PWWP domain-containing protein

Overview
NamePWWP domain-containing protein
Smed IDSMED30004856
Length (bp)1933
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PWWP domain-containing protein (SMED30004856) t-SNE clustered cells

Violin plots show distribution of expression levels for PWWP domain-containing protein (SMED30004856) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PWWP domain-containing protein (SMED30004856) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PWWP domain-containing protein (SMED30004856) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004856

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30004856SMESG000068720.1 dd_Smed_v4_8454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004856SMESG000068720.1 dd_Smed_v4_8454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30004856SMESG000068720.1 dd_Smed_v4_8454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30004856SMESG000068720.1 dd_Smed_v4_8454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004856SMESG000068720.1 dd_Smed_v4_8454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PWWP domain-containing protein vs. Ensembl Human
Match: PWWP2A (PWWP domain containing 2A [Source:HGNC Symbol;Acc:HGNC:29406])

HSP 1 Score: 68.1662 bits (165), Expect = 3.540e-11
Identity = 39/109 (35.78%), Postives = 57/109 (52.29%), Query Frame = 2
Query:  359 KCKLSD-REFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKN---KKYFEAVNEAKQLTEE 673
            KC   D R   + DIVWAKI G+P+WP++IL+I  S+K        + ++    A + W      S++  + LS F  +F ++F+ K K    K   EA   AKQLT E
Sbjct:  644 KCVTPDGRTICVGDIVWAKIYGFPWWPARILTITVSRK-------DNGLLVRQEARISWFGSPTTSFLALSQLSPFLENFQSRFNKKRKGLYRKAITEAAKAAKQLTPE 745          
BLAST of PWWP domain-containing protein vs. Ensembl Human
Match: PWWP2B (PWWP domain containing 2B [Source:HGNC Symbol;Acc:HGNC:25150])

HSP 1 Score: 60.077 bits (144), Expect = 8.998e-9
Identity = 37/118 (31.36%), Postives = 59/118 (50.00%), Query Frame = 2
Query:  332 LNFNQQPLIKCKLSD-REFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKN---KKYFEAVNEAKQLTEE 673
            +  + Q + +C   D R  A+ DIVW KI G+P+WP+++L I+  QK     + + +  E   A V W      S+++ + LS F   F  +F+ K K    K   EA N A+ +  E
Sbjct:  470 VRLHTQSVSECITEDGRTVAVGDIVWGKIHGFPWWPARVLDISLGQK----EDGEPSWRE---AKVSWFGSPTTSFLSISKLSPFSEFFKLRFNRKKKGMYRKAITEAANAARHVAPE 580          
BLAST of PWWP domain-containing protein vs. Ensembl Zebrafish
Match: CU855895.3 (pep chromosome:GRCz11:21:30025031:30030644:-1 gene:ENSDARG00000114922.1 transcript:ENSDART00000190810.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CU855895.3)

HSP 1 Score: 67.0106 bits (162), Expect = 2.769e-12
Identity = 39/111 (35.14%), Postives = 56/111 (50.45%), Query Frame = 2
Query:  353 LIKC-KLSDREFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKN---KKYFEAVNEAKQLTEE 673
            + KC  L  R   + DIVWAKI G+P+WP++IL+I  S+K        + ++    A V W      S++    L+ F  +F ++F  K K    K   EA   AKQLT E
Sbjct:   81 VTKCVALDGRTICVGDIVWAKILGFPWWPARILAITVSRK-------DNGLLVRQEARVSWFGSPTTSFLAITQLAPFLENFQSRFDKKRKGLYRKAITEAAKAAKQLTPE 184          
BLAST of PWWP domain-containing protein vs. Ensembl Zebrafish
Match: pwwp2b (PWWP domain containing 2B [Source:ZFIN;Acc:ZDB-GENE-110930-2])

HSP 1 Score: 55.8398 bits (133), Expect = 1.348e-7
Identity = 33/111 (29.73%), Postives = 56/111 (50.45%), Query Frame = 2
Query:  332 LNFNQQPLIKCKLSD-REFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKNKKYFEAVNEAKQ 661
            +  + + + KC   D     + D+VW KI G+P+WP++ILSI+ +++  +     +   E   A V W      S ++ A LS F   F ++F+ K K   Y  A+ EA +
Sbjct:  475 VRLHTRSMSKCVTEDGHAVTVGDVVWGKIHGFPWWPARILSISGTRR--EDGEVDAPWPE---AKVSWFGSPTTSELSVAKLSPFREFFRSRFNRK-KKGMYRRAIMEAAK 579          
BLAST of PWWP domain-containing protein vs. Ensembl Xenopus
Match: PWWP2A (PWWP domain containing 2A [Source:NCBI gene;Acc:100145656])

