Glutaredoxin-1

Overview
NameGlutaredoxin-1
Smed IDSMED30004855
Length (bp)466
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutaredoxin-1 (SMED30004855) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutaredoxin-1 (SMED30004855) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutaredoxin-1 (SMED30004855) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutaredoxin-1 (SMED30004855) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004855

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30004855SMESG000053749.1 SmedASXL_019472SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30004855SMESG000053749.1 dd_Smed_v4_4565_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30004855SMESG000053749.1 dd_Smed_v4_4565_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30004855SMESG000053749.1 dd_Smed_v4_4565_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30004855SMESG000053749.1 dd_Smed_v6_4565_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30004855SMESG000053749.1 OX_Smed_1.0.02727ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30004855SMESG000053749.1 dd_Smed_v4_4565_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutaredoxin-1 vs. Ensembl Celegans
Match: glrx-10 (GLutaRedoXin [Source:UniProtKB/TrEMBL;Acc:Q9N456])

HSP 1 Score: 53.1434 bits (126), Expect = 1.010e-9
Identity = 29/100 (29.00%), Postives = 48/100 (48.00%), Query Frame = 3
Query:   99 LVEDKIAIRKIVLFSKKNDPRCMIIRKILDRFNLNKITYDNFEEIQIESRQDCAEIENYLWFITNKTKREMPHLFVKKNYIGSYDELMRMHLNDTLHLIF 398
             V+  +   K+V+FSK   P C   R  L+  N+     D  + I+I+ R+DC EI++YL  +T    R +P +F+   + G  D+      N  L  + 
Sbjct:    5 FVDGLLQSSKVVVFSKSYCPYCHKARAALESVNVKP---DALQWIEIDERKDCNEIQDYLGSLTG--ARSVPRVFINGKFFGGGDDTAAGAKNGKLAALL 99          
BLAST of Glutaredoxin-1 vs. Ensembl Fly
Match: Grx1 (gene:FBgn0036820 transcript:FBtr0308813)

HSP 1 Score: 52.373 bits (124), Expect = 2.741e-9
Identity = 31/107 (28.97%), Postives = 50/107 (46.73%), Query Frame = 3
Query:   78 MELNAAKLVEDKIAIRKIVLFSKKNDPRCMIIRKILDRFNLNKITYDNFEEIQIESRQDCAEIENYLWFITNKTKREMPHLFVKKNYIGSYDELMRMHLNDTLHLIF 398
            M    AK VE+ IA  K+V+FSK   P C + ++   + N++         I+++   D  EI+  L  IT    R +P +F+   +IG   ++ RM     L   F
Sbjct:   15 MSTKQAKFVENTIASNKVVIFSKTYCPYCTMAKEPFKKLNVDATI------IELDGNPDGNEIQAVLGEITG--ARTVPRVFIDGKFIGGGTDIKRMFETGALQKYF 113          
BLAST of Glutaredoxin-1 vs. Ensembl Fly
Match: Grx1 (gene:FBgn0036820 transcript:FBtr0075063)

HSP 1 Score: 52.373 bits (124), Expect = 2.741e-9
Identity = 31/107 (28.97%), Postives = 50/107 (46.73%), Query Frame = 3
Query:   78 MELNAAKLVEDKIAIRKIVLFSKKNDPRCMIIRKILDRFNLNKITYDNFEEIQIESRQDCAEIENYLWFITNKTKREMPHLFVKKNYIGSYDELMRMHLNDTLHLIF 398
            M    AK VE+ IA  K+V+FSK   P C + ++   + N++         I+++   D  EI+  L  IT    R +P +F+   +IG   ++ RM     L   F
Sbjct:   15 MSTKQAKFVENTIASNKVVIFSKTYCPYCTMAKEPFKKLNVDATI------IELDGNPDGNEIQAVLGEITG--ARTVPRVFIDGKFIGGGTDIKRMFETGALQKYF 113          
BLAST of Glutaredoxin-1 vs. Ensembl Fly
Match: Grx1t (gene:FBgn0034658 transcript:FBtr0071714)

