct:  273 VDWQDFLEAFS---------LLSDKTEGADWQREVARAALAGHRGAGDHALSAGGVLRRLRDVVSARFYAVARALVCADLPGVGRLTREQFRQVVHRHFLRLSDKQFEELWAQLPVDECDKLDYRDYREFLKRFCDGTALPAAAF------TSSAPPGIEHTHGHAQSTHPSLSFPPQSLNTGHRPASVAGSVRGGTARAVRSTPLVDCEALES---RLRERVSRRWQEILRECRLKDPTASGEIGANDLLGVLRTFDVWLSEDELAGLASKFAAHSTGHVAYRAFLRHLVLTLRPRQHGL-----LQRQRLQQPSFTPGGTAPNDAFLEAMLHLREQVLPNWRPMRRAFRAVDPSASGFLSAPDFRQVLKQFAINLTEDEFFQILNYYDGQLHNRVPYNAFLRTFL 656          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004547.1 (pep scaffold:Pmarinus_7.0:GL477109:94389:129511:-1 gene:ENSPMAG00000004110.1 transcript:ENSPMAT00000004547.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 3.762e-10
Identity = 75/351 (21.37%), Postives = 133/351 (37.89%), Query Frame = 2
Query: 1877 RMVADVLKFRFHAIDKQYKSFPIKEQGTLTKPILFELLNSQKCSLTLQEMEIIWAV--VESHPHYSSLHYRQVLKHLMMNLYKRAEEINIENRVTTAEDPNIEVLKEFKKTHKDDKSQLLDYCDKKIFMA-------------LLKKDFVVDSEKLQKTVEKMSPVLGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFL-HEFLKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKL---TVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLL 2872
            R + DV+  RF+A+ +      +   G LT+    ++++     L+ ++ E +WA   V+         YR+ LK          +   +     T+  P        K   K   S LL   +     A              ++   +VD E L+    ++   +   W  I ++ R  D      I   ++  +L      L+ DE+  L   F     G   Y  FL H  L  RP +          R R Q  +   GG       +EA   +R+ +L  W+ + RAFR +D   +G +      Q+L +  I L++D+ + + + +D  L  ++ Y  F+   L
Sbjct: 1138 RRLRDVVSARFYAVARALVCADLPGVGRLTREQFRQVVHRHFLRLSDKQFEELWAQLPVDECDKLDYRDYREFLKRF-------CDGTALPAAAFTSSAPPDNGATAMKSRPKTTASCLLTRSEHTHGHAQSTHPSLSGGTARAVRSTPLVDCEALE---SRLRERVSRRWQEILRECRLKDPTASGEIGANDLLGVLRTFDVWLSEDELAGLASKFAAHSTGHVAYRAFLRHLVLTLRPRQHGL-----LQRQRLQQPSFTPGGTAPNDAFLEAMLHLREQVLPNWRPMRRAFRAVDPSASGFLSAPDFRQVLKQFAINLTEDEFFQILNYYDGQLHNRVPYNAFLRTFL 1473          

HSP 2 Score: 52.7582 bits (125), Expect = 4.135e-7
Identity = 43/171 (25.15%), Postives = 72/171 (42.11%), Query Frame = 2
Query: 2357 KQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEFLKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKLTVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQL 2869
            +  R +D     T+   E++ +L      LT  +    +      RNG   Y++FL  FL       TA           + +NE+T   L         RK L +  K ++R FR  D +  G++ + +L  +L   G RLS+     +++  D +  G + Y EF+E L
Sbjct:   25 RAFRALDPGRAGTVSHGELRRVLDLFVLPLTDPQFGACVIQVPAGRNGNIPYLQFLEHFLGQPTRPSTASSRQKSTPPAGRGINEETDLLL---------RKKLGRDLKGVVRTFRLFDYNGDGRVQRHELRGVLESHGARLSESQFSKLWARHDVHQGGTVAYQEFLESL 186          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Sea Lamprey
Match: efcab7 (EF-hand calcium binding domain 7 [Source:ZFIN;Acc:ZDB-GENE-040625-115])

HSP 1 Score: 50.8322 bits (120), Expect = 1.222e-6
Identity = 25/64 (39.06%), Postives = 38/64 (59.38%), Query Frame = 2
Query: 2687 LIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLLDV 2878
            L+ AFRKID +  G +   +L ++L   G R+++ +L  VF   D N DGK+DY EF   +L+ 
Sbjct:   79 LLDAFRKIDRNSDGFLTCDELRRVLTTRGERMTEKELQGVFEDADVNRDGKLDYAEFSRMVLET 142          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Nematostella
Match: EDO28943 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T520])