HSP 1 Score: 67.3958 bits (163), Expect = 5.692e-11
Identity = 38/109 (34.86%), Postives = 57/109 (52.29%), Query Frame = 2
Query:  359 KCKLSD-REFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKN---KKYFEAVNEAKQLTEE 673
            KC   D R   + DIVWAKI G+P+WP++IL+I  S+K        + ++    A + W      S++  + L+ F  +F ++F+ K K    K   EA   AKQLT E
Sbjct:  676 KCVTPDGRTICVGDIVWAKIYGFPWWPARILAITVSRK-------DTGLLVRQEARISWFGSPTTSFLALSQLTPFLENFQSRFNKKRKGLYRKAITEAAKAAKQLTPE 777          
BLAST of PWWP domain-containing protein vs. Ensembl Mouse
Match: Pwwp2a (PWWP domain containing 2A [Source:MGI Symbol;Acc:MGI:1918052])

HSP 1 Score: 65.4698 bits (158), Expect = 1.482e-10
Identity = 39/109 (35.78%), Postives = 56/109 (51.38%), Query Frame = 2
Query:  359 KCKLSD-REFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKN---KKYFEAVNEAKQLTEE 673
            KC   D R   + DIVWAKI G+P+WP++IL+I  S+K        + ++    A + W A    S +  + LS F  +F  +F+ K K    +   EA   AKQLT E
Sbjct:  619 KCITPDGRTICVGDIVWAKIYGFPWWPARILTITVSRK-------DNGLLARQEARISWFASPTTSSLALSQLSPFLENFQLRFNKKRKGLYRRAITEAAKAAKQLTPE 720          
BLAST of PWWP domain-containing protein vs. Ensembl Mouse
Match: Pwwp2a (PWWP domain containing 2A [Source:MGI Symbol;Acc:MGI:1918052])

HSP 1 Score: 63.929 bits (154), Expect = 2.923e-10
Identity = 39/109 (35.78%), Postives = 56/109 (51.38%), Query Frame = 2
Query:  359 KCKLSD-REFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKN---KKYFEAVNEAKQLTEE 673
            KC   D R   + DIVWAKI G+P+WP++IL+I  S+K        + ++    A + W A    S +  + LS F  +F  +F+ K K    +   EA   AKQLT E
Sbjct:  344 KCITPDGRTICVGDIVWAKIYGFPWWPARILTITVSRK-------DNGLLARQEARISWFASPTTSSLALSQLSPFLENFQLRFNKKRKGLYRRAITEAAKAAKQLTPE 445          
BLAST of PWWP domain-containing protein vs. Ensembl Mouse
Match: Pwwp2b (PWWP domain containing 2B [Source:MGI Symbol;Acc:MGI:2142008])

HSP 1 Score: 63.5438 bits (153), Expect = 5.222e-10
Identity = 38/121 (31.40%), Postives = 61/121 (50.41%), Query Frame = 2
Query:  332 LNFNQQPLIKCKLSD-REFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKNKKYFEAVNEAKQLTEENITRIR 691
            +  + Q + +C   D R  A+ DIVW KI G+P+WP+++L I+  QK     + + +  E   A V W      S+++ + LS F   F  +F+ K K   Y +A+ EA   T+     IR
Sbjct:  480 VRLHTQSVSRCVTEDGRTVAVGDIVWGKIHGFPWWPARVLDISLGQK----EDGEPSWQE---AKVSWFGSPTTSFLSISKLSPFSEFFKLRFNRK-KKGMYRKAITEAANATQHVAPEIR 592          
BLAST of PWWP domain-containing protein vs. Ensembl Mouse
Match: Pwwp2b (PWWP domain containing 2B [Source:MGI Symbol;Acc:MGI:2142008])