HSP 1 Score: 48.521 bits (114), Expect = 8.184e-8
Identity = 28/108 (25.93%), Postives = 52/108 (48.15%), Query Frame = 3
Query:   75 SMELNAAKLVEDKIAIRKIVLFSKKNDPRCMIIRKILDRFNLNKITYDNFEEIQIESRQDCAEIENYLWFITNKTKREMPHLFVKKNYIGSYDELMRMHLNDTLHLIF 398
            SM+ + A+ V D I+  K+V+FSK   P C + ++   + N+          I+++ R D  EI+  L  +T    R +P  F+   ++G   ++ R++    L   F
Sbjct:   16 SMDSSHAQFVRDTISGNKVVIFSKSYCPYCSMAKEQFRKINVKATV------IELDQRDDGNEIQAVLGEMTG--SRTVPRCFIDGKFVGGGTDVKRLYEQGILQKYF 115          
BLAST of Glutaredoxin-1 vs. Ensembl Zebrafish
Match: glrx (glutaredoxin (thioltransferase) [Source:ZFIN;Acc:ZDB-GENE-041010-11])

HSP 1 Score: 46.9802 bits (110), Expect = 3.645e-7
Identity = 25/89 (28.09%), Postives = 48/89 (53.93%), Query Frame = 3
Query:   93 AKLVEDKIAIRKIVLFSKKNDPRCMIIRKILDRFNLNKITYDNFEEIQIESRQDCAEIENYLWFITNKTKREMPHLFVKKNYIGSYDEL 359
            A+ V+ +I   K+V+F K     C++ + +L ++   K    +FE I I +R D   I++YL  IT    R +P +F+ ++ +G   ++
Sbjct:    2 AEFVKAQIKDGKVVVFCKPTCSYCILAKDVLSKY---KFKAGHFELIDISARADMGSIQDYLQQITG--ARTVPRVFIGEDCVGGGSDV 85          
BLAST of Glutaredoxin-1 vs. Ensembl Zebrafish
Match: glrx (glutaredoxin (thioltransferase) [Source:ZFIN;Acc:ZDB-GENE-041010-11])

HSP 1 Score: 44.669 bits (104), Expect = 2.791e-6
Identity = 24/89 (26.97%), Postives = 48/89 (53.93%), Query Frame = 3
Query:   93 AKLVEDKIAIRKIVLFSKKNDPRCMIIRKILDRFNLNKITYDNFEEIQIESRQDCAEIENYLWFITNKTKREMPHLFVKKNYIGSYDEL 359
            A+ V+ +I   K+V+F K   P C++ + +L ++   K    + E + I +R D   I++YL  IT    R +P +F+ ++ +G   ++
Sbjct:    2 AEFVKAQIKNGKVVVFLKPPCPYCVLAKDVLSKY---KFKAGHLELVDISARSDMDSIQDYLQQITG--ARTVPRVFIGEDCVGGGSDV 85          
BLAST of Glutaredoxin-1 vs. Ensembl Zebrafish
Match: glrx (glutaredoxin (thioltransferase) [Source:ZFIN;Acc:ZDB-GENE-041010-11])