HSP 1 Score: 82.0333 bits (201), Expect = 1.077e-17
Identity = 51/183 (27.87%), Postives = 95/183 (51.91%), Query Frame = 2
Query: 2342 WVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEF-LKFRP--DEGTAKPVLHFDRVRHQLLNEKTGGKLT--VVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLLD 2875
            W  ++K  R +D      + F+++K++L+++  +L  +E+ +L    D+   GR  Y +FL  F L  +P  D    +P L   +V        + G  +  +++    IR  + + WK + RAFR ID D +G  +     Q+L +  I L++++ +HV+S +D ++ GKI Y EF+   L+
Sbjct:   29 WQQLQKSFRNLDPDNTGHVSFHQLKDVLVQHYVILNNNELLSLWRKHDVDGKGRIVYKDFLRHFVLAMKPQDDSKLIRPKLQPTKV------PSSPGVRSDELIDVMATIRGKVQEDWKEMRRAFRAIDKDGSGLCNPVDFRQMLKRFKIDLNEEEFFHVYSFYDKDMTGKISYNEFLRAHLE 205          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Nematostella
Match: EDO36810 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHJ6])

HSP 1 Score: 77.0258 bits (188), Expect = 1.599e-14
Identity = 96/415 (23.13%), Postives = 164/415 (39.52%), Query Frame = 3
Query:  300 RMTVDEIDLIIREKFINERFSIQELFKVADEHKNGFVTKEALMKIFYTICDGLKVDHFYKLLERYKLNEKPVIAFSD----------VEKVFGLP------PTGKYPAPQIFHGMGHPYNVSAG---------------FGLQ---LLREXXXXXXXXXXXXXPESCFEEGGVILMAQFREALKKLKITLCAEDFIRLWRKFDIKGVGSVSQRQLLWILNLQDN-GKPMCGIRPTFIPLKRPKIERVVRTKP-PLKYKNCYELDNQPPQPDIRAGGVSFPLIRIPKWKPKGPGGSDEYEFGKGIQFVKGLQKLRDNRPEFSQIMDRLSYIFEEPFQALFTVFRHYDTKNSGFVSLDTGLKILSEYGFV---IEIENLIKFLNKINCLDLNSGMNYKRMLTDIQTKGPGTCVNKVI 1427
            R TV+E++ +I++K     F +++ F+  D    G V++EA   I Y +C  +       LL+R  +     I+F D          V+K +  P           PA Q+        NV                    LQ   LL+  A     +    LP+SCF+  G++L  Q R+AL  + I +  ++F ++W + D  G+G+V  R     L L  N GK            K P  E+V+  KP  ++  +C + D+              P   IP                           + + + E   IM  LS  F+E +  +  +F  YD +N+G VS     ++L+ Y      IE+E+   FL++  C   +  + Y+++L   Q +     + K++
Sbjct:   40 RRTVEELEELIKDKLTTGFFGVRQAFRANDPRGRGSVSREAFTTILYHLCGYVSPSLVSSLLQRIGVESPSSISFDDFISHFRDNEVVQKEWLDPVLRPVRQGAHLPANQLRDSQRERSNVEQHEKRKQGLRKTLPVFYTALQVFPLLKRKAQGGLGEFARFLPDSCFDVDGMVLKPQLRQALFLMDIHMYDDEFDKVWDRIDRSGLGTVDSRTFFLTLGLGGNEGKEKQH-------QKSPIKEQVLEDKPDSVQPASCAKQDS--------------PKTVIPV-------------------------TVDECQEEKEDIMAVLSNKFKEGYNGIVEMFSRYDPENTGKVSKHELRQVLASYRLTLGPIEVEH---FLSRFGCRH-DEMVPYRKILDMCQDRTDKGLLQKIM 404          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Nematostella
Match: EDO32038 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW85])

HSP 1 Score: 67.781 bits (164), Expect = 5.835e-12
Identity = 45/158 (28.48%), Postives = 82/158 (51.90%), Query Frame = 2
Query: 2417 ELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEF-LKFRP--DEGTAKPVLHFDRVRHQLLNEKTGGKLT--VVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLLD 2875
            ++L+++  +L  +E+ +L    D+   GR  Y +FL  F L  +P  D    +P L   +V        + G  +  +++    IR  + + WK + RAFR ID D +G  +     Q+L +  I L++++ +HV+S +D ++ GKI Y EF+   L+
Sbjct:  206 DVLVQHHVILNNNELLSLWRKHDVNGKGRIVYKDFLRHFVLAMKPQDDSKLIRPKLQPTKV------PSSPGVRSDELIDVMATIRGKVQEDWKEMRRAFRAIDKDGSGLCNPLDFRQMLKRFKIDLNEEEFFHVYSFYDKDMTGKISYNEFLRAHLE 357          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Nematostella
Match: EDO46548 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPQ2])