HSP 1 Score: 63.5438 bits (153), Expect = 5.222e-10
Identity = 38/121 (31.40%), Postives = 61/121 (50.41%), Query Frame = 2
Query:  332 LNFNQQPLIKCKLSD-REFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKNKKYFEAVNEAKQLTEENITRIR 691
            +  + Q + +C   D R  A+ DIVW KI G+P+WP+++L I+  QK     + + +  E   A V W      S+++ + LS F   F  +F+ K K   Y +A+ EA   T+     IR
Sbjct:  480 VRLHTQSVSRCVTEDGRTVAVGDIVWGKIHGFPWWPARVLDISLGQK----EDGEPSWQE---AKVSWFGSPTTSFLSISKLSPFSEFFKLRFNRK-KKGMYRKAITEAANATQHVAPEIR 592          
BLAST of PWWP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96N64|PWP2A_HUMAN (PWWP domain-containing protein 2A OS=Homo sapiens OX=9606 GN=PWWP2A PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 1.700e-10
Identity = 39/109 (35.78%), Postives = 57/109 (52.29%), Query Frame = 2
Query:  359 KCKLSD-REFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKN---KKYFEAVNEAKQLTEE 673
            KC   D R   + DIVWAKI G+P+WP++IL+I  S+K        + ++    A + W      S++  + LS F  +F ++F+ K K    K   EA   AKQLT E
Sbjct:  644 KCVTPDGRTICVGDIVWAKIYGFPWWPARILTITVSRK-------DNGLLVRQEARISWFGSPTTSFLALSQLSPFLENFQSRFNKKRKGLYRKAITEAAKAAKQLTPE 745          
BLAST of PWWP domain-containing protein vs. UniProt/SwissProt
Match: sp|F7AQ22|PWP2A_XENTR (PWWP domain-containing protein 2A OS=Xenopus tropicalis OX=8364 GN=pwwp2a PE=2 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 3.252e-10
Identity = 38/109 (34.86%), Postives = 57/109 (52.29%), Query Frame = 2
Query:  359 KCKLSD-REFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKN---KKYFEAVNEAKQLTEE 673
            KC   D R   + DIVWAKI G+P+WP++IL+I  S+K        + ++    A + W      S++  + L+ F  +F ++F+ K K    K   EA   AKQLT E
Sbjct:  673 KCVTPDGRTICVGDIVWAKIYGFPWWPARILAITVSRK-------DTGLLVRQEARISWFGSPTTSFLALSQLTPFLENFQSRFNKKRKGLYRKAITEAAKAAKQLTPE 774          
BLAST of PWWP domain-containing protein vs. UniProt/SwissProt
Match: sp|A0A1L8GR68|PWP2A_XENLA (PWWP domain-containing protein 2A OS=Xenopus laevis OX=8355 GN=pwwp2a PE=3 SV=2)

HSP 1 Score: 66.2402 bits (160), Expect = 6.878e-10
Identity = 38/109 (34.86%), Postives = 57/109 (52.29%), Query Frame = 2
Query:  359 KCKLSD-REFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKN---KKYFEAVNEAKQLTEE 673
            KC   D R   + DIVWAKI G+P+WP++IL+I  S+K        + ++    A + W      S++  + L+ F  +F ++F+ K K    K   EA   AKQLT E
Sbjct:  673 KCVTPDGRTICVGDIVWAKIYGFPWWPARILAITISRK-------DNGLLIRQEARISWFGSPTTSFLALSQLAPFLENFQSRFNKKRKGLYRKAITEAAKAAKQLTPE 774          
BLAST of PWWP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q69Z61|PWP2A_MOUSE (PWWP domain-containing protein 2A OS=Mus musculus OX=10090 GN=Pwwp2a PE=2 SV=2)

HSP 1 Score: 65.4698 bits (158), Expect = 1.037e-9
Identity = 39/109 (35.78%), Postives = 56/109 (51.38%), Query Frame = 2
Query:  359 KCKLSD-REFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKN---KKYFEAVNEAKQLTEE 673
            KC   D R   + DIVWAKI G+P+WP++IL+I  S+K        + ++    A + W A    S +  + LS F  +F  +F+ K K    +   EA   AKQLT E
Sbjct:  619 KCITPDGRTICVGDIVWAKIYGFPWWPARILTITVSRK-------DNGLLARQEARISWFASPTTSSLALSQLSPFLENFQLRFNKKRKGLYRRAITEAAKAAKQLTPE 720          
BLAST of PWWP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6NUJ5|PWP2B_HUMAN (PWWP domain-containing protein 2B OS=Homo sapiens OX=9606 GN=PWWP2B PE=1 SV=3)