HSP 1 Score: 44.669 bits (104), Expect = 2.791e-6
Identity = 24/89 (26.97%), Postives = 48/89 (53.93%), Query Frame = 3
Query:   93 AKLVEDKIAIRKIVLFSKKNDPRCMIIRKILDRFNLNKITYDNFEEIQIESRQDCAEIENYLWFITNKTKREMPHLFVKKNYIGSYDEL 359
            A+ V+ +I   K+V+F K   P C++ + +L ++   K    + E + I +R D   I++YL  IT    R +P +F+ ++ +G   ++
Sbjct:    2 AEFVKAQIKNGKVVVFLKPPCPYCVLAKDVLSKY---KFKAGHLELVDISARSDMDSIQDYLQQITG--ARTVPRVFIGEDCVGGGSDV 85          
BLAST of Glutaredoxin-1 vs. TrEMBL
Match: K1R9T8 (Glutaredoxin-1 OS=Crassostrea gigas OX=29159 GN=CGI_10021681 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 5.623e-19
Identity = 44/106 (41.51%), Postives = 62/106 (58.49%), Query Frame = 3
Query:   84 LNAAKL-VEDKIAIRKIVLFSKKNDPRCMIIRKILDRFNLNKITYDNFEEIQIESRQDCAEIENYLWFITNKTKREMPHLFVKKNYIGSYDELMRMHLNDTLHLIF 398
            +  AKL V+ K+A   IV+FSK   P C +I++IL  +NL  + Y     + IESRQDC ++ENYL  +     R +P LF+   YIG   EL+RMH +  L  +F
Sbjct:    1 MAGAKLFVDKKLAQGNIVVFSKSYSPDCKLIQRILAEYNLKNLLY-----VDIESRQDCTQLENYLQILCQTDARSVPQLFIGTKYIGGEKELIRMHESGQLKKVF 101          
BLAST of Glutaredoxin-1 vs. TrEMBL
Match: A0A094ZHV3 (Glutaredoxin-1 OS=Schistosoma haematobium OX=6185 GN=MS3_01654 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 6.235e-19
Identity = 41/103 (39.81%), Postives = 61/103 (59.22%), Query Frame = 3
Query:   90 AAKLVEDKIAIRKIVLFSKKNDPRCMIIRKILDRFNLNKITYDNFEEIQIESRQDCAEIENYLWFITNKTKREMPHLFVKKNYIGSYDELMRMHLNDTLHLIF 398
              K ++ KI  R+++L SK+N P C  I +IL  +NLNK   +NFE + I+ R+DC  +E YLW       R++PHLF+   +IG   E+ R+H N  +  IF
Sbjct:    3 VTKFIDSKIKQRRVLLISKQNSPVCQTIERILRTYNLNKEQDNNFEVLCIDCRRDCTTVETYLWHKLIFGNRQVPHLFLDGKHIGGEPEIKRLHENGEMRRIF 105          
BLAST of Glutaredoxin-1 vs. TrEMBL
Match: A0A5K4F8X5 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.131e-18
Identity = 41/103 (39.81%), Postives = 60/103 (58.25%), Query Frame = 3
Query:   90 AAKLVEDKIAIRKIVLFSKKNDPRCMIIRKILDRFNLNKITYDNFEEIQIESRQDCAEIENYLWFITNKTKREMPHLFVKKNYIGSYDELMRMHLNDTLHLIF 398
              + ++ KI  R+++L SKKN P C  I  IL  +NLNK   +NFE + IE R+DC  +E YLW       R++PHLF+   +IG   E+ R+H +  +  IF
Sbjct:    3 VTEFIDSKIKQRRVLLISKKNSPVCRTIEGILRTYNLNKEQANNFEVLCIECRKDCTTVETYLWHKLIYRNRQVPHLFLDGKHIGGEPEIKRLHESGEMRRIF 105          
BLAST of Glutaredoxin-1 vs. TrEMBL
Match: A0A4Z2DT93 (Glutaredoxin domain-containing protein OS=Schistosoma japonicum OX=6182 GN=EWB00_005977 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.259e-18
Identity = 40/105 (38.10%), Postives = 62/105 (59.05%), Query Frame = 3
Query:   90 AAKLVEDKIAIRKIVLFSKKNDPRCMIIRKILDRFNLNKITYDNFEEIQIESRQDCAEIENYLWFITNKTKREMPHLFVKKNYIGSYDELMRMHLNDTLHLIFVD 404
            +   ++ KI  R+++L SK+  P C  I  IL R+NLN+   DNFE + I++R+DC  IE YLW       R++PHLF+   +IG   E+ R+H +  +  IF +
Sbjct:    9 STNFIDAKIKQRRVLLISKQKVPICQTIEGILGRYNLNRKQNDNFEILYIDARKDCGTIETYLWHKLIYRDRQVPHLFLDGKHIGGESEIKRLHESGEMRRIFAE 113          
BLAST of Glutaredoxin-1 vs. TrEMBL
Match: A0A210PLX4 (Glutaredoxin-C8 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04676 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.260e-18
Identity = 42/109 (38.53%), Postives = 63/109 (57.80%), Query Frame = 3
Query:   87 NAAKLVEDKIAIRKIVLFSKKNDPRCMIIRKILDRFNLNKITYDNFEEIQIESRQDCAEIENYLWFITNKTKREMPHLFVKKNYIGSYDELMRMHLNDTLHLIFVDFWR 413
             A   V+ KI  R ++LFSKK  P   ++++I+D + L   TY   E ++IE+RQDC +IE+Y   I    +RE+P LFV+  YIG   E+ R+H +  L  I +   R
Sbjct:    3 GAKPFVDSKIKQRPVLLFSKKYSPESKMVKEIMDGYKLTNKTY---EVVEIENRQDCNQIEDYFQIICLTDRREVPQLFVRGKYIGGEQEIRRLHESGNLGKILISLKR 108          
BLAST of Glutaredoxin-1 vs. Ensembl Cavefish
Match: glrx (glutaredoxin [Source:NCBI gene;Acc:111193948])