HSP 1 Score: 69.3218 bits (168), Expect = 6.018e-12
Identity = 53/191 (27.75%), Postives = 94/191 (49.21%), Query Frame = 3
Query:  297 DRMTVDEIDLIIREKFINERFSIQELFKVADEHKNGFVTKEALMKIFYT-ICDGLKVDHFYKLLERYKLNEKPVIAFSDVEKVFGLPPTGKYPAPQIFHGMGHP--YNVSAGFGLQLLREXXXXXXXXXXXXXPESCFEEGGVILMAQFREALKKLKITLCAEDFIRLWRKFDIKGVGSVSQRQLLWILNL 860
            D+ +VDE + ++REK     F+I+ LFK  D    G V++E+L +I  T +   + +  F KL+ R  L+ K +IA+ +    F  PP      P     +  P    ++A      L+E A  +  D+  L+P+      G IL  + R  L ++   +  ++F +LW K+D + VG++   +L+  L +
Sbjct:  129 DKASVDEFEYLLREKMKTGYFTIKNLFKQRDPENKGIVSRESLSQILTTFVGKPISLSQFNKLMVRLNLDHKKMIAYDEFYAAF-RPPKKADEGPAWLE-LEKPNMRTMTASQVHAHLKEKAKQRFLDVAELIPQMNPGGSGRILRPELRNVLNQMGFYMDDDEFEKLWLKYDTENVGTIRAEKLMGKLGI 317          

HSP 2 Score: 63.1586 bits (152), Expect = 4.670e-10
Identity = 52/208 (25.00%), Postives = 94/208 (45.19%), Query Frame = 2
Query: 2273 DFVVDSEKLQKTVEKMSPVLGS----MWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEFLK-----FRPDEGTAKPVLHFDRVRHQLLNEKTGGKLTVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQL 2869
            DF++ S KL   V+ +   L S     W  ++ +    D      +     KE+L      LT  E+  +   FD K   R  Y++FL  + K     F  + GT       +     ++ +   G L+ + A  ++R+ L  +WK+L +AFRK+D    G +   +   +L      L +D++YH+ S  D+ + G ++Y EF+ ++
Sbjct:  694 DFMMRSNKLNSDVDMLFDQLKSKVDFHWDRLRGEFAAADPNNAGFVSREAFKEILQDLCIELTDYELSYVTNKFDPKNENRVSYVKFLEPYAKRRRRYFSNNMGTVMNHPQAELPMDDIVPKPNKG-LSGITA--KLRQKLSGEWKNLRKAFRKLDLQNDGYLSIPEFRSVLRLCNTVLEEDEIYHLLSELDSGMSGNVNYREFLTKV 898          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Nematostella
Match: EDO46549 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPQ2])

HSP 1 Score: 55.0694 bits (131), Expect = 2.429e-8
Identity = 29/87 (33.33%), Postives = 48/87 (55.17%), Query Frame = 3
Query:  297 DRMTVDEIDLIIREKFINERFSIQELFKVADEHKNGFVTKEALMKIFYT-ICDGLKVDHFYKLLERYKLNEKPVIAFSDVEKVFGLP 554
            D+ +VDE + ++REK     F+I+ LFK  D    G V++E+L +I  T +   + +  F KL+ R  L+ K +IA+ +    F  P
Sbjct:  129 DKASVDEFEYLLREKMKTGYFTIKNLFKQRDPENKGIVSRESLSQILTTFVGKPISLSQFNKLMVRLNLDHKKMIAYDEFYAAFRPP 215          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Planmine SMEST
Match: SMESG000058629.1 (SMESG000058629.1)