HSP 1 Score: 60.077 bits (144), Expect = 4.321e-8
Identity = 37/118 (31.36%), Postives = 59/118 (50.00%), Query Frame = 2
Query:  332 LNFNQQPLIKCKLSD-REFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKN---KKYFEAVNEAKQLTEE 673
            +  + Q + +C   D R  A+ DIVW KI G+P+WP+++L I+  QK     + + +  E   A V W      S+++ + LS F   F  +F+ K K    K   EA N A+ +  E
Sbjct:  470 VRLHTQSVSECITEDGRTVAVGDIVWGKIHGFPWWPARVLDISLGQK----EDGEPSWRE---AKVSWFGSPTTSFLSISKLSPFSEFFKLRFNRKKKGMYRKAITEAANAARHVAPE 580          
BLAST of PWWP domain-containing protein vs. TrEMBL
Match: A0A3P8J9P6 (PWWP domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS10429 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.903e-14
Identity = 44/121 (36.36%), Postives = 72/121 (59.50%), Query Frame = 2
Query:  350 PLIK-CKLSDRE-FAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEE-----------YIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKNKKYFEAVNEAKQLTEE 673
            PL+K CKL+D   F + D+VW+K+SG+P+WP++I SI R     +P++ +   + +           ++AC+ W A+ Q+SY+ C  L HF ++   +F  K K   + +AVNEAKQ  E+
Sbjct:  718 PLVKRCKLADDVVFRVGDLVWSKLSGWPYWPAQITSIQRIGSEVEPSSLEKEPVTKDSHEKISEQVCFVACLHWFAWHQVSYMPCDKLYHF-LEHCKRFDNKKKRGVFRQAVNEAKQAAEK 837          
BLAST of PWWP domain-containing protein vs. TrEMBL
Match: A0A183WE76 (PWWP domain-containing protein OS=Trichobilharzia regenti OX=157069 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.903e-14
Identity = 44/121 (36.36%), Postives = 72/121 (59.50%), Query Frame = 2
Query:  350 PLIK-CKLSDRE-FAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEE-----------YIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKNKKYFEAVNEAKQLTEE 673
            PL+K CKL+D   F + D+VW+K+SG+P+WP++I SI R     +P++ +   + +           ++AC+ W A+ Q+SY+ C  L HF ++   +F  K K   + +AVNEAKQ  E+
Sbjct:  718 PLVKRCKLADDVVFRVGDLVWSKLSGWPYWPAQITSIQRIGSEVEPSSLEKEPVTKDSHEKISEQVCFVACLHWFAWHQVSYMPCDKLYHF-LEHCKRFDNKKKRGVFRQAVNEAKQAAEK 837          
BLAST of PWWP domain-containing protein vs. TrEMBL
Match: A0A0R3VSI9 (PWWP domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS132 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.549e-13
Identity = 101/354 (28.53%), Postives = 148/354 (41.81%), Query Frame = 2
Query:  152 PLNRKTRT----KKSKLLHVDDHSESSSEFNPPLKLKLIRDQS--DP---KTF-------KSIQIIN------DFSQASDYYLNFNQQPLIKCKLSDREFAINDIVWAKISGYPFWPSKI--LSINRSQKCAQ--PNNCKS------------AVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKNKKYFEAVNEAKQLTEENITRIRLFSSNDT-INNHKQVDSVHSCETLEGETS-STLPSHNFTSPESNQSLQSCCLSRPTGVMS-DPLSNQSDRSSHSNIEFPHTSDSQISISIPLLKSKFEAEKLAAPTH-WD-LPDLGSNLDFESNNHIPEFSDYEDE 1084
            P++RK ++    K  +   V   S SS+     LK++L RD S  +P   K F       KS+Q+        D           N    +    +   F + D+VWAK++GYP+WPS+I  L      + AQ  P N  S            A+   + A VEW A++Q SY++CA L  F   F   +S + + K Y EAVN AK + E      RL S   + I          S  T  G ++ S  P  +F     N+  QS  L  P   ++ DP++ Q    S   +E  H S   +  +          +   AP   W  LP L  +   E N+ +P FS+ EDE
Sbjct:  241 PVSRKRQSRLDSKARENCSVPQPSTSSAFLTGGLKIRLRRDVSVDEPICGKKFRSRKSNQKSVQVFRIVESWCDADAPGGLAAKSNAVSPMSTNQTSGGFRVGDVVWAKLAGYPYWPSRISALYARTPHQLAQVSPENANSDSLAVSATPADPALAPGFTAKVEWFAWNQCSYLSCAKLFPFMEYFAKLYSPRTRVKNYAEAVNMAKLVVEGGSNETRLISEPQSDIKKGSSASLSLSNNTEHGRSNLSCPPDLHFAFNPLNEPKQSDVLRLPDLRLAFDPVNPQLPVGSQVPVENGHFSFLNLGAN--------SGDFCQAPDQCWGPLPQLDVSGLNEFNSGVPTFSEDEDE 586          
BLAST of PWWP domain-containing protein vs. TrEMBL
Match: A0A504YUG3 (PWWP domain-containing protein 2A OS=Fasciola gigantica OX=46835 GN=FGIG_02827 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.393e-13
Identity = 51/139 (36.69%), Postives = 76/139 (54.68%), Query Frame = 2
Query:  359 KCKLSDRE-FAINDIVWAKISGYPFWPSKILSINRS--------QKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKNKKYFEAVNEAKQLTEENITRIRLFSSNDTINNHKQVDSVHS 748
            +CKL D   F + D+VW+K+SG+P+WP++I SI++S            Q  + KS V   Y AC+ W A+ Q+SY+ C  L HF   +  +F  K K   + +AVNEA Q  +E    I   S  D+   ++ VD +HS
Sbjct:  801 RCKLPDGVVFRVGDLVWSKLSGWPYWPAQITSIHQSVVDEQEINPDVIQQPDTKSIV---YTACLHWFAWHQVSYMTCDKLYHFMQHY-RRFDNKRKRGVFRQAVNEACQAADEKRNEISSSSDADSGLENENVD-IHS 934          
BLAST of PWWP domain-containing protein vs. TrEMBL
Match: A0A4E0RA01 (PWWP domain-containing protein 2A OS=Fasciola hepatica OX=6192 GN=D915_006020 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.653e-13
Identity = 49/135 (36.30%), Postives = 74/135 (54.81%), Query Frame = 2
Query:  359 KCKLSDRE-FAINDIVWAKISGYPFWPSKILSINRS--------QKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKNKKYFEAVNEAKQLTEENITRIRLFSSNDTINNHKQVD 736
            +CKL D   F + D+VW+K+SG+P+WP++I SI++S            Q ++ KS V   Y AC+ W A+ Q+SY+ C  L HF   +  +F  K K   + +AVNEA Q  +E    I   S  D+   ++ VD
Sbjct:  801 RCKLPDGVVFRVGDLVWSKLSGWPYWPAQITSIHQSVVDEQEINPDVIQQSDTKSIV---YTACLHWFAWHQVSYMTCDKLYHFMQHY-RRFDNKRKRGVFRQAVNEACQAADEKRNEISSSSDADSGLENENVD 931          
BLAST of PWWP domain-containing protein vs. Ensembl Cavefish
Match: pwwp2a (PWWP domain containing 2A [Source:NCBI gene;Acc:103027727])