HSP 1 Score: 50.447 bits (119), Expect = 1.554e-8
Identity = 28/99 (28.28%), Postives = 51/99 (51.52%), Query Frame = 3
Query:   90 AAKLVEDKIAIRKIVLFSKKNDPRCMIIRKILDRFNLNKITYDNFEEIQIESRQDCAEIENYLWFITNKTKREMPHLFVKKNYIGSYDELMRMHLNDTL 386
            A + V+ KI   K+V+F K + P C+  + +L ++   K    + E I I  R D + I+++L  IT    R +P +F+ +  IG   ++  +H +  L
Sbjct:    2 AQEFVKAKIQGDKVVVFLKPSCPYCVTAKDVLSKY---KFRAGHLEMIDISGRSDMSSIQDFLQQITG--ARTVPRVFIGEECIGGGSDVSELHRSGKL 95          
BLAST of Glutaredoxin-1 vs. Ensembl Nematostella
Match: EDO36222 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ69])

HSP 1 Score: 45.8246 bits (107), Expect = 3.113e-7
Identity = 29/88 (32.95%), Postives = 45/88 (51.14%), Query Frame = 3
Query:   99 LVEDKIAIRKIVLFSKKNDPRCMIIRKILDRFNLNKITYDNFEEIQIESRQDCAEIENYLWFITNKTKRE--MPHLFVKKNYIGSYDE 356
             VE +I+  K+++FSK   P C   +K L +  L      +F  I+IE+R D  EI++YL    NK  R   +P + +   +IG   E
Sbjct:   10 FVEGEISSHKVMMFSKTYCPFCTKAKKALQKAGLQ-----DFHVIEIENRSDGGEIQDYL----NKRNRSRTVPQVHINGKFIGGGTE 88          
BLAST of Glutaredoxin-1 vs. Planmine SMEST
Match: SMESG000053749.1 (SMESG000053749.1)

HSP 1 Score: 230.335 bits (586), Expect = 3.167e-79
Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 3
Query:   78 MELNAAKLVEDKIAIRKIVLFSKKNDPRCMIIRKILDRFNLNKITYDNFEEIQIESRQDCAEIENYLWFITNKTKREMPHLFVKKNYIGSYDELMRMHLNDTLHLIFVDFWR 413
            MELNAAKLVEDKIAIRKIVLFSKKNDPRCMIIRKILDRFNLNKITYDNFEEIQIESRQDCAEIENYLWFITNKTKREMPHLFVKKNYIGSYDELMRMHLNDTLHLIFVDFWR
Sbjct:    1 MELNAAKLVEDKIAIRKIVLFSKKNDPRCMIIRKILDRFNLNKITYDNFEEIQIESRQDCAEIENYLWFITNKTKREMPHLFVKKNYIGSYDELMRMHLNDTLHLIFVDFWR 112          
BLAST of Glutaredoxin-1 vs. Planmine SMEST
Match: SMESG000007272.1 (SMESG000007272.1)