HSP 1 Score: 1014.22 bits (2621), Expect = 0.000e+0
Identity = 503/503 (100.00%), Postives = 503/503 (100.00%), Query Frame = 3
Query:   51 MLKPTDHCMPNVTPSKTWAMKTAKIYPTIDRCDRVKGFRDIDYKPGLNSFRNIAEEEYKYIFPRDQQGLAIFSKKITPRAHGDRMTVDEIDLIIREKFINERFSIQELFKVADEHKNGFVTKEALMKIFYTICDGLKVDHFYKLLERYKLNEKPVIAFSDVEKVFGLPPTGKYPAPQIFHGMGHPYNVSAGFGLQLLREXXXXXXXXXXXXXPESCFEEGGVILMAQFREALKKLKITLCAEDFIRLWRKFDIKGVGSVSQRQLLWILNLQDNGKPMCGIRPTFIPLKRPKIERVVRTKPPLKYKNCYELDNQPPQPDIRAGGVSFPLIRIPKWKPKGPGGSDEYEFGKGIQFVKGLQKLRDNRPEFSQIMDRLSYIFEEPFQALFTVFRHYDTKNSGFVSLDTGLKILSEYGFVIEIENLIKFLNKINCLDLNSGMNYKRMLTDIQTKGPGTCVNKVISQIIKAESQSTGLKSLRTMSVDEIEQEVYKTLHKDFMSFQSQLE 1559
            MLKPTDHCMPNVTPSKTWAMKTAKIYPTIDRCDRVKGFRDIDYKPGLNSFRNIAEEEYKYIFPRDQQGLAIFSKKITPRAHGDRMTVDEIDLIIREKFINERFSIQELFKVADEHKNGFVTKEALMKIFYTICDGLKVDHFYKLLERYKLNEKPVIAFSDVEKVFGLPPTGKYPAPQIFHGMGHPYNVSAGFGLQLLREAALDKDFDLKALLPESCFEEGGVILMAQFREALKKLKITLCAEDFIRLWRKFDIKGVGSVSQRQLLWILNLQDNGKPMCGIRPTFIPLKRPKIERVVRTKPPLKYKNCYELDNQPPQPDIRAGGVSFPLIRIPKWKPKGPGGSDEYEFGKGIQFVKGLQKLRDNRPEFSQIMDRLSYIFEEPFQALFTVFRHYDTKNSGFVSLDTGLKILSEYGFVIEIENLIKFLNKINCLDLNSGMNYKRMLTDIQTKGPGTCVNKVISQIIKAESQSTGLKSLRTMSVDEIEQEVYKTLHKDFMSFQSQLE
Sbjct:    1 MLKPTDHCMPNVTPSKTWAMKTAKIYPTIDRCDRVKGFRDIDYKPGLNSFRNIAEEEYKYIFPRDQQGLAIFSKKITPRAHGDRMTVDEIDLIIREKFINERFSIQELFKVADEHKNGFVTKEALMKIFYTICDGLKVDHFYKLLERYKLNEKPVIAFSDVEKVFGLPPTGKYPAPQIFHGMGHPYNVSAGFGLQLLREAALDKDFDLKALLPESCFEEGGVILMAQFREALKKLKITLCAEDFIRLWRKFDIKGVGSVSQRQLLWILNLQDNGKPMCGIRPTFIPLKRPKIERVVRTKPPLKYKNCYELDNQPPQPDIRAGGVSFPLIRIPKWKPKGPGGSDEYEFGKGIQFVKGLQKLRDNRPEFSQIMDRLSYIFEEPFQALFTVFRHYDTKNSGFVSLDTGLKILSEYGFVIEIENLIKFLNKINCLDLNSGMNYKRMLTDIQTKGPGTCVNKVISQIIKAESQSTGLKSLRTMSVDEIEQEVYKTLHKDFMSFQSQLE 503          

HSP 2 Score: 916.376 bits (2367), Expect = 0.000e+0
Identity = 445/447 (99.55%), Postives = 447/447 (100.00%), Query Frame = 2
Query: 1556 RASATSNLICENEARKIIENIIGHSMTKEQWKELQFQFDYCQPLSGKEEKDVNRLIDFRKFLNKFSKPTGICRYRFKSDLDKPIDWSNRNKKVKEFYDPPRHHAYLCRMVADVLKFRFHAIDKQYKSFPIKEQGTLTKPILFELLNSQKCSLTLQEMEIIWAVVESHPHYSSLHYRQVLKHLMMNLYKRAEEINIENRVTTAEDPNIEVLKEFKKTHKDDKSQLLDYCDKKIFMALLKKDFVVDSEKLQKTVEKMSPVLGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEFLKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKLTVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLLDVFAPYPS 2896
            +ASATSNLICENEARKIIENIIGHSMTKEQWKELQFQFDYCQPLSGKEEKDVNRLIDFRKFLNKFSKPTGICRYRFKSDLDKPIDWSNRNKKVKEFYDPPRHHAYLCRMVADVLKFRFHAIDKQYKSFPIKEQGTLTKPILFELLNSQKCSLTLQEMEIIWAVVESHPHYSSLHYRQVLKHLMMNLYKRAEEINIENRVTTAEDPNIEVLKEFKKTHKDDKSQLLDYCDKKIFMALLKKDFVVDSEKLQKTVEKMSPVLGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEFLKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKLTVV+AYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLLDVFAPYPS
Sbjct:  504 KASATSNLICENEARKIIENIIGHSMTKEQWKELQFQFDYCQPLSGKEEKDVNRLIDFRKFLNKFSKPTGICRYRFKSDLDKPIDWSNRNKKVKEFYDPPRHHAYLCRMVADVLKFRFHAIDKQYKSFPIKEQGTLTKPILFELLNSQKCSLTLQEMEIIWAVVESHPHYSSLHYRQVLKHLMMNLYKRAEEINIENRVTTAEDPNIEVLKEFKKTHKDDKSQLLDYCDKKIFMALLKKDFVVDSEKLQKTVEKMSPVLGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEFLKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKLTVVKAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLLDVFAPYPS 950          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Planmine SMEST
Match: SMESG000023232.1 (SMESG000023232.1)