HSP 1 Score: 68.1662 bits (165), Expect = 1.825e-11
Identity = 39/109 (35.78%), Postives = 55/109 (50.46%), Query Frame = 2
Query:  359 KC-KLSDREFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKN---KKYFEAVNEAKQLTEE 673
            KC  L  R   + DIVWAKI G+P+WP++IL+I  S+K        + ++    A V W      S++    L+ F  +F ++F  K K    K   EA   AKQLT E
Sbjct:  912 KCVALDGRTICVGDIVWAKILGFPWWPARILAITVSRK-------DNGLLVRQEARVSWFGSPTTSFLAITQLAPFLENFQSRFDKKRKGLYRKAITEAAKAAKQLTPE 1013          
BLAST of PWWP domain-containing protein vs. Ensembl Cavefish
Match: pwwp2b (PWWP domain containing 2B [Source:ZFIN;Acc:ZDB-GENE-110930-2])

HSP 1 Score: 54.6842 bits (130), Expect = 2.326e-7
Identity = 33/102 (32.35%), Postives = 49/102 (48.04%), Query Frame = 2
Query:  383 FAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKNKKYFEAVNEAKQLTEENITRI 688
              + D+VW KI G+P+WP+++LSIN S++        +   E   A V W      S ++ A LS F   F  +F+ K K   Y  A+ EA +      T I
Sbjct:  478 VTVGDVVWGKIHGFPWWPARVLSINGSRR--DEGEMDAPWPE---AKVSWFGSPTTSQLSVAKLSPFREFFRLRFNRK-KKGMYRRAIIEAAKAVGHMSTEI 573          
BLAST of PWWP domain-containing protein vs. Ensembl Sea Lamprey
Match: pwwp2b (PWWP domain containing 2B [Source:ZFIN;Acc:ZDB-GENE-110930-2])

HSP 1 Score: 60.4622 bits (145), Expect = 6.310e-10
Identity = 31/108 (28.70%), Postives = 50/108 (46.30%), Query Frame = 2
Query:  374 DREFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKNKKYFEAVNEAKQLTEENITRIRLF 697
             R+  + D+VWAKI G+P+WP+ +L ++       P        E   A V W      S V+ A L+ F   F  +   K K  +Y +AV EA + T+     ++ +
Sbjct:  378 GRKVHVGDVVWAKIHGFPWWPACVLGLS-------PELGPGGQQESGEALVSWFGSHTTSAVSLAKLAPFQESFRARLDRKRKG-RYRQAVAEAARATKRLTAEVKAW 477          
BLAST of PWWP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001585.1 (pep scaffold:Pmarinus_7.0:GL478812:497860:498661:1 gene:ENSPMAG00000001433.1 transcript:ENSPMAT00000001585.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 2.231e-7
Identity = 26/101 (25.74%), Postives = 52/101 (51.49%), Query Frame = 2
Query:  389 INDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKNKKYFEAVNEAKQLTEENITRIR 691
            + DIVWAK+ G P+WP+++ S++ S +       +S ++    A + W      S++  +    F  +F+ ++S + K+  Y  AV+EA + +      +R
Sbjct:   26 VGDIVWAKLHGCPWWPAQVRSVSVSVQ------EESGLVLSQEAKMAWFGSTTTSFLPLSQAVPFMENFEARYSRRKKSNGYRRAVSEAAEASRRLTPEVR 120          
BLAST of PWWP domain-containing protein vs. Ensembl Medaka
Match: pwwp2b (PWWP domain containing 2B [Source:NCBI gene;Acc:101155875])