HSP 1 Score: 63.929 bits (154), Expect = 6.158e-14
Identity = 31/104 (29.81%), Postives = 61/104 (58.65%), Query Frame = 3
Query:   90 AAKLVEDKIAIRKIVLFSKKNDPRCMIIRKILDRFNLNKITYDNFEEIQIESRQDCAEIENYLWFITNKTKREMPHLFVKKNYIGSYDELMRMHLNDTLHLIFV 401
            AA+ V +KI+ +K+V+FSK   P C + + +L+++    I  D +E +++E+  +C +I++YL  IT    R +P +FV   +IG   ++ ++   + L  + V
Sbjct:    2 AAEFVNEKISTKKVVVFSKSFCPYCTLAKNVLNKYIGTSIPTDQYEVVELENDPNCNKIQDYLSEITG--ARTVPRVFVNSKFIGGGTDVEKLDKMNQLEPLLV 103          
The following BLAST results are available for this feature:
BLAST of Glutaredoxin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutaredoxin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
glrx-101.010e-929.00GLutaRedoXin [Source:UniProtKB/TrEMBL;Acc:Q9N456][more]
back to top
BLAST of Glutaredoxin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Grx12.741e-928.97gene:FBgn0036820 transcript:FBtr0308813[more]
Grx12.741e-928.97gene:FBgn0036820 transcript:FBtr0075063[more]
Grx1t8.184e-825.93gene:FBgn0034658 transcript:FBtr0071714[more]
back to top
BLAST of Glutaredoxin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
glrx3.645e-728.09glutaredoxin (thioltransferase) [Source:ZFIN;Acc:Z... [more]
glrx2.791e-626.97glutaredoxin (thioltransferase) [Source:ZFIN;Acc:Z... [more]
glrx2.791e-626.97glutaredoxin (thioltransferase) [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Glutaredoxin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutaredoxin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutaredoxin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutaredoxin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1R9T85.623e-1941.51Glutaredoxin-1 OS=Crassostrea gigas OX=29159 GN=CG... [more]
A0A094ZHV36.235e-1939.81Glutaredoxin-1 OS=Schistosoma haematobium OX=6185 ... [more]
A0A5K4F8X51.131e-1839.81Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4Z2DT931.259e-1838.10Glutaredoxin domain-containing protein OS=Schistos... [more]
A0A210PLX42.260e-1838.53Glutaredoxin-C8 OS=Mizuhopecten yessoensis OX=6573... [more]
back to top
BLAST of Glutaredoxin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
glrx1.554e-828.28glutaredoxin [Source:NCBI gene;Acc:111193948][more]
back to top
BLAST of Glutaredoxin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutaredoxin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutaredoxin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO362223.113e-732.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutaredoxin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutaredoxin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000053749.13.167e-79100.00SMESG000053749.1[more]
SMESG000007272.16.158e-1429.81SMESG000007272.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004855 ID=SMED30004855|Name=Glutaredoxin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=466bp
ATTCTTTCTGTTGTCAACGGTTACTATAACGCGATTTTCTTGCAATTGCT
GCCAATTATTGAGCAAATAATCGTTCAATGGAATTAAATGCAGCAAAATT
AGTTGAAGACAAAATAGCAATTAGAAAAATTGTATTATTTAGCAAAAAAA
ATGACCCGAGATGCATGATTATCAGAAAAATTTTGGATCGGTTTAATTTA
AATAAAATCACTTATGATAACTTTGAAGAAATCCAAATTGAAAGTCGACA
AGATTGTGCTGAAATTGAGAACTATTTATGGTTTATAACAAATAAAACCA
AACGTGAAATGCCCCATTTGTTTGTGAAGAAAAATTACATCGGTAGTTAC
GATGAACTCATGAGAATGCATCTCAATGATACTTTGCATTTGATTTTTGT
TGATTTTTGGAGGTAATTCTTGAACTAATTTCAATCAAGATTTTGATTTT
TAATTTCAAGTGAAAT
back to top

protein sequence of SMED30004855-orf-1

>SMED30004855-orf-1 ID=SMED30004855-orf-1|Name=SMED30004855-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=113bp
MELNAAKLVEDKIAIRKIVLFSKKNDPRCMIIRKILDRFNLNKITYDNFE
EIQIESRQDCAEIENYLWFITNKTKREMPHLFVKKNYIGSYDELMRMHLN
DTLHLIFVDFWR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: biological process
TermDefinition
GO:0022900electron transport chain
GO:0045454cell redox homeostasis
GO:0055114oxidation-reduction process
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR012336Thioredoxin-like_fold
IPR002109Glutaredoxin
Vocabulary: molecular function
TermDefinition
GO:0015035protein disulfide oxidoreductase activity
GO:0009055electron carrier activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 2..110
e-value: 2.5E-18
score: 67.8
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 9..106
IPR002109GlutaredoxinPROSITEPS51354GLUTAREDOXIN_2coord: 6..112
score: 12.853