HSP 1 Score: 149.828 bits (377), Expect = 2.470e-40
Identity = 88/240 (36.67%), Postives = 140/240 (58.33%), Query Frame = 2
Query: 2165 DPNIEVLKEFKKTHKDDKSQLLDYCDKKIFMALLKKDFVVDSEKLQKT--VEKMSPVLGSMWVPIKKQLRQIDVVGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHEFLKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKLTVVEAYKEIRKTLLKQWKSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNLDGKIDYIEFIEQLLDV 2878
            D NIE+L+ FK   K +K         KI ++L  K    D  K+  T   EK+ P++   W  IK    ++D++G  T E +EM     K    L+  E+ NL+  FD+ +NGRF+Y+EFL +F   +PDE +   +  FD   H+L+++K+     + E  + +R +++K+WK+L+ AF+K+D  K G +   Q+N +L ++ I L KDDLYH+ + FD N+D KIDY EFI ++LD+
Sbjct:   10 DRNIEILQNFKANLKIEKENERQKLINKIDLSL--KSTTYDPLKIDVTEICEKIRPLMHKHWEDIKAYFIKLDIIGSTTFEDHEMHTFSHKYFLPLSKSEISNLIKRFDINKNGRFHYVEFLKQFRLPKPDEMS---LTKFDSYTHKLVDKKSKAVYNLSEIREILRHSMIKKWKNLLSAFKKMDHCKEGLLTIDQINNVLKENKIFLKKDDLYHILTNFDKNMDRKIDYYEFIHEILDI 244          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Planmine SMEST
Match: SMESG000023233.1 (SMESG000023233.1)

HSP 1 Score: 120.939 bits (302), Expect = 6.516e-31
Identity = 68/162 (41.98%), Postives = 98/162 (60.49%), Query Frame = 3
Query:  723 MAQFREALKKLKITLCAEDFIRLWRKFDIKGVGSVSQRQLLWILNLQDNGKPMCGIR-PTFIPLKRPKIERVVRTKPPLKYKNCYELDNQPPQ---PDIRAGGVSFPLIRIPKWKPKGPGGSDEYEFGKGIQFVKGLQKLRDNRPEFSQIMDRLSYIFEEPF 1196
            M Q REAL ++ I L   ++ RLW KFD   VGSV    L  +LNLQDNGKPMCGIR P  I L++ +   + R  PP+   + Y+    P +    +I AGGVSFP+ R+  W P+G GG++E E GKG +++ GL+ L  + P++  + + L YI+ + F
Sbjct:    1 MPQLREALCRIDIRLSDVEYSRLWEKFDKSNVGSVPMSTLFQMLNLQDNGKPMCGIRKPPEIRLRQKQSNAMKR--PPI--TDTYKCLKNPLEDGFKNIGAGGVSFPITRVHGWVPQGMGGTNEPELGKGTRYLAGLKSLMGDHPKYDSVYENLYYIYYKYF 158          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Planmine SMEST
Match: SMESG000023233.1 (SMESG000023233.1)

HSP 1 Score: 119.013 bits (297), Expect = 4.927e-29
Identity = 66/162 (40.74%), Postives = 98/162 (60.49%), Query Frame = 3
Query:  723 MAQFREALKKLKITLCAEDFIRLWRKFDIKGVGSVSQRQLLWILNLQDNGKPMCGIR-PTFIPLKRPKIERVVRTKPPLKYKNCYELDNQPPQ---PDIRAGGVSFPLIRIPKWKPKGPGGSDEYEFGKGIQFVKGLQKLRDNRPEFSQIMDRLSYIFEEPF 1196
            + + REAL ++ I L   ++ RLW KFD   VGSV    L  +LNLQDNGKPMCGIR P  I L++ +   + R  PP+   + Y+    P +    +I AGGVSFP+ R+  W P+G GG++E E GKG +++ GL+ L  + P++  + + L YI+ + F
Sbjct:  106 LRRLREALCRIDIRLSDVEYSRLWEKFDKSNVGSVPMSTLFQMLNLQDNGKPMCGIRKPPEIRLRQKQSNAMKR--PPIT--DTYKCLKNPLEDGFKNIGAGGVSFPITRVHGWVPQGMGGTNEPELGKGTRYLAGLKSLMGDHPKYDSVYENLYYIYYKYF 263          

HSP 2 Score: 55.4546 bits (132), Expect = 8.743e-8
Identity = 27/86 (31.40%), Postives = 47/86 (54.65%), Query Frame = 3
Query:  249 QGLAIFSKKITPRAHGDRMTVDEIDLIIREKFINERFSIQELFKVADEHKNGFVTKEALMKIFYTICDGLKVDHFYKLLERYKLNE 506
            Q L  +  K       +R   DE++LII +K + ER  ++ LF  + ++K+G+VT+  L  I   +C  LK D F  +L++  L++
Sbjct:   12 QDLPSYVTKTRANPFPNRPNQDEVELIISKKMVEERVLVKNLFASSAKNKDGYVTRSELFAILLKLCPNLKFDQFEAILQKCNLDK 97          
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Planmine SMEST
Match: SMESG000023233.1 (SMESG000023233.1)

HSP 1 Score: 119.013 bits (297), Expect = 9.420e-29
Identity = 66/162 (40.74%), Postives = 98/162 (60.49%), Query Frame = 3
Query:  723 MAQFREALKKLKITLCAEDFIRLWRKFDIKGVGSVSQRQLLWILNLQDNGKPMCGIR-PTFIPLKRPKIERVVRTKPPLKYKNCYELDNQPPQ---PDIRAGGVSFPLIRIPKWKPKGPGGSDEYEFGKGIQFVKGLQKLRDNRPEFSQIMDRLSYIFEEPF 1196
            + + REAL ++ I L   ++ RLW KFD   VGSV    L  +LNLQDNGKPMCGIR P  I L++ +   + R  PP+   + Y+    P +    +I AGGVSFP+ R+  W P+G GG++E E GKG +++ GL+ L  + P++  + + L YI+ + F
Sbjct:  139 LRRLREALCRIDIRLSDVEYSRLWEKFDKSNVGSVPMSTLFQMLNLQDNGKPMCGIRKPPEIRLRQKQSNAMKR--PPIT--DTYKCLKNPLEDGFKNIGAGGVSFPITRVHGWVPQGMGGTNEPELGKGTRYLAGLKSLMGDHPKYDSVYENLYYIYYKYF 296          

HSP 2 Score: 76.6406 bits (187), Expect = 1.207e-14
Identity = 44/135 (32.59%), Postives = 72/135 (53.33%), Query Frame = 3
Query:  108 MKTAKIYPTIDRCDRVKGFRD--IDYKPGLNSFRNIAEEEYKYIFPRDQQGLAIFSKKITPRAHGDRMTVDEIDLIIREKFINERFSIQELFKVADEHKNGFVTKEALMKIFYTICDGLKVDHFYKLLERYKLNE 506
            MK  KIY  ++RC    GF D  +DY     ++R+I ++ Y YI P     L  +  K       +R   DE++LII +K + ER  ++ LF  + ++K+G+VT+  L  I   +C  LK D F  +L++  L++
Sbjct:    1 MKNPKIYYPVERC----GFFDENLDYS-TFKTYRDIYDDTYDYIVPPSNNYLPSYVTKTRANPFPNRPNQDEVELIISKKMVEERVLVKNLFASSAKNKDGYVTRSELFAILLKLCPNLKFDQFEAILQKCNLDK 130          
The following BLAST results are available for this feature:
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
EFCAB61.503e-1022.40EF-hand calcium binding domain 6 [Source:HGNC Symb... [more]
EFCAB61.988e-1022.40EF-hand calcium binding domain 6 [Source:HGNC Symb... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-256e7.54.971e-626.42si:dkey-256e7.5 [Source:ZFIN;Acc:ZDB-GENE-090313-2... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
immp2l7.983e-1423.21inner mitochondrial membrane peptidase subunit 2 [... [more]
immp2l8.627e-1423.21inner mitochondrial membrane peptidase subunit 2 [... [more]
immp2l9.431e-1423.21inner mitochondrial membrane peptidase subunit 2 [... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Efcab61.936e-1023.89EF-hand calcium binding domain 6 [Source:MGI Symbo... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q5THR3|EFCB6_HUMAN9.547e-1022.40EF-hand calcium-binding domain-containing protein ... [more]
sp|Q6P1E8|EFCB6_MOUSE1.354e-923.89EF-hand calcium-binding domain-containing protein ... [more]
sp|Q4R8T1|EFCB6_MACFA3.814e-921.86EF-hand calcium-binding domain-containing protein ... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504Y7V11.305e-10331.34EF-hand calcium-binding domain-containing protein ... [more]
A0A4V3SH746.222e-10235.09Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4E0RNG01.295e-9229.94EF-hand calcium-binding domain-containing protein ... [more]
A0A5K3FBQ11.118e-8331.17Uncharacterized protein OS=Mesocestoides corti OX=... [more]
G7YFU61.208e-7728.54EF-hand calcium-binding domain-containing protein ... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000045911.14.725e-1730.68pep primary_assembly:Astyanax_mexicanus-2.0:24:368... [more]
ENSAMXT00000025429.22.649e-640.63pep primary_assembly:Astyanax_mexicanus-2.0:22:220... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000004536.13.368e-1420.45pep scaffold:Pmarinus_7.0:GL477109:94389:131012:-1... [more]
ENSPMAT00000004557.18.063e-1321.13pep scaffold:Pmarinus_7.0:GL477109:94389:108111:-1... [more]
ENSPMAT00000004547.13.762e-1021.37pep scaffold:Pmarinus_7.0:GL477109:94389:129511:-1... [more]
efcab71.222e-639.06EF-hand calcium binding domain 7 [Source:ZFIN;Acc:... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO289431.077e-1727.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368101.599e-1423.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320385.835e-1228.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465486.018e-1227.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465492.429e-833.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand calcium-binding domain-containing protein 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058629.10.000e+0100.00SMESG000058629.1[more]
SMESG000023232.12.470e-4036.67SMESG000023232.1[more]
SMESG000023233.16.516e-3141.98SMESG000023233.1[more]
SMESG000023233.14.927e-2940.74SMESG000023233.1[more]
SMESG000023233.19.420e-2940.74SMESG000023233.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004875 ID=SMED30004875|Name=EF-hand calcium-binding domain-containing protein 6|organism=Schmidtea mediterranea sexual|type=transcript|length=3009bp
CTCTTCCGATCTGAAAAATTTAAAAATTTTCGGAATTATTACGCGGGAAA
ATGTTAAAGCCAACTGACCATTGTATGCCCAATGTAACTCCATCAAAGAC
ATGGGCAATGAAAACAGCTAAGATCTATCCGACAATTGATAGATGTGACC
GTGTCAAGGGATTTCGTGACATTGACTATAAACCCGGGCTTAATTCATTT
CGAAATATCGCCGAAGAAGAATATAAATATATATTTCCTAGAGATCAACA
AGGGTTGGCAATTTTCTCCAAAAAAATCACTCCAAGAGCTCATGGGGATC
GCATGACAGTTGATGAGATAGATCTGATTATTCGAGAGAAATTTATTAAT
GAACGCTTTTCTATTCAAGAACTGTTCAAAGTTGCTGATGAACATAAAAA
CGGATTCGTTACAAAAGAGGCCTTAATGAAAATATTCTACACGATTTGTG
ATGGTTTAAAAGTAGATCATTTTTATAAACTTCTTGAAAGATACAAGTTA
AACGAAAAACCTGTCATAGCATTTTCCGACGTTGAGAAAGTATTCGGGCT
GCCACCAACTGGAAAATATCCAGCCCCACAAATTTTTCATGGCATGGGTC
ATCCATATAATGTATCAGCTGGTTTCGGATTACAATTATTAAGAGAAGCA
GCTCTTGACAAAGATTTTGATTTAAAAGCCTTACTACCTGAAAGTTGTTT
TGAAGAAGGTGGAGTCATACTGATGGCACAGTTTAGGGAAGCCTTGAAAA
AACTCAAAATTACATTATGTGCCGAGGATTTTATTCGATTATGGAGAAAG
TTTGATATTAAAGGTGTTGGCTCAGTTTCCCAAAGACAATTGCTATGGAT
ATTGAATCTACAGGATAATGGTAAACCGATGTGTGGAATACGCCCAACAT
TCATTCCACTAAAACGGCCGAAGATTGAACGAGTTGTTCGAACAAAACCT
CCATTAAAATATAAAAATTGCTACGAATTAGATAACCAACCTCCTCAGCC
GGATATCCGAGCTGGCGGTGTGTCATTTCCACTTATCAGAATTCCTAAAT
GGAAACCGAAGGGACCAGGAGGATCTGACGAATATGAATTTGGAAAGGGA
ATACAATTTGTTAAAGGACTGCAGAAACTCAGAGACAACAGACCAGAATT
CTCTCAGATTATGGATAGATTATCATACATTTTTGAAGAACCTTTTCAAG
CTCTGTTTACCGTATTCAGGCACTACGATACGAAAAACTCTGGATTCGTT
TCTTTAGATACCGGCTTAAAGATACTCAGTGAATACGGATTCGTTATTGA
GATCGAAAACTTGATCAAATTTCTGAACAAAATCAACTGTCTTGATCTGA
ATTCTGGTATGAATTACAAAAGGATGTTAACAGACATTCAAACAAAAGGT
CCTGGAACTTGCGTGAATAAAGTTATTTCTCAAATAATTAAAGCAGAAAG
TCAGTCAACTGGTCTTAAAAGCTTGCGAACAATGTCTGTCGACGAAATTG
AACAGGAAGTATACAAAACTTTACACAAGGACTTCATGAGTTTCCAGAGT
CAACTCGAGCTTCTGCGACTTCGAATTTAATTTGTGAAAATGAAGCCAGA
AAAATCATTGAAAACATAATTGGACATTCCATGACGAAAGAACAATGGAA
AGAATTACAATTTCAATTTGACTATTGCCAGCCGCTTTCAGGAAAAGAGG
AAAAAGATGTCAATCGACTGATTGATTTCAGAAAGTTTCTGAATAAATTT
AGCAAACCGACCGGAATATGCCGATATAGATTTAAATCTGATCTAGACAA
GCCAATTGACTGGAGCAATAGGAATAAAAAAGTTAAAGAATTTTACGACC
CTCCGAGACATCATGCTTACCTATGCCGAATGGTTGCAGATGTGTTAAAA
TTCAGATTTCACGCAATAGATAAACAATACAAATCTTTTCCAATTAAAGA
ACAAGGGACTTTAACAAAACCGATTTTGTTTGAATTACTTAACAGTCAGA
AATGTTCTCTAACCCTTCAAGAAATGGAAATAATATGGGCTGTAGTTGAG
TCTCATCCTCACTATTCCTCCTTGCATTATCGGCAAGTCTTGAAGCATTT
GATGATGAATTTGTATAAGCGCGCTGAGGAAATTAACATTGAAAACCGAG
TAACAACGGCTGAAGATCCAAATATAGAAGTGTTAAAAGAATTTAAGAAA
ACACACAAAGACGATAAATCACAACTATTAGATTATTGTGATAAAAAGAT
TTTCATGGCTCTTTTGAAAAAGGATTTCGTCGTTGACAGTGAAAAACTTC
AGAAAACCGTAGAAAAAATGTCACCGGTACTTGGCTCGATGTGGGTTCCT
ATCAAGAAGCAGTTGAGGCAGATTGATGTTGTTGGAAAAGCAACAATCGA
ATTTTATGAAATGAAAGAATTGTTAATTAAAAACGGTTTCGTTTTAACGC
CAGACGAAATGGAAAATTTACTTTATGCTTTTGATCTAAAACGAAATGGA
AGATTTTATTATATTGAATTTCTTCATGAATTTTTGAAGTTTCGCCCTGA
TGAAGGCACAGCTAAACCGGTTCTTCATTTTGACAGAGTTCGGCATCAAT
TGTTAAATGAGAAAACGGGTGGAAAATTAACAGTCGTGGAAGCATATAAA
GAAATTAGGAAAACTCTTTTAAAGCAGTGGAAATCGCTAATAAGAGCATT
TAGAAAAATTGATACGGATAAAACTGGTAAGATAGATCAAAGTCAATTGA
ATCAAATTCTTTTGAAATCTGGAATTCGCCTTTCTAAAGATGACTTGTAT
CACGTTTTTTCAGGATTTGACACAAATCTTGATGGGAAAATTGACTATAT
AGAATTCATTGAGCAATTGTTAGATGTTTTTGCTCCTTATCCCTCTTGAA
TATTTATGAAATCTTTGTTAAAGAATTAAACTTCATAAGTTATAAGTATA
GATGTTAGATATTGTATATTATTAATAGAAATTTACTTTTCTATGCAAAG
TATTTATTG
back to top

protein sequence of SMED30004875-orf-1

>SMED30004875-orf-1 ID=SMED30004875-orf-1|Name=SMED30004875-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=510bp
MLKPTDHCMPNVTPSKTWAMKTAKIYPTIDRCDRVKGFRDIDYKPGLNSF
RNIAEEEYKYIFPRDQQGLAIFSKKITPRAHGDRMTVDEIDLIIREKFIN
ERFSIQELFKVADEHKNGFVTKEALMKIFYTICDGLKVDHFYKLLERYKL
NEKPVIAFSDVEKVFGLPPTGKYPAPQIFHGMGHPYNVSAGFGLQLLREA
ALDKDFDLKALLPESCFEEGGVILMAQFREALKKLKITLCAEDFIRLWRK
FDIKGVGSVSQRQLLWILNLQDNGKPMCGIRPTFIPLKRPKIERVVRTKP
PLKYKNCYELDNQPPQPDIRAGGVSFPLIRIPKWKPKGPGGSDEYEFGKG
IQFVKGLQKLRDNRPEFSQIMDRLSYIFEEPFQALFTVFRHYDTKNSGFV
SLDTGLKILSEYGFVIEIENLIKFLNKINCLDLNSGMNYKRMLTDIQTKG
PGTCVNKVISQIIKAESQSTGLKSLRTMSVDEIEQEVYKTLHKDFMSFQS
QLELLRLRI*
back to top

protein sequence of SMED30004875-orf-2

>SMED30004875-orf-2 ID=SMED30004875-orf-2|Name=SMED30004875-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=423bp
MTKEQWKELQFQFDYCQPLSGKEEKDVNRLIDFRKFLNKFSKPTGICRYR
FKSDLDKPIDWSNRNKKVKEFYDPPRHHAYLCRMVADVLKFRFHAIDKQY
KSFPIKEQGTLTKPILFELLNSQKCSLTLQEMEIIWAVVESHPHYSSLHY
RQVLKHLMMNLYKRAEEINIENRVTTAEDPNIEVLKEFKKTHKDDKSQLL
DYCDKKIFMALLKKDFVVDSEKLQKTVEKMSPVLGSMWVPIKKQLRQIDV
VGKATIEFYEMKELLIKNGFVLTPDEMENLLYAFDLKRNGRFYYIEFLHE
FLKFRPDEGTAKPVLHFDRVRHQLLNEKTGGKLTVVEAYKEIRKTLLKQW
KSLIRAFRKIDTDKTGKIDQSQLNQILLKSGIRLSKDDLYHVFSGFDTNL
DGKIDYIEFIEQLLDVFAPYPS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR011992EF-hand-dom_pair
IPR002048EF_hand_dom
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 87..164
e-value: 4.1E-6
score: 28.6
NoneNo IPR availablePANTHERPTHR20875FAMILY NOT NAMEDcoord: 83..503
NoneNo IPR availablePANTHERPTHR20875:SF5coord: 83..503
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 380..415
score: 6.647
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 100..135
score: 8.934
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 239..274
score: 6.173
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 93..267
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 366..429