Actin-binding LIM protein

Overview
NameActin-binding LIM protein
Smed IDSMED30004846
Length (bp)3287
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Actin-binding LIM protein (SMED30004846) t-SNE clustered cells

Violin plots show distribution of expression levels for Actin-binding LIM protein (SMED30004846) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Actin-binding LIM protein (SMED30004846) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Actin-binding LIM protein (SMED30004846) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004846

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30004846h1SMcG0011905 dd_Smed_v4_5410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004846h1SMcG0011905 dd_Smed_v4_5410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004846h1SMcG0011905 dd_Smed_v4_5410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004846h1SMcG0011905 dd_Smed_v4_5410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004846h1SMcG0011905 dd_Smed_v4_5410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004846h1SMcG0011905 dd_Smed_v4_5410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004846h1SMcG0011905 dd_Smed_v4_5410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004846h1SMcG0011905 Contig53499uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004846h1SMcG0011905 Contig53499newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30004846h1SMcG0011905 dd_Smed_v4_5410_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Actin-binding LIM protein vs. Ensembl Human
Match: ABLIM1 (actin binding LIM protein 1 [Source:HGNC Symbol;Acc:HGNC:78])

HSP 1 Score: 119.783 bits (299), Expect = 7.855e-27
Identity = 50/114 (43.86%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            I C  C + CKG+VL++  K  H  CF C  C  +L +GGFF ++  Y C+ DYQ++YG +C  C ++ +GEVVT LG T+H  CF C  C  PF  GD+ T      LC  CA
Sbjct:   37 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 150          

HSP 2 Score: 88.9669 bits (219), Expect = 2.841e-17
Identity = 94/398 (23.62%), Postives = 165/398 (41.46%), Query Frame = 3
Query:  132 CEICRKKCKGD--VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA-SVKQEKENIVPPL--SSQKSITESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPS-----YLQIQERITKHTPPNAVYCGSNRNPNTVPPITS----HFHRPEN--FSYRSSPNINMKKGMSLLVNPFGQ-------------MFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKK 1238
            C  C +  K    +L LD+++ H GCF C  C K L  G +  +D   +C +DYQ L+GVKC  C+++  G+V+      +H  C +C  CN  F  G++  L         C  S K E++  +P +  SS        ++ +   +P +     +++   S     +   P   +   ++N            K +  Y  +     ++    E F  S    K   +      R L+P+     Y  +++R+   +           + ++  P TS    HFHRP N   S R+SP +  +     L   + Q             +++KP   + +  +  QS +    SE++ + + +P  + PDP   P I+   +P PPS +VV  DMK+
Sbjct:  166 CAGCGRDIKNGQALLALDKQW-HLGCFKCKSCGKVL-TGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRLPNIRRSSSDFFYSKSLIRRTGRSPSLQPTRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITY----EPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPGNEPSSGRNSP-LPYRPDSRPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHAALAAQSKS----SEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAVVGPDMKR 552          

HSP 3 Score: 60.8474 bits (146), Expect = 1.407e-8
Identity = 28/65 (43.08%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 2190 ETFPYEKLKINNFS---LPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + FPYE L + N     + + +DR+RLE HL    F  +F MS   F RLP W+RND+K+K  L+
Sbjct:  682 KIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF 746          
BLAST of Actin-binding LIM protein vs. Ensembl Human
Match: ABLIM1 (actin binding LIM protein 1 [Source:HGNC Symbol;Acc:HGNC:78])

HSP 1 Score: 119.398 bits (298), Expect = 9.490e-27
Identity = 50/114 (43.86%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            I C  C + CKG+VL++  K  H  CF C  C  +L +GGFF ++  Y C+ DYQ++YG +C  C ++ +GEVVT LG T+H  CF C  C  PF  GD+ T      LC  CA
Sbjct:   37 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 150          

HSP 2 Score: 92.4337 bits (228), Expect = 2.293e-18
Identity = 92/369 (24.93%), Postives = 158/369 (42.82%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSI-TESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQ----LHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKH--TPPNAVYCGSNR----NPNTVPPITSHFHRPENFSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKK 1238
            +L LD+++ H GCF C  C K L  G +  +D   +C +DYQ L+GVKC  C+++  G+V+      +H  C +C  CN  F  G++  L         C    + +E + P  +S +SI +     +  +    I   V     D  D     ++K    ++    +  E  YTS     ++ +S        SP  S    ++  +R     +S ++G+ N   Y   SY     R  +H   P N    G N      P++ P   ++   P++F +     IN+              ++KP   + +  +  QS +    SE++ + + +P  + PDP   P I+   +P PPS +VV  DMK+
Sbjct:  179 LLALDKQW-HLGCFKCKSCGKVL-TGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQD--VRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPGNEPSSGRNSPLPYRPDSRPLTPTYAQAPKHF-HVPDQGINI--------------YRKPPIYKQHAALAAQSKS----SEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAVVGPDMKR 524          

HSP 3 Score: 60.8474 bits (146), Expect = 1.204e-8
Identity = 28/65 (43.08%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 2190 ETFPYEKLKINNFS---LPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + FPYE L + N     + + +DR+RLE HL    F  +F MS   F RLP W+RND+K+K  L+
Sbjct:  654 KIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF 718          
BLAST of Actin-binding LIM protein vs. Ensembl Human
Match: ABLIM1 (actin binding LIM protein 1 [Source:HGNC Symbol;Acc:HGNC:78])

HSP 1 Score: 119.013 bits (297), Expect = 1.063e-26
Identity = 50/114 (43.86%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            I C  C + CKG+VL++  K  H  CF C  C  +L +GGFF ++  Y C+ DYQ++YG +C  C ++ +GEVVT LG T+H  CF C  C  PF  GD+ T      LC  CA
Sbjct:   37 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 150          

HSP 2 Score: 92.0485 bits (227), Expect = 2.819e-18
Identity = 92/369 (24.93%), Postives = 158/369 (42.82%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSI-TESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQ----LHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKH--TPPNAVYCGSNR----NPNTVPPITSHFHRPENFSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKK 1238
            +L LD+++ H GCF C  C K L  G +  +D   +C +DYQ L+GVKC  C+++  G+V+      +H  C +C  CN  F  G++  L         C    + +E + P  +S +SI +     +  +    I   V     D  D     ++K    ++    +  E  YTS     ++ +S        SP  S    ++  +R     +S ++G+ N   Y   SY     R  +H   P N    G N      P++ P   ++   P++F +     IN+              ++KP   + +  +  QS +    SE++ + + +P  + PDP   P I+   +P PPS +VV  DMK+
Sbjct:  179 LLALDKQW-HLGCFKCKSCGKVL-TGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQD--VRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPGNEPSSGRNSPLPYRPDSRPLTPTYAQAPKHF-HVPDQGINI--------------YRKPPIYKQHAALAAQSKS----SEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAVVGPDMKR 524          

HSP 3 Score: 60.8474 bits (146), Expect = 1.301e-8
Identity = 28/65 (43.08%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 2190 ETFPYEKLKINNFS---LPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + FPYE L + N     + + +DR+RLE HL    F  +F MS   F RLP W+RND+K+K  L+
Sbjct:  654 KIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF 718          
BLAST of Actin-binding LIM protein vs. Ensembl Human
Match: ABLIM1 (actin binding LIM protein 1 [Source:HGNC Symbol;Acc:HGNC:78])

HSP 1 Score: 118.627 bits (296), Expect = 1.642e-26
Identity = 50/114 (43.86%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            I C  C + CKG+VL++  K  H  CF C  C  +L +GGFF ++  Y C+ DYQ++YG +C  C ++ +GEVVT LG T+H  CF C  C  PF  GD+ T      LC  CA
Sbjct:   97 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 210          