HSP 1 Score: 63.5438 bits (153), Expect = 4.776e-10
Identity = 37/129 (28.68%), Postives = 65/129 (50.39%), Query Frame = 2
Query:  278 TFKSIQIINDFSQASDYYLNFNQQPLIKCKLSD-REFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKNKKYFEAVNEAKQ 661
            T  S+   +D        +  + + + KC   +    A+ DIVW KI G+P+WP+++LSI+ ++K   P +C++   +  +A   W      S ++ A LS F   F ++F+ K K   Y  A+ EA +
Sbjct:  485 TSSSVTPQDDCKTVPPLTVRLHTRSMTKCVTEEGHAVAVGDIVWGKIHGFPWWPARVLSISGTRKQEMP-SCEAQWPQAKVA---WFGSPTTSQLSVAKLSPFRELFRSRFNRK-KKGMYRRAILEAAK 608          
BLAST of PWWP domain-containing protein vs. Planmine SMEST
Match: SMESG000068720.1 (SMESG000068720.1)

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 364/366 (99.45%), Postives = 366/366 (100.00%), Query Frame = 2
Query:   41 MDVYDFSERDDQSNXXXXXXXXXXXXXXDSTLVTKIRPLNRKTRTKKSKLLHVDDHSESSSEFNPPLKLKLIRDQSDPKTFKSIQIINDFSQASDYYLNFNQQPLIKCKLSDREFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKNKKYFEAVNEAKQLTEENITRIRLFSSNDTINNHKQVDSVHSCETLEGETSSTLPSHNFTSPESNQSLQSCCLSRPTGVMSDPLSNQSDRSSHSNIEFPHTSDSQISISIPLLKSKFEAEKLAAPTHWDLPDLGSNLDFESNNHIPEFSDYEDEFESIDIEKIKFLVDVENN 1138
            MDVYDFSERDDQSNIQSKNIKHKKRKIKDSTLVTKIRPLNRKTRTKKSKLLHVDDHSESSSEFNPPLKLKLIRDQSDPKTFKSIQIINDFSQASDYYLNFNQQPLIKCKLSDREFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKNKKYFEAVNEAKQLTEENITRI+LFSSNDTINNHKQVDSVHSCETLEGETSSTLPSHNFTSPESNQSLQSCCLSRPTG+MSDPLSNQSDRSSHSNIEFPHTSDSQISISIPLLKSKFEAEKLAAPTHWDLPDLGSNLDFESNNHIPEFSDYEDEFESIDIEKIKFLVDVENN
Sbjct:    1 MDVYDFSERDDQSNIQSKNIKHKKRKIKDSTLVTKIRPLNRKTRTKKSKLLHVDDHSESSSEFNPPLKLKLIRDQSDPKTFKSIQIINDFSQASDYYLNFNQQPLIKCKLSDREFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKNKKYFEAVNEAKQLTEENITRIKLFSSNDTINNHKQVDSVHSCETLEGETSSTLPSHNFTSPESNQSLQSCCLSRPTGIMSDPLSNQSDRSSHSNIEFPHTSDSQISISIPLLKSKFEAEKLAAPTHWDLPDLGSNLDFESNNHIPEFSDYEDEFESIDIEKIKFLVDVENN 366          
BLAST of PWWP domain-containing protein vs. Planmine SMEST
Match: SMESG000059612.1 (SMESG000059612.1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.073e-17
Identity = 37/92 (40.22%), Postives = 58/92 (63.04%), Query Frame = 2
Query:  383 FAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKNKKYFEAVNEAK 658
            F ++D+VWAKI+GYPFWP+KI+S ++ +             + +I C+EW A+++IS++   NL HF  +F  K+  + +N KY EAV  AK
Sbjct:  518 FNLSDVVWAKITGYPFWPAKIISFSQEE-------------DTFIGCIEWYAWNEISFIKVNNLHHFSTNFPTKYQKRYRNGKYQEAVKLAK 596          
BLAST of PWWP domain-containing protein vs. Planmine SMEST
Match: SMESG000031464.1 (SMESG000031464.1)

HSP 1 Score: 68.5514 bits (166), Expect = 7.749e-12
Identity = 36/93 (38.71%), Postives = 53/93 (56.99%), Query Frame = 2
Query:  380 EFAINDIVWAKISGYPFWPSKILSI-NRSQKCAQPNNCKSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKNKKYFEAVNEA 655
            +F+IN+IVWAKI GYPFWP+ I S  N S   +Q   C+          + W+ ++Q S++   +L HF   F  K+S K K++KY  A+  A
Sbjct:  324 KFSINNIVWAKIPGYPFWPAHIKSFDNVSASKSQGKRCR----------INWIGWNQKSFLPLKSLLHFEEHFKMKYSAKFKSQKYKTAIELA 406          
BLAST of PWWP domain-containing protein vs. Planmine SMEST
Match: SMESG000027963.1 (SMESG000027963.1)

HSP 1 Score: 53.5286 bits (127), Expect = 3.626e-7
Identity = 44/146 (30.14%), Postives = 69/146 (47.26%), Query Frame = 2
Query:  242 KLKLIRDQSDPKTFKSIQIINDFSQASDYY--LNFNQQPLIKCKLSDR----EFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNCKSAVIEEYIACVEWLAYD-QISYVNCANLSHFHIDFDNKFSTKIKNKKYFEAVNEAK 658
            KLK++++ S P  +    II    + S+     + N  P+ K     R    +F+I D+VWAK+SGY  WP+K++ ++       PNN  + V+        WL  D + S +    L  F   F  KF+ K K   Y  AV +A+
Sbjct:  284 KLKIVKNGSKPNCY----IIKPAEKISNTTNPKSVNDIPICKINTKSRYNCKKFSIGDVVWAKLSGYSIWPAKVIDLD-------PNNDNATVM--------WLGDDYRTSQLARYKLWDFRAHFQEKFNKKGKG-NYMAAVQQAQ 409          
The following BLAST results are available for this feature:
BLAST of PWWP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PWWP2A3.540e-1135.78PWWP domain containing 2A [Source:HGNC Symbol;Acc:... [more]
PWWP2B8.998e-931.36PWWP domain containing 2B [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of PWWP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PWWP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PWWP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CU855895.32.769e-1235.14pep chromosome:GRCz11:21:30025031:30030644:-1 gene... [more]
pwwp2b1.348e-729.73PWWP domain containing 2B [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of PWWP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PWWP2A5.692e-1134.86PWWP domain containing 2A [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of PWWP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Pwwp2a1.482e-1035.78PWWP domain containing 2A [Source:MGI Symbol;Acc:M... [more]
Pwwp2a2.923e-1035.78PWWP domain containing 2A [Source:MGI Symbol;Acc:M... [more]
Pwwp2b5.222e-1031.40PWWP domain containing 2B [Source:MGI Symbol;Acc:M... [more]
Pwwp2b5.222e-1031.40PWWP domain containing 2B [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of PWWP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96N64|PWP2A_HUMAN1.700e-1035.78PWWP domain-containing protein 2A OS=Homo sapiens ... [more]
sp|F7AQ22|PWP2A_XENTR3.252e-1034.86PWWP domain-containing protein 2A OS=Xenopus tropi... [more]
sp|A0A1L8GR68|PWP2A_XENLA6.878e-1034.86PWWP domain-containing protein 2A OS=Xenopus laevi... [more]
sp|Q69Z61|PWP2A_MOUSE1.037e-935.78PWWP domain-containing protein 2A OS=Mus musculus ... [more]
sp|Q6NUJ5|PWP2B_HUMAN4.321e-831.36PWWP domain-containing protein 2B OS=Homo sapiens ... [more]
back to top
BLAST of PWWP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P8J9P61.903e-1436.36PWWP domain-containing protein OS=Trichobilharzia ... [more]
A0A183WE761.903e-1436.36PWWP domain-containing protein OS=Trichobilharzia ... [more]
A0A0R3VSI91.549e-1328.53PWWP domain-containing protein OS=Taenia asiatica ... [more]
A0A504YUG32.393e-1336.69PWWP domain-containing protein 2A OS=Fasciola giga... [more]
A0A4E0RA012.653e-1336.30PWWP domain-containing protein 2A OS=Fasciola hepa... [more]
back to top
BLAST of PWWP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pwwp2a1.825e-1135.78PWWP domain containing 2A [Source:NCBI gene;Acc:10... [more]
pwwp2b2.326e-732.35PWWP domain containing 2B [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of PWWP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pwwp2b6.310e-1028.70PWWP domain containing 2B [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000001585.12.231e-725.74pep scaffold:Pmarinus_7.0:GL478812:497860:498661:1... [more]
back to top
BLAST of PWWP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PWWP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PWWP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pwwp2b4.776e-1028.68PWWP domain containing 2B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of PWWP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000068720.10.000e+099.45SMESG000068720.1[more]
SMESG000059612.11.073e-1740.22SMESG000059612.1[more]
SMESG000031464.17.749e-1238.71SMESG000031464.1[more]
SMESG000027963.13.626e-730.14SMESG000027963.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004856 ID=SMED30004856|Name=PWWP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1933bp
CTTATATGACAAAAATGAATGTCTAAATTGTTGACTGAAAATGGATGTTT
ACGACTTTTCAGAGCGTGACGATCAGTCAAATATTCAAAGTAAAAATATA
AAGCATAAAAAGAGAAAAATTAAGGATAGTACACTTGTAACTAAAATACG
ACCACTAAATCGGAAAACTCGAACTAAAAAGTCAAAACTTCTTCATGTTG
ACGACCATTCAGAAAGCAGTTCTGAATTTAATCCACCTCTCAAATTAAAA
CTAATTCGTGATCAAAGTGATCCGAAAACCTTTAAATCGATACAAATTAT
TAATGATTTTTCTCAAGCTTCTGATTATTATTTAAACTTTAATCAGCAAC
CACTAATCAAATGTAAATTATCGGACAGAGAATTTGCCATTAATGATATT
GTTTGGGCAAAAATCAGCGGATATCCATTTTGGCCTTCTAAAATACTATC
AATAAATCGATCACAAAAATGTGCTCAACCAAATAATTGTAAATCAGCAG
TGATCGAAGAATATATTGCCTGCGTTGAATGGCTCGCGTATGATCAAATA
TCTTATGTTAACTGTGCCAATCTTTCACATTTTCATATTGATTTCGATAA
TAAATTCAGCACTAAAATAAAAAATAAGAAATATTTTGAAGCTGTTAATG
AAGCTAAACAGTTAACCGAAGAAAACATAACTAGAATAAGATTATTTTCT
TCAAATGATACCATTAATAATCACAAACAAGTGGACAGTGTTCATTCATG
TGAAACCCTTGAAGGGGAAACAAGCAGTACTTTGCCGAGTCATAATTTTA
CCAGCCCAGAGAGTAATCAATCTCTACAATCCTGCTGCCTTTCTCGACCA
ACCGGGGTAATGTCTGATCCGTTATCCAATCAATCAGATCGTTCATCCCA
TAGTAACATTGAATTTCCTCACACCTCCGATTCTCAAATTTCAATTTCTA
TTCCTTTATTAAAATCAAAGTTTGAAGCCGAAAAATTAGCTGCTCCGACA
CATTGGGATTTACCTGATTTAGGGAGCAATTTAGATTTTGAAAGTAACAA
CCACATTCCGGAATTTTCTGATTACGAAGACGAATTTGAAAGTATTGATA
TTGAAAAAATCAAATTTCTAGTAGACGTGGAAAATAATTAGAAAAAATTT
CAAAAAATGTGGTTTCAATTTAAAGTAATTTGTTCATAAAAATTGGTATT
GATTCGGCTTTGCCTTATTAATATCTGTTTTCTTTGCGTTGTAATGGGGG
ATTTGCTTGTTTTCATTTTCAACTTTGCCCTTTCAGATGATTATTTGTTA
AGATGGTTATTAATTTTCCTCAGAATTTCTTCAAGTGATTTCAAAATAGC
ACTATTGTATCTGTTATCAGATTATAAAAAATCAATTTATTTCAATGCAC
TTTCTATTAAAAATTCAATTACAAATTTAATCAATATTCGTATTAGAATG
TTTGAATTATCCTCGGTAAATTATCTTAATTTCTTTCTTATTATATAAAA
TATAGTCATAATGAATTATTTTAACAGGAAAATTTTGGCAGGATTTGTTT
TGACGGCATAATTATCTATTTTACACTGTGTGTACTGTATTTATGAATTT
TGTACATTTGCTCTACTGATTGTGATTTGGCGCATTTGTGTGTTTGTAAT
TCATTTTCTTAATGTAATGTTATTATTTAAAATACCTGACAGATGTTTGT
GTATATAAATAGGTTTTGCATAAAACAAGTGGTCGTTTATGCGACATGTT
TTCATGGGGATTGTGTTAAATTCGTCAATATTTTTTACACAAAATGCTTT
TTATAAGTTTCGATATGCTGTTTTTTATTATTACAACTCACCTTGTAAAT
AAGTTGATGCATCTATAATAAATAACGATTTGGTATATTAATAGTAATTT
TCCTGATTGTTTTAAATTTGCATTATTTTTTGT
back to top

protein sequence of SMED30004856-orf-1

>SMED30004856-orf-1 ID=SMED30004856-orf-1|Name=SMED30004856-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=367bp
MDVYDFSERDDQSNIQSKNIKHKKRKIKDSTLVTKIRPLNRKTRTKKSKL
LHVDDHSESSSEFNPPLKLKLIRDQSDPKTFKSIQIINDFSQASDYYLNF
NQQPLIKCKLSDREFAINDIVWAKISGYPFWPSKILSINRSQKCAQPNNC
KSAVIEEYIACVEWLAYDQISYVNCANLSHFHIDFDNKFSTKIKNKKYFE
AVNEAKQLTEENITRIRLFSSNDTINNHKQVDSVHSCETLEGETSSTLPS
HNFTSPESNQSLQSCCLSRPTGVMSDPLSNQSDRSSHSNIEFPHTSDSQI
SISIPLLKSKFEAEKLAAPTHWDLPDLGSNLDFESNNHIPEFSDYEDEFE
SIDIEKIKFLVDVENN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR000313PWWP_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 107..223
e-value: 6.7E-20
score: 73.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..18
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..26
NoneNo IPR availablePANTHERPTHR23068DNA CYTOSINE-5- -METHYLTRANSFERASE 3-RELATEDcoord: 10..228
NoneNo IPR availablePANTHERPTHR23068:SF30coord: 10..228
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 111..217
IPR000313PWWP domainPFAMPF00855PWWPcoord: 115..208
e-value: 5.8E-12
score: 45.9
IPR000313PWWP domainPROSITEPS50812PWWPcoord: 117..137
score: 10.432