HSP 2 Score: 91.6633 bits (226), Expect = 3.916e-18
Identity = 92/369 (24.93%), Postives = 158/369 (42.82%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSI-TESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQ----LHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKH--TPPNAVYCGSNR----NPNTVPPITSHFHRPENFSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKK 1238
            +L LD+++ H GCF C  C K L  G +  +D   +C +DYQ L+GVKC  C+++  G+V+      +H  C +C  CN  F  G++  L         C    + +E + P  +S +SI +     +  +    I   V     D  D     ++K    ++    +  E  YTS     ++ +S        SP  S    ++  +R     +S ++G+ N   Y   SY     R  +H   P N    G N      P++ P   ++   P++F +     IN+              ++KP   + +  +  QS +    SE++ + + +P  + PDP   P I+   +P PPS +VV  DMK+
Sbjct:  239 LLALDKQW-HLGCFKCKSCGKVL-TGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQD--VRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPGNEPSSGRNSPLPYRPDSRPLTPTYAQAPKHF-HVPDQGINI--------------YRKPPIYKQHAALAAQSKS----SEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAVVGPDMKR 584          

HSP 3 Score: 60.8474 bits (146), Expect = 1.200e-8
Identity = 28/65 (43.08%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 2190 ETFPYEKLKINNFS---LPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + FPYE L + N     + + +DR+RLE HL    F  +F MS   F RLP W+RND+K+K  L+
Sbjct:  714 KIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF 778          
BLAST of Actin-binding LIM protein vs. Ensembl Human
Match: ABLIM1 (actin binding LIM protein 1 [Source:HGNC Symbol;Acc:HGNC:78])

HSP 1 Score: 117.857 bits (294), Expect = 2.595e-26
Identity = 50/114 (43.86%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            I C  C + CKG+VL++  K  H  CF C  C  +L +GGFF ++  Y C+ DYQ++YG +C  C ++ +GEVVT LG T+H  CF C  C  PF  GD+ T      LC  CA
Sbjct:   37 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 150          

HSP 2 Score: 88.1965 bits (217), Expect = 5.329e-17
Identity = 91/383 (23.76%), Postives = 155/383 (40.47%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRC-ASVKQEKENIVPPL--SSQKSITESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPS-----YLQIQERITKHTPPNAVYCGSNRNPNTVPPITS----HFHRPEN--FSYRSSPNINMKKGMSLLVNPFGQM---FKKP--------LPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKK 1238
            +L LD+++ H GCF C  C K L  G +  +D   +C +DYQ L+GVKC  C+++  G+V+      +H  C +C  CN  F  G++  L         C  S K E++  +P +  SS        ++ +   +P +     +++   S     +   P   +   ++N            K +  Y  +     ++    E F  S    K   +      R L+P+     Y  +++R+   +           + ++  P TS    HFHRP N   S R+SP +  +     L   + Q    F  P         P  Y +            SE++ + + +P  + PDP   P I+   +P PPS +VV  DMK+
Sbjct:  179 LLALDKQW-HLGCFKCKSCGKVL-TGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRLPNIRRSSSDFFYSKSLIRRTGRSPSLQPTRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITY----EPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPGNEPSSGRNSP-LPYRPDSRPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHDAAALAAQSKSSEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAVVGPDMKR 554          

HSP 3 Score: 60.8474 bits (146), Expect = 1.240e-8
Identity = 28/65 (43.08%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 2190 ETFPYEKLKINNF---SLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + FPYE L + N     + + +DR+RLE HL    F  +F MS   F RLP W+RND+K+K  L+
Sbjct:  684 KIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF 748          
BLAST of Actin-binding LIM protein vs. Ensembl Celegans
Match: pxl-1 (Paxillin homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09476])

HSP 1 Score: 67.781 bits (164), Expect = 4.780e-12
Identity = 34/96 (35.42%), Postives = 46/96 (47.92%), Query Frame = 3
Query:  123 KIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPF 410
            K  C  C K   G V+    K  H   + C +C   L +  FF R+ R FC EDY   +  KC  C++      V+++   FHI+CF C  CN PF
Sbjct:   86 KGDCAACGKPIIGQVVIALGKMWHPEHYTCCECGAELGQRPFFERNGRAFCEEDYHNQFSPKCQGCHRAITDRCVSVMNKNFHIECFTCAECNQPF 181          

HSP 2 Score: 55.0694 bits (131), Expect = 8.230e-8
Identity = 25/88 (28.41%), Postives = 44/88 (50.00%), Query Frame = 3
Query:  129 QCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQ 392
            +C+ C +      + +  K  H  CF C +CN+   + GF  ++ + +C  D+ +L+  KC  C++      +T LG  +H  CF CQ
Sbjct:  147 KCQGCHRAITDRCVSVMNKNFHIECFTCAECNQPFGEDGFHEKNGQTYCKRDFFRLFAPKCNGCSQPITSNFITALGTHWHPDCFVCQ 234          
BLAST of Actin-binding LIM protein vs. Ensembl Celegans
Match: unc-115 (pep chromosome:WBcel235:X:10147492:10153085:1 gene:WBGene00006839.1 transcript:F09B9.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-115)

HSP 1 Score: 70.4774 bits (171), Expect = 5.054e-12
Identity = 29/63 (46.03%), Postives = 43/63 (68.25%), Query Frame = 3
Query:  111 FIMGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCR-DNRYFCSEDYQKL 296
             I+GK +C++CRKKC GDVLK + K+ H  CF C KC +NL + GF+   +N Y C +D++ +
Sbjct:   13 LILGK-KCDVCRKKCSGDVLKANDKYFHINCFQCKKCGRNLGETGFYTTPENAYLCPDDFRAV 74          

HSP 2 Score: 65.855 bits (159), Expect = 1.338e-10
Identity = 93/342 (27.19%), Postives = 141/342 (41.23%), Query Frame = 3
Query:  918 NTVPPITSHFHRPEN-FSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGTDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQXXXXXXXXXXXXYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRD-NRYEGRPAHHLSYRVQYSNT-------------GGRTGTLPSAYTSSSENESATRSYRSYHSYYPAPQPGYTQGYLSCTEDSASGRP-TNGLNYRASSLP---RPLNLYTPVCVNTTN 1886
            N   P    +H P+     R S    +K GM  L     +  +K +P       RP+S +  N  EE   LAHYP    PDPD+ P I+R DFPA P     ++++K+          +ST  +            E+ D   SE +K  + K+  T++ L E    S ++  +   +E++  + R   ++DP +ASR+P     P  K RYD     SPSR  NR           R Q +NT               R  TLP+ +  +   E+   +  S++S +            S TE   +G P + G     SSLP   +P   Y  + + TTN
Sbjct:  294 NAKEPNAPQYHVPQGPIKIRKSRMSMLKTGMQRLT----EDLEKNIP-------RPKSPHMDN--EEPIELAHYPAAHVPDPDTLPAIEREDFPA-PQFPYAVEELKRR---------LSTSSV----------ENEISDDEYSESDKVDEDKLRKTVETL-EKYNDSSIAHVIRQNIEDSHKKQRLPLHWDPRNASRTPSGKKMPHLKFRYDVPINASPSRHLNRPRPWVVWQGGERDQGNNTLPCFHIPEDSRANTLRAATLPTEFGQNLSLENLDTTISSHYSEH------------STTESGTAGGPRSAGGAVLRSSLPDMSKPAKQYDLLFLQTTN 589          

HSP 3 Score: 61.6178 bits (148), Expect = 2.847e-9
Identity = 38/124 (30.65%), Postives = 54/124 (43.55%), Query Frame = 3
Query:  132 CEICRKKC-KGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVP 500
            C  C +    G VL       H  CF C +C+  L  G +     +  C  DY + +GVKC  C K+  G+V+   G  FH  C +C  C S F  G++  +  G  + H      +  ENI P
Sbjct:  131 CAACDQALHSGQVLLALGLSWHVYCFKCSECSAVLH-GEYMSHHGKPLCLRDYNEKFGVKCYECEKFIAGKVLQAGGYKFHPTCARCSRCGSHFGDGEEMYM-QGDEIWHPSCEHARTTENIAP 252          

HSP 4 Score: 60.4622 bits (145), Expect = 5.138e-9
Identity = 29/64 (45.31%), Postives = 40/64 (62.50%), Query Frame = 3
Query: 2184 PAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            PA+ +    L+  N  LP+ +DR  LE HL  + FE +F+MS   F +LPEWKR +LKRK  L+
Sbjct:  576 PAKQYDLLFLQTTNSDLPEDVDRQHLERHLPRDQFEEIFKMSLIEFYKLPEWKRINLKRKHKLF 639          
BLAST of Actin-binding LIM protein vs. Ensembl Celegans
Match: pxl-1 (Paxillin homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09476])

HSP 1 Score: 68.9366 bits (167), Expect = 7.417e-12
Identity = 34/96 (35.42%), Postives = 46/96 (47.92%), Query Frame = 3
Query:  123 KIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPF 410
            K  C  C K   G V+    K  H   + C +C   L +  FF R+ R FC EDY   +  KC  C++      V+++   FHI+CF C  CN PF
Sbjct:  173 KGDCAACGKPIIGQVVIALGKMWHPEHYTCCECGAELGQRPFFERNGRAFCEEDYHNQFSPKCQGCHRAITDRCVSVMNKNFHIECFTCAECNQPF 268          

HSP 2 Score: 61.2326 bits (147), Expect = 2.282e-9
Identity = 32/113 (28.32%), Postives = 56/113 (49.56%), Query Frame = 3
Query:  129 QCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWD--GKYLCHR 461
            +C+ C +      + +  K  H  CF C +CN+   + GF  ++ + +C  D+ +L+  KC  C++      +T LG  +H  CF CQ+C   F   + A+ ++  G  LC R
Sbjct:  234 KCQGCHRAITDRCVSVMNKNFHIECFTCAECNQPFGEDGFHEKNGQTYCKRDFFRLFAPKCNGCSQPITSNFITALGTHWHPDCFVCQHCGVSF---NGASFFEHNGAPLCER 343          
BLAST of Actin-binding LIM protein vs. Ensembl Celegans
Match: unc-115 (pep chromosome:WBcel235:X:10146889:10153142:1 gene:WBGene00006839.1 transcript:F09B9.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-115)

HSP 1 Score: 68.9366 bits (167), Expect = 1.402e-11
Identity = 29/61 (47.54%), Postives = 42/61 (68.85%), Query Frame = 3
Query:  117 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCR-DNRYFCSEDYQKL 296
            MGK +C++CRKKC GDVLK + K+ H  CF C KC +NL + GF+   +N Y C +D++ +
Sbjct:    1 MGK-KCDVCRKKCSGDVLKANDKYFHINCFQCKKCGRNLGETGFYTTPENAYLCPDDFRAV 60          

HSP 2 Score: 65.855 bits (159), Expect = 1.409e-10
Identity = 93/342 (27.19%), Postives = 141/342 (41.23%), Query Frame = 3
Query:  918 NTVPPITSHFHRPEN-FSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGTDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQXXXXXXXXXXXXYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRD-NRYEGRPAHHLSYRVQYSNT-------------GGRTGTLPSAYTSSSENESATRSYRSYHSYYPAPQPGYTQGYLSCTEDSASGRP-TNGLNYRASSLP---RPLNLYTPVCVNTTN 1886
            N   P    +H P+     R S    +K GM  L     +  +K +P       RP+S +  N  EE   LAHYP    PDPD+ P I+R DFPA P     ++++K+          +ST  +            E+ D   SE +K  + K+  T++ L E    S ++  +   +E++  + R   ++DP +ASR+P     P  K RYD     SPSR  NR           R Q +NT               R  TLP+ +  +   E+   +  S++S +            S TE   +G P + G     SSLP   +P   Y  + + TTN
Sbjct:  280 NAKEPNAPQYHVPQGPIKIRKSRMSMLKTGMQRLT----EDLEKNIP-------RPKSPHMDN--EEPIELAHYPAAHVPDPDTLPAIEREDFPA-PQFPYAVEELKRR---------LSTSSV----------ENEISDDEYSESDKVDEDKLRKTVETL-EKYNDSSIAHVIRQNIEDSHKKQRLPLHWDPRNASRTPSGKKMPHLKFRYDVPINASPSRHLNRPRPWVVWQGGERDQGNNTLPCFHIPEDSRANTLRAATLPTEFGQNLSLENLDTTISSHYSEH------------STTESGTAGGPRSAGGAVLRSSLPDMSKPAKQYDLLFLQTTN 575          

HSP 3 Score: 61.2326 bits (147), Expect = 3.191e-9
Identity = 38/124 (30.65%), Postives = 54/124 (43.55%), Query Frame = 3
Query:  132 CEICRKKC-KGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVP 500
            C  C +    G VL       H  CF C +C+  L  G +     +  C  DY + +GVKC  C K+  G+V+   G  FH  C +C  C S F  G++  +  G  + H      +  ENI P
Sbjct:  117 CAACDQALHSGQVLLALGLSWHVYCFKCSECSAVLH-GEYMSHHGKPLCLRDYNEKFGVKCYECEKFIAGKVLQAGGYKFHPTCARCSRCGSHFGDGEEMYM-QGDEIWHPSCEHARTTENIAP 238          

HSP 4 Score: 60.4622 bits (145), Expect = 5.427e-9
Identity = 29/64 (45.31%), Postives = 40/64 (62.50%), Query Frame = 3
Query: 2184 PAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            PA+ +    L+  N  LP+ +DR  LE HL  + FE +F+MS   F +LPEWKR +LKRK  L+
Sbjct:  562 PAKQYDLLFLQTTNSDLPEDVDRQHLERHLPRDQFEEIFKMSLIEFYKLPEWKRINLKRKHKLF 625          
BLAST of Actin-binding LIM protein vs. Ensembl Celegans
Match: pxl-1 (Paxillin homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09476])

HSP 1 Score: 67.3958 bits (163), Expect = 1.624e-11
Identity = 34/96 (35.42%), Postives = 46/96 (47.92%), Query Frame = 3
Query:  123 KIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPF 410
            K  C  C K   G V+    K  H   + C +C   L +  FF R+ R FC EDY   +  KC  C++      V+++   FHI+CF C  CN PF
Sbjct:  112 KGDCAACGKPIIGQVVIALGKMWHPEHYTCCECGAELGQRPFFERNGRAFCEEDYHNQFSPKCQGCHRAITDRCVSVMNKNFHIECFTCAECNQPF 207          

HSP 2 Score: 59.6918 bits (143), Expect = 5.963e-9
Identity = 32/113 (28.32%), Postives = 56/113 (49.56%), Query Frame = 3
Query:  129 QCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWD--GKYLCHR 461
            +C+ C +      + +  K  H  CF C +CN+   + GF  ++ + +C  D+ +L+  KC  C++      +T LG  +H  CF CQ+C   F   + A+ ++  G  LC R
Sbjct:  173 KCQGCHRAITDRCVSVMNKNFHIECFTCAECNQPFGEDGFHEKNGQTYCKRDFFRLFAPKCNGCSQPITSNFITALGTHWHPDCFVCQHCGVSF---NGASFFEHNGAPLCER 282          
BLAST of Actin-binding LIM protein vs. Ensembl Fly
Match: Unc-115b (gene:FBgn0260463 transcript:FBtr0082094)

HSP 1 Score: 132.494 bits (332), Expect = 3.502e-31
Identity = 55/116 (47.41%), Postives = 72/116 (62.07%), Query Frame = 3
Query:  123 KIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCAS 470
            KI C  C KKC G+VL++     HK CF C +C K+L  GGFF +DN Y+C  DYQ+LYG KC  C +Y +GEVV+ +G T+H +CF C  C  PF  G K T    + LC +C +
Sbjct:   43 KIYCAKCTKKCSGEVLRVADNHFHKACFQCCQCKKSLATGGFFTKDNAYYCIPDYQRLYGTKCANCQQYVEGEVVSTMGKTYHQKCFTCSKCKQPFKSGSKVTNTGKEVLCEQCVT 158          

HSP 2 Score: 71.633 bits (174), Expect = 2.772e-12
Identity = 81/297 (27.27%), Postives = 120/297 (40.40%), Query Frame = 3
Query:  930 PITSHFHRPENFSYRSS-------------PNINMKKGMSLLVNPFGQMFKKPL-PGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGTDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQXXXXXXXXXXXXYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHH-------LSYRVQYSNTGGRTGTLPSAYTSSSENESATRSYRSYHSYYPAPQPGY 1757
            P++ HFHRP +++  +S             P+   +  M +LV+       +P  PG  N              EE   L+HYP  K+P P   P I+R DFPAPP       D ++ + Y      V   D   D     +     G     E+++  +++ E   K+    G     S    D  E+ + R   +N  DP +ASR+P AS EP  K RY+     SPSR+  ++ +P +         SYR    + G   G  P              SY + HSY   P+PGY
Sbjct:  435 PLSPHFHRPSSYATTASNAGSVAGSRPPSRPHSRTRSAMKVLVDAIRSETPRPKSPGMNN--------------EEPIELSHYPAAKKPPPGEQPKIERDDFPAPP---YPYTDPERRRRYSDTYKGVPASD---DEDENVENGKPNGKVKNGEEQQRLQREAEQLEKLNSGIG-----SAIAKDLKEHAKYRKWKQNNLDPRNASRTPSASKEPLYKLRYESPIGASPSRNLDHQ-KPFYEDEMFDRSTSYR---GSLGKSLGNAP--------------SYNAIHSYRSPPKPGY 688          

HSP 3 Score: 62.003 bits (149), Expect = 2.773e-9
Identity = 36/120 (30.00%), Postives = 54/120 (45.00%), Query Frame = 3
Query:  159 GDVLKLDQKFI------HKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGG-TFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIV 497
            G++LK  Q  +      H  CF C  C   L  G +  +D   +C + YQK +GVKC +C+++  G+V+       FH  C +C  C  PF  G++  L        RC     E   I+
Sbjct:  215 GELLKEGQALVALDRQWHVSCFRCKACQAVLN-GEYMGKDAVPYCEKCYQKGFGVKCAYCSRFISGKVLQAGDNHHFHPTCARCTKCGDPFGDGEEMYLQGSAIWHPRCGPGPSESGIIL 333          
BLAST of Actin-binding LIM protein vs. Ensembl Fly
Match: Unc-115b (gene:FBgn0260463 transcript:FBtr0082095)

HSP 1 Score: 132.494 bits (332), Expect = 3.550e-31
Identity = 55/116 (47.41%), Postives = 72/116 (62.07%), Query Frame = 3
Query:  123 KIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCAS 470
            KI C  C KKC G+VL++     HK CF C +C K+L  GGFF +DN Y+C  DYQ+LYG KC  C +Y +GEVV+ +G T+H +CF C  C  PF  G K T    + LC +C +
Sbjct:   27 KIYCAKCTKKCSGEVLRVADNHFHKACFQCCQCKKSLATGGFFTKDNAYYCIPDYQRLYGTKCANCQQYVEGEVVSTMGKTYHQKCFTCSKCKQPFKSGSKVTNTGKEVLCEQCVT 142          

HSP 2 Score: 72.0182 bits (175), Expect = 2.367e-12
Identity = 81/297 (27.27%), Postives = 120/297 (40.40%), Query Frame = 3
Query:  930 PITSHFHRPENFSYRSS-------------PNINMKKGMSLLVNPFGQMFKKPL-PGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGTDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQXXXXXXXXXXXXYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHH-------LSYRVQYSNTGGRTGTLPSAYTSSSENESATRSYRSYHSYYPAPQPGY 1757
            P++ HFHRP +++  +S             P+   +  M +LV+       +P  PG  N              EE   L+HYP  K+P P   P I+R DFPAPP       D ++ + Y      V   D   D     +     G     E+++  +++ E   K+    G     S    D  E+ + R   +N  DP +ASR+P AS EP  K RY+     SPSR+  ++ +P +         SYR    + G   G  P              SY + HSY   P+PGY
Sbjct:  419 PLSPHFHRPSSYATTASNAGSVAGSRPPSRPHSRTRSAMKVLVDAIRSETPRPKSPGMNN--------------EEPIELSHYPAAKKPPPGEQPKIERDDFPAPP---YPYTDPERRRRYSDTYKGVPASD---DEDENVENGKPNGKVKNGEEQQRLQREAEQLEKLNSGIG-----SAIAKDLKEHAKYRKWKQNNLDPRNASRTPSASKEPLYKLRYESPIGASPSRNLDHQ-KPFYEDEMFDRSTSYR---GSLGKSLGNAP--------------SYNAIHSYRSPPKPGY 672          

HSP 3 Score: 62.003 bits (149), Expect = 3.094e-9
Identity = 36/120 (30.00%), Postives = 54/120 (45.00%), Query Frame = 3
Query:  159 GDVLKLDQKFI------HKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGG-TFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIV 497
            G++LK  Q  +      H  CF C  C   L  G +  +D   +C + YQK +GVKC +C+++  G+V+       FH  C +C  C  PF  G++  L        RC     E   I+
Sbjct:  199 GELLKEGQALVALDRQWHVSCFRCKACQAVLN-GEYMGKDAVPYCEKCYQKGFGVKCAYCSRFISGKVLQAGDNHHFHPTCARCTKCGDPFGDGEEMYLQGSAIWHPRCGPGPSESGIIL 317          
BLAST of Actin-binding LIM protein vs. Ensembl Fly
Match: Unc-115b (gene:FBgn0260463 transcript:FBtr0303039)

HSP 1 Score: 132.494 bits (332), Expect = 3.550e-31
Identity = 55/116 (47.41%), Postives = 72/116 (62.07%), Query Frame = 3
Query:  123 KIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCAS 470
            KI C  C KKC G+VL++     HK CF C +C K+L  GGFF +DN Y+C  DYQ+LYG KC  C +Y +GEVV+ +G T+H +CF C  C  PF  G K T    + LC +C +
Sbjct:   27 KIYCAKCTKKCSGEVLRVADNHFHKACFQCCQCKKSLATGGFFTKDNAYYCIPDYQRLYGTKCANCQQYVEGEVVSTMGKTYHQKCFTCSKCKQPFKSGSKVTNTGKEVLCEQCVT 142          

HSP 2 Score: 72.0182 bits (175), Expect = 2.367e-12
Identity = 81/297 (27.27%), Postives = 120/297 (40.40%), Query Frame = 3
Query:  930 PITSHFHRPENFSYRSS-------------PNINMKKGMSLLVNPFGQMFKKPL-PGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGTDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQXXXXXXXXXXXXYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHH-------LSYRVQYSNTGGRTGTLPSAYTSSSENESATRSYRSYHSYYPAPQPGY 1757
            P++ HFHRP +++  +S             P+   +  M +LV+       +P  PG  N              EE   L+HYP  K+P P   P I+R DFPAPP       D ++ + Y      V   D   D     +     G     E+++  +++ E   K+    G     S    D  E+ + R   +N  DP +ASR+P AS EP  K RY+     SPSR+  ++ +P +         SYR    + G   G  P              SY + HSY   P+PGY
Sbjct:  419 PLSPHFHRPSSYATTASNAGSVAGSRPPSRPHSRTRSAMKVLVDAIRSETPRPKSPGMNN--------------EEPIELSHYPAAKKPPPGEQPKIERDDFPAPP---YPYTDPERRRRYSDTYKGVPASD---DEDENVENGKPNGKVKNGEEQQRLQREAEQLEKLNSGIG-----SAIAKDLKEHAKYRKWKQNNLDPRNASRTPSASKEPLYKLRYESPIGASPSRNLDHQ-KPFYEDEMFDRSTSYR---GSLGKSLGNAP--------------SYNAIHSYRSPPKPGY 672          

HSP 3 Score: 62.003 bits (149), Expect = 3.094e-9
Identity = 36/120 (30.00%), Postives = 54/120 (45.00%), Query Frame = 3
Query:  159 GDVLKLDQKFI------HKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGG-TFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIV 497
            G++LK  Q  +      H  CF C  C   L  G +  +D   +C + YQK +GVKC +C+++  G+V+       FH  C +C  C  PF  G++  L        RC     E   I+
Sbjct:  199 GELLKEGQALVALDRQWHVSCFRCKACQAVLN-GEYMGKDAVPYCEKCYQKGFGVKCAYCSRFISGKVLQAGDNHHFHPTCARCTKCGDPFGDGEEMYLQGSAIWHPRCGPGPSESGIIL 317          
BLAST of Actin-binding LIM protein vs. Ensembl Fly
Match: Unc-115a (gene:FBgn0051352 transcript:FBtr0346714)

HSP 1 Score: 132.494 bits (332), Expect = 3.972e-31
Identity = 55/116 (47.41%), Postives = 72/116 (62.07%), Query Frame = 3
Query:  123 KIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCAS 470
            KI C  C KKC G+VL++     HK CF C +C K+L  GGFF +DN Y+C  DYQ+LYG KC  C +Y +GEVV+ +G T+H +CF C  C  PF  G K T    + LC +C +
Sbjct:    5 KIYCAKCTKKCSGEVLRVADNHFHKACFQCCQCKKSLATGGFFTKDNAYYCIPDYQRLYGTKCANCQQYVEGEVVSTMGKTYHQKCFTCSKCKQPFKSGSKVTNTGKEVLCEQCVT 120          

HSP 2 Score: 118.627 bits (296), Expect = 8.094e-27
Identity = 134/510 (26.27%), Postives = 204/510 (40.00%), Query Frame = 3
Query:  912 NPNTVPPITSHFHRPENFSYRSS-------------PNINMKKGMSLLVNPFGQMFKKPL-PGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGTDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQXXXXXXXXXXXXYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHH-------LSYRVQYSNTGGRTGTLPSAYTSSSENESATRSYRSYHSYYPAPQPGYTQGYLSCTEDSASGRPTNGLNYRASSLPRPLNLYTPVCVNTTNYLLDGHMSPSMTTSGYSVDATTHSIDESTLIGGSGLLNAT-AHRNGYMSDMAPLSAPYGPKKTRPDWFYESENEAVFHSNYPTVQSYLKPSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            +P    P++ HFHRP +++  +S             P+   +  M +LV+       +P  PG  N              EE   L+HYP  K+P P   P I+R DFPAPP       D ++ + Y      V   D   D     +     G     E+++  +++ E   K+    G     S    D  E+ + R   +N  DP +ASR+P AS EP  K RY+     SPSR+  ++ +P +         SYR    + G   G  P              SY    +    P+PGY                  GL  R+ +             +TT+     H +   +  G  +   THS D S     + + + T   R   M    P S+ Y    +     Y      +   + P +      S+ +   E  PA+ +PY  L I N+ LP  +DR  LE HL+D +FE + Q +RS F RLP+W+RN+LKR+V L+
Sbjct:  391 DPYDKTPLSPHFHRPSSYATTASNAGSVAGSRPPSRPHSRTRSAMKVLVDAIRSETPRPKSPGMNN--------------EEPIELSHYPAAKKPPPGEQPKIERDDFPAPP---YPYTDPERRRRYSDTYKGVPASD---DEDENVENGKPNGKVKNGEEQQRLQREAEQLEKLNSGIG-----SAIAKDLKEHAKYRKWKQNNLDPRNASRTPSASKEPLYKLRYESPIGASPSRNLDHQ-KPFYEDEMFDRSTSYR---GSLGKSLGNAP--------------SYNVVSALRHVPKPGY------------------GLAPRSHTF-----------SSTTSAAATMHGATDFSYGG--LGDKTHSTDLSCGKSEASVDSITEGDRRALMGGDLPASSTYSGALS-----YHYPQAGLIRRSLPNM------SHSMLVHE--PAKIYPYHLLLITNYRLPSDVDRCNLERHLSDIEFEHILQCARSEFYRLPQWRRNELKRRVKLF 813          

HSP 3 Score: 62.003 bits (149), Expect = 3.231e-9
Identity = 36/120 (30.00%), Postives = 54/120 (45.00%), Query Frame = 3
Query:  159 GDVLKLDQKFI------HKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGG-TFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIV 497
            G++LK  Q  +      H  CF C  C   L  G +  +D   +C + YQK +GVKC +C+++  G+V+       FH  C +C  C  PF  G++  L        RC     E   I+
Sbjct:  177 GELLKEGQALVALDRQWHVSCFRCKACQAVLN-GEYMGKDAVPYCEKCYQKGFGVKCAYCSRFISGKVLQAGDNHHFHPTCARCTKCGDPFGDGEEMYLQGSAIWHPRCGPGPSESGIIL 295          
BLAST of Actin-binding LIM protein vs. Ensembl Fly
Match: Unc-115b (gene:FBgn0260463 transcript:FBtr0082097)

HSP 1 Score: 132.494 bits (332), Expect = 4.032e-31
Identity = 55/116 (47.41%), Postives = 72/116 (62.07%), Query Frame = 3
Query:  123 KIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCAS 470
            KI C  C KKC G+VL++     HK CF C +C K+L  GGFF +DN Y+C  DYQ+LYG KC  C +Y +GEVV+ +G T+H +CF C  C  PF  G K T    + LC +C +
Sbjct:   38 KIYCAKCTKKCSGEVLRVADNHFHKACFQCCQCKKSLATGGFFTKDNAYYCIPDYQRLYGTKCANCQQYVEGEVVSTMGKTYHQKCFTCSKCKQPFKSGSKVTNTGKEVLCEQCVT 153          

HSP 2 Score: 71.633 bits (174), Expect = 3.012e-12
Identity = 81/297 (27.27%), Postives = 120/297 (40.40%), Query Frame = 3
Query:  930 PITSHFHRPENFSYRSS-------------PNINMKKGMSLLVNPFGQMFKKPL-PGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGTDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQXXXXXXXXXXXXYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHH-------LSYRVQYSNTGGRTGTLPSAYTSSSENESATRSYRSYHSYYPAPQPGY 1757
            P++ HFHRP +++  +S             P+   +  M +LV+       +P  PG  N              EE   L+HYP  K+P P   P I+R DFPAPP       D ++ + Y      V   D   D     +     G     E+++  +++ E   K+    G     S    D  E+ + R   +N  DP +ASR+P AS EP  K RY+     SPSR+  ++ +P +         SYR    + G   G  P              SY + HSY   P+PGY
Sbjct:  411 PLSPHFHRPSSYATTASNAGSVAGSRPPSRPHSRTRSAMKVLVDAIRSETPRPKSPGMNN--------------EEPIELSHYPAAKKPPPGEQPKIERDDFPAPP---YPYTDPERRRRYSDTYKGVPASD---DEDENVENGKPNGKVKNGEEQQRLQREAEQLEKLNSGIG-----SAIAKDLKEHAKYRKWKQNNLDPRNASRTPSASKEPLYKLRYESPIGASPSRNLDHQ-KPFYEDEMFDRSTSYR---GSLGKSLGNAP--------------SYNAIHSYRSPPKPGY 664          

HSP 3 Score: 61.6178 bits (148), Expect = 3.212e-9
Identity = 36/120 (30.00%), Postives = 54/120 (45.00%), Query Frame = 3
Query:  159 GDVLKLDQKFI------HKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGG-TFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIV 497
            G++LK  Q  +      H  CF C  C   L  G +  +D   +C + YQK +GVKC +C+++  G+V+       FH  C +C  C  PF  G++  L        RC     E   I+
Sbjct:  210 GELLKEGQALVALDRQWHVSCFRCKACQAVLN-GEYMGKDAVPYCEKCYQKGFGVKCAYCSRFISGKVLQAGDNHHFHPTCARCTKCGDPFGDGEEMYLQGSAIWHPRCGPGPSESGIIL 328          
BLAST of Actin-binding LIM protein vs. Ensembl Zebrafish
Match: ablim2 (actin binding LIM protein family, member 2 [Source:ZFIN;Acc:ZDB-GENE-100316-5])

HSP 1 Score: 120.939 bits (302), Expect = 1.574e-27
Identity = 50/115 (43.48%), Postives = 70/115 (60.87%), Query Frame = 3
Query:  120 GKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRC 464
            G + C+ C K CKG+VL++  K  H  CF C  C  +L +GGFF R   Y C+ DYQ+LYG +C  C ++ +GEVV+ LG T+H +CF C  C  PF  GD+ T    + +C +C
Sbjct:   24 GPVPCQNCGKPCKGEVLRVQNKHFHIKCFVCKVCGCDLAQGGFFVRQGEYICTVDYQRLYGTRCFSCEEFIEGEVVSALGKTYHPRCFVCATCKQPFPAGDRVTFNGKECICEKC 138          

HSP 2 Score: 63.5438 bits (153), Expect = 1.117e-9
Identity = 43/137 (31.39%), Postives = 69/137 (50.36%), Query Frame = 3
Query:  132 CEICRKKCKGD--VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCH---RCASVKQEKENIVPPLSSQKSIT 527
            C  C K+ K +  ++ LD+ + H GCF C  CNK L    +  +D   +C  DY  ++G++C  C KY  G+V+      +H  C +C  C+  F  G++  L  G  + H   R A+  +EK  +    +S +SIT
Sbjct:  156 CCGCGKEFKNEQSLVALDKHW-HLGCFKCKVCNKVL-NAEYISKDGIPYCEADYHAMFGIQCETCKKYITGKVLEAGEKHYHPTCARCARCDQMFGEGEEMYL-QGSTIWHPPCRQAARMEEKSKVT--RTSSESIT 287          

HSP 3 Score: 61.2326 bits (147), Expect = 5.433e-9
Identity = 49/172 (28.49%), Postives = 83/172 (48.26%), Query Frame = 3
Query: 1902 HMSPSMTTSGYSVDATTHS--IDESTLIGG-SGLLNATAHRNGYMSDMAPLSAPYGPKKTRPDW----FYES----ENEAVFHSNYPTVQSYLKPSNILRTKEKIPAETFPYEKLKINN---FSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            H S +    G  VD  T +  ++  T I G S  L+     +   +DM+  + PY    + P +     Y++    E+EA   S++  ++ Y               + +PY+ L +++     LP+ +DR+RLE HL+  DF  VF+M+   F RL  WK+N+LK+K  L+
Sbjct:  526 HASRTSWQDGDDVDRKTRTSWMNLKTEIDGQSPELDPRTSTHSLPTDMSQPNFPYNKSASLPGYGRNGIYKAADLGEDEADHDSSWSGMREY---------------KVYPYDMLAVSHRVRVKLPRDVDRTRLERHLSPEDFYNVFRMTIEQFDRLALWKKNELKKKARLF 682          
BLAST of Actin-binding LIM protein vs. Ensembl Zebrafish
Match: BX465192.1 (actin binding LIM protein family, member 2 [Source:NCBI gene;Acc:568454])

HSP 1 Score: 115.931 bits (289), Expect = 3.328e-26
Identity = 56/134 (41.79%), Postives = 77/134 (57.46%), Query Frame = 3
Query:   66 Y*TFLKFDVHFQLLLFIMGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            Y TF +  VH  L     G + C+ C K CKG+VL++  K  H  CF C  C  +L +GGFF R   Y C+ DYQ+LYG +C  C ++ +GEVV+ LG T+H +CF C  C  PF  GD+ T    + +C +C 
Sbjct:    8 YSTFHQQAVHSPLE---HGPVPCQNCGKPCKGEVLRVQNKHFHIKCFVCKVCECDLAQGGFFVRQGEYICTVDYQRLYGTRCFSCEEFIEGEVVSALGKTYHPRCFVCATCKQPFPAGDRVTFNGKECICEKCT 138          

HSP 2 Score: 61.2326 bits (147), Expect = 5.946e-9
Identity = 27/68 (39.71%), Postives = 43/68 (63.24%), Query Frame = 3
Query: 2181 IPAETFPYEKLKINN---FSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            +    +PY+ L +++     LP+ +DR+RLE HL+  DF  VF+M+   F RL  WK+N+LK+K  L+
Sbjct:  492 VSISVYPYDMLAVSHRVRVKLPRDVDRTRLERHLSPEDFYNVFRMTIEQFDRLALWKKNELKKKARLF 559          

HSP 3 Score: 60.8474 bits (146), Expect = 7.061e-9
Identity = 40/129 (31.01%), Postives = 65/129 (50.39%), Query Frame = 3
Query:  150 KCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCH---RCASVKQEKENIVPPLSSQKSIT 527
            K +  ++ LD+ + H GCF C  CNK L    +  +D   +C  DY  ++G++C  C KY  G+V+      +H  C +C  C+  F  G++  L  G  + H   R A+  +EK  +    +S +SIT
Sbjct:  163 KSEQSLVALDKHW-HLGCFKCKVCNKVL-NAEYISKDGIPYCEADYHAMFGIQCETCKKYITGKVLEAGEKHYHPTCARCARCDQMFGEGEEMYL-QGSSIWHPPCRQAARMEEKSKVT--RTSSESIT 286          
BLAST of Actin-binding LIM protein vs. Ensembl Zebrafish
Match: ablim2 (actin binding LIM protein family, member 2 [Source:ZFIN;Acc:ZDB-GENE-100316-5])

HSP 1 Score: 115.161 bits (287), Expect = 5.696e-26
Identity = 50/116 (43.10%), Postives = 70/116 (60.34%), Query Frame = 3
Query:  120 GKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            G + C+ C K CKG+VL++  K  H  CF C  C  +L +GGFF R   Y C+ DYQ+LYG +C  C ++ +GEVV+ LG T+H +CF C  C  PF  GD+ T    + +C +C 
Sbjct:   17 GPVPCQNCGKPCKGEVLRVQNKHFHIKCFVCKVCGCDLAQGGFFVRQGEYICTVDYQRLYGTRCFSCEEFIEGEVVSALGKTYHPRCFVCATCKQPFPAGDRVTFNGKECICEKCT 132          

HSP 2 Score: 61.2326 bits (147), Expect = 5.543e-9
Identity = 27/68 (39.71%), Postives = 43/68 (63.24%), Query Frame = 3
Query: 2181 IPAETFPYEKLKINN---FSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            +    +PY+ L +++     LP+ +DR+RLE HL+  DF  VF+M+   F RL  WK+N+LK+K  L+
Sbjct:  491 VSISVYPYDMLAVSHRVRVKLPRDVDRTRLERHLSPEDFYNVFRMTIEQFDRLALWKKNELKKKARLF 558          

HSP 3 Score: 60.4622 bits (145), Expect = 8.894e-9
Identity = 39/124 (31.45%), Postives = 63/124 (50.81%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCH---RCASVKQEKENIVPPLSSQKSIT 527
            ++ LD+ + H GCF C  CNK L    +  +D   +C  DY  ++G++C  C KY  G+V+      +H  C +C  C+  F  G++  L  G  + H   R A+  +EK  +    +S +SIT
Sbjct:  162 LVALDKHW-HLGCFKCKVCNKVL-NAEYISKDGIPYCEADYHAMFGIQCETCKKYITGKVLEAGEKHYHPTCARCARCDQMFGEGEEMYL-QGSTIWHPPCRQAARMEEKSKVT--RTSSESIT 280          
BLAST of Actin-binding LIM protein vs. Ensembl Zebrafish
Match: BX465192.1 (actin binding LIM protein family, member 2 [Source:NCBI gene;Acc:568454])

HSP 1 Score: 114.775 bits (286), Expect = 6.889e-26
Identity = 50/116 (43.10%), Postives = 70/116 (60.34%), Query Frame = 3
Query:  120 GKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            G + C+ C K CKG+VL++  K  H  CF C  C  +L +GGFF R   Y C+ DYQ+LYG +C  C ++ +GEVV+ LG T+H +CF C  C  PF  GD+ T    + +C +C 
Sbjct:   16 GPVPCQNCGKPCKGEVLRVQNKHFHIKCFVCKVCECDLAQGGFFVRQGEYICTVDYQRLYGTRCFSCEEFIEGEVVSALGKTYHPRCFVCATCKQPFPAGDRVTFNGKECICEKCT 131          

HSP 2 Score: 60.8474 bits (146), Expect = 6.508e-9
Identity = 27/64 (42.19%), Postives = 42/64 (65.62%), Query Frame = 3
Query: 2193 TFPYEKLKINN---FSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
             +PY+ L +++     LP+ +DR+RLE HL+  DF  VF+M+   F RL  WK+N+LK+K  L+
Sbjct:  487 VYPYDMLAVSHRVRVKLPRDVDRTRLERHLSPEDFYNVFRMTIEQFDRLALWKKNELKKKARLF 550          

HSP 3 Score: 60.4622 bits (145), Expect = 8.280e-9
Identity = 40/129 (31.01%), Postives = 65/129 (50.39%), Query Frame = 3
Query:  150 KCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCH---RCASVKQEKENIVPPLSSQKSIT 527
            K +  ++ LD+ + H GCF C  CNK L    +  +D   +C  DY  ++G++C  C KY  G+V+      +H  C +C  C+  F  G++  L  G  + H   R A+  +EK  +    +S +SIT
Sbjct:  156 KSEQSLVALDKHW-HLGCFKCKVCNKVLN-AEYISKDGIPYCEADYHAMFGIQCETCKKYITGKVLEAGEKHYHPTCARCARCDQMFGEGEEMYL-QGSSIWHPPCRQAARMEEKSKVT--RTSSESIT 279          
BLAST of Actin-binding LIM protein vs. Ensembl Zebrafish
Match: BX465192.1 (actin binding LIM protein family, member 2 [Source:NCBI gene;Acc:568454])

HSP 1 Score: 114.775 bits (286), Expect = 7.580e-26
Identity = 50/116 (43.10%), Postives = 70/116 (60.34%), Query Frame = 3
Query:  120 GKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            G + C+ C K CKG+VL++  K  H  CF C  C  +L +GGFF R   Y C+ DYQ+LYG +C  C ++ +GEVV+ LG T+H +CF C  C  PF  GD+ T    + +C +C 
Sbjct:   17 GPVPCQNCGKPCKGEVLRVQNKHFHIKCFVCKVCECDLAQGGFFVRQGEYICTVDYQRLYGTRCFSCEEFIEGEVVSALGKTYHPRCFVCATCKQPFPAGDRVTFNGKECICEKCT 132          

HSP 2 Score: 61.2326 bits (147), Expect = 4.999e-9
Identity = 44/139 (31.65%), Postives = 70/139 (50.36%), Query Frame = 3
Query:  126 IQCEICRKKCKGD--VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCH---RCASVKQEKENIVPPLSSQKSIT 527
            I C  C K+ K +  ++ LD+ + H GCF C  CNK L    +  +D   +C  DY  ++G++C  C KY  G+V+      +H  C +C  C+  F  G++  L  G  + H   R A+  +EK  +    +S +SIT
Sbjct:  146 INCCGCGKEFKSEQSLVALDKHW-HLGCFKCKVCNKVL-NAEYISKDGIPYCEADYHAMFGIQCETCKKYITGKVLEAGEKHYHPTCARCARCDQMFGEGEEMYL-QGSSIWHPPCRQAARMEEKSKVT--RTSSESIT 279          

HSP 3 Score: 60.8474 bits (146), Expect = 6.093e-9
Identity = 27/68 (39.71%), Postives = 43/68 (63.24%), Query Frame = 3
Query: 2181 IPAETFPYEKLKINN---FSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            +    +PY+ L +++     LP+ +DR+RLE HL+  DF  VF+M+   F RL  WK+N+LK+K  L+
Sbjct:  485 VSISVYPYDMLAVSHRVRVKLPRDVDRTRLERHLSPEDFYNVFRMTIEQFDRLALWKKNELKKKARLF 552          
BLAST of Actin-binding LIM protein vs. Ensembl Xenopus
Match: uck2 (uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-GENE-942591])

HSP 1 Score: 111.694 bits (278), Expect = 1.801e-24
Identity = 48/116 (41.38%), Postives = 67/116 (57.76%), Query Frame = 3
Query:  120 GKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            G IQC  C + CKG+V+++     H  CF C  CN +L + GFF ++  Y C+ DYQ+LYG +C  C  +  GEV++ LG T+H +CF C  C  PF  GDK T      +C  C+
Sbjct:   16 GPIQCYRCGETCKGEVVRVQTNHFHIRCFTCQVCNCDLAQSGFFFKNGEYICTRDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSICRKPFPIGDKVTFRGKDCVCQNCS 131          

HSP 2 Score: 65.0846 bits (157), Expect = 5.025e-10
Identity = 40/139 (28.78%), Postives = 62/139 (44.60%), Query Frame = 3
Query:  114 IMGKIQCEICRKKCK-GDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSIT 527
            I G   C  C+++ K G  L   +K  H  CF C  C   L  G +  +D   +C  DY   +G+KC  CNKY  G V+   G  +H  C +C  C   F  G++  L   +     C    + ++ +    +S+ SI+
Sbjct:  142 IHGPSHCAGCKEEIKQGQSLLALEKQWHVSCFKCQTCGIVL-TGEYISKDGVPYCESDYHAQFGIKCETCNKYISGRVLEAGGKHYHPTCARCVRCQQMFSEGEEMYLTGSEVWHPICKQAARAEKKLKYRRASETSIS 279          

HSP 3 Score: 60.077 bits (144), Expect = 1.974e-8
Identity = 29/64 (45.31%), Postives = 40/64 (62.50%), Query Frame = 3
Query: 2193 TFPYEKLKINNFS---LPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
             +PYE L +       LPK +DR+RLE HL+  +F  VF M+ S F RL  WKRN+LK++  L+
Sbjct:  594 IYPYELLVVTTRGRNRLPKDVDRTRLERHLSAEEFYQVFGMTISEFDRLALWKRNELKKQARLF 657          
BLAST of Actin-binding LIM protein vs. Ensembl Xenopus
Match: uck2 (uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-GENE-942591])

HSP 1 Score: 111.694 bits (278), Expect = 2.159e-24
Identity = 48/116 (41.38%), Postives = 67/116 (57.76%), Query Frame = 3
Query:  120 GKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            G IQC  C + CKG+V+++     H  CF C  CN +L + GFF ++  Y C+ DYQ+LYG +C  C  +  GEV++ LG T+H +CF C  C  PF  GDK T      +C  C+
Sbjct:   16 GPIQCYRCGETCKGEVVRVQTNHFHIRCFTCQVCNCDLAQSGFFFKNGEYICTRDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSICRKPFPIGDKVTFRGKDCVCQNCS 131          

HSP 2 Score: 64.6994 bits (156), Expect = 6.548e-10
Identity = 40/139 (28.78%), Postives = 62/139 (44.60%), Query Frame = 3
Query:  114 IMGKIQCEICRKKCK-GDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSIT 527
            I G   C  C+++ K G  L   +K  H  CF C  C   L  G +  +D   +C  DY   +G+KC  CNKY  G V+   G  +H  C +C  C   F  G++  L   +     C    + ++ +    +S+ SI+
Sbjct:  142 IHGPSHCAGCKEEIKQGQSLLALEKQWHVSCFKCQTCGIVL-TGEYISKDGVPYCESDYHAQFGIKCETCNKYISGRVLEAGGKHYHPTCARCVRCQQMFSEGEEMYLTGSEVWHPICKQAARAEKKLKYRRASETSIS 279          
BLAST of Actin-binding LIM protein vs. Ensembl Xenopus
Match: uck2 (uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-GENE-942591])

HSP 1 Score: 108.997 bits (271), Expect = 6.929e-24
Identity = 48/116 (41.38%), Postives = 67/116 (57.76%), Query Frame = 3
Query:  120 GKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            G IQC  C + CKG+V+++     H  CF C  CN +L + GFF ++  Y C+ DYQ+LYG +C  C  +  GEV++ LG T+H +CF C  C  PF  GDK T      +C  C+
Sbjct:   18 GPIQCYRCGETCKGEVVRVQTNHFHIRCFTCQVCNCDLAQSGFFFKNGEYICTRDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSICRKPFPIGDKVTFRGKDCVCQNCS 133          

HSP 2 Score: 64.3142 bits (155), Expect = 8.144e-10
Identity = 40/139 (28.78%), Postives = 62/139 (44.60%), Query Frame = 3
Query:  114 IMGKIQCEICRKKCK-GDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSIT 527
            I G   C  C+++ K G  L   +K  H  CF C  C   L  G +  +D   +C  DY   +G+KC  CNKY  G V+   G  +H  C +C  C   F  G++  L   +     C    + ++ +    +S+ SI+
Sbjct:  144 IHGPSHCAGCKEEIKQGQSLLALEKQWHVSCFKCQTCGIVL-TGEYISKDGVPYCESDYHAQFGIKCETCNKYISGRVLEAGGKHYHPTCARCVRCQQMFSEGEEMYLTGSEVWHPICKQAARAEKKLKYRRASETSIS 281          
BLAST of Actin-binding LIM protein vs. Ensembl Xenopus
Match: uck2 (uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-GENE-942591])

HSP 1 Score: 109.383 bits (272), Expect = 7.563e-24
Identity = 48/116 (41.38%), Postives = 67/116 (57.76%), Query Frame = 3
Query:  120 GKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            G IQC  C + CKG+V+++     H  CF C  CN +L + GFF ++  Y C+ DYQ+LYG +C  C  +  GEV++ LG T+H +CF C  C  PF  GDK T      +C  C+
Sbjct:   16 GPIQCYRCGETCKGEVVRVQTNHFHIRCFTCQVCNCDLAQSGFFFKNGEYICTRDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSICRKPFPIGDKVTFRGKDCVCQNCS 131          

HSP 2 Score: 64.6994 bits (156), Expect = 7.181e-10
Identity = 40/139 (28.78%), Postives = 62/139 (44.60%), Query Frame = 3
Query:  114 IMGKIQCEICRKKCK-GDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSIT 527
            I G   C  C+++ K G  L   +K  H  CF C  C   L  G +  +D   +C  DY   +G+KC  CNKY  G V+   G  +H  C +C  C   F  G++  L   +     C    + ++ +    +S+ SI+
Sbjct:  142 IHGPSHCAGCKEEIKQGQSLLALEKQWHVSCFKCQTCGIVL-TGEYISKDGVPYCESDYHAQFGIKCETCNKYISGRVLEAGGKHYHPTCARCVRCQQMFSEGEEMYLTGSEVWHPICKQAARAEKKLKYRRASETSIS 279          

HSP 3 Score: 60.077 bits (144), Expect = 1.912e-8
Identity = 29/64 (45.31%), Postives = 40/64 (62.50%), Query Frame = 3
Query: 2193 TFPYEKLKINNFS---LPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
             +PYE L +       LPK +DR+RLE HL+  +F  VF M+ S F RL  WKRN+LK++  L+
Sbjct:  560 IYPYELLVVTTRGRNRLPKDVDRTRLERHLSAEEFYQVFGMTISEFDRLALWKRNELKKQARLF 623          
BLAST of Actin-binding LIM protein vs. Ensembl Xenopus
Match: uck2 (uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-GENE-942591])

HSP 1 Score: 108.997 bits (271), Expect = 8.251e-24
Identity = 48/116 (41.38%), Postives = 67/116 (57.76%), Query Frame = 3
Query:  120 GKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            G IQC  C + CKG+V+++     H  CF C  CN +L + GFF ++  Y C+ DYQ+LYG +C  C  +  GEV++ LG T+H +CF C  C  PF  GDK T      +C  C+
Sbjct:   16 GPIQCYRCGETCKGEVVRVQTNHFHIRCFTCQVCNCDLAQSGFFFKNGEYICTRDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSICRKPFPIGDKVTFRGKDCVCQNCS 131          

HSP 2 Score: 63.929 bits (154), Expect = 9.817e-10
Identity = 40/139 (28.78%), Postives = 62/139 (44.60%), Query Frame = 3
Query:  114 IMGKIQCEICRKKCK-GDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSIT 527
            I G   C  C+++ K G  L   +K  H  CF C  C   L  G +  +D   +C  DY   +G+KC  CNKY  G V+   G  +H  C +C  C   F  G++  L   +     C    + ++ +    +S+ SI+
Sbjct:  142 IHGPSHCAGCKEEIKQGQSLLALEKQWHVSCFKCQTCGIVL-TGEYISKDGVPYCESDYHAQFGIKCETCNKYISGRVLEAGGKHYHPTCARCVRCQQMFSEGEEMYLTGSEVWHPICKQAARAEKKLKYRRASETSIS 279          
BLAST of Actin-binding LIM protein vs. Ensembl Mouse
Match: Ablim1 (actin-binding LIM protein 1 [Source:MGI Symbol;Acc:MGI:1194500])

HSP 1 Score: 119.013 bits (297), Expect = 9.876e-27
Identity = 50/114 (43.86%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            I C  C + CKG+VL++  K  H  CF C  C  +L +GGFF ++  Y C+ DYQ++YG +C  C ++ +GEVVT LG T+H  CF C  C  PF  GD+ T      LC  CA
Sbjct:   97 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 210          

HSP 2 Score: 88.1965 bits (217), Expect = 3.143e-17
Identity = 93/382 (24.35%), Postives = 161/382 (42.15%), Query Frame = 3
Query:  132 CEICRKKCKGD--VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSI-TESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQ----LHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKH--TPPNAVYCGSNR----NPNTVPPITSHFHRPENFSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKK 1238
            C  C +  K    +L LD+++ H GCF C  C K L  G +  +D   +C +DYQ L+GVKC  C+++  G+V+      +H  C +C  CN  F  G++  L         C    + +E + P  +S +SI +     +  +    I   V     D  D     ++K    ++    +  E  YTS     ++ +S        SP  S    ++  +R     +S ++G+ N   Y   SY     R  +H   P N    G N      P++ P   ++   P++F +     IN+              ++KP   + +  +  QS      SE++ + + +P  + PDP+  P I+   +P PPSL+ V  D ++
Sbjct:  226 CAGCGRDIKNGQALLALDKQW-HLGCFKCKSCGKVL-TGEYISKDGSPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYEDKQERQSLGESPRTLSPTPSAEGYQD--VRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPGNEPSSGRNSPLPYRPDSRPLTPTYAQAPKHF-HVPDQGINI--------------YRKPPIYKQHAALAAQS----KASEDIIKFSKFPAAQAPDPNEIPKIETDHWPGPPSLAAVGTDPRR 584          

HSP 3 Score: 59.3066 bits (142), Expect = 2.514e-8
Identity = 27/65 (41.54%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 2190 ETFPYEKLKINNFS---LPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + FPYE L + N     + + +DR+RLE HL    F  +F MS   F +LP W+RND+K+K  L+
Sbjct:  713 KIFPYEMLMVTNRGRNKILRDVDRTRLERHLAPEVFWEIFGMSIQEFDKLPLWRRNDMKKKAKLF 777          
BLAST of Actin-binding LIM protein vs. Ensembl Mouse
Match: Ablim1 (actin-binding LIM protein 1 [Source:MGI Symbol;Acc:MGI:1194500])

HSP 1 Score: 117.857 bits (294), Expect = 1.673e-26
Identity = 50/114 (43.86%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            I C  C + CKG+VL++  K  H  CF C  C  +L +GGFF ++  Y C+ DYQ++YG +C  C ++ +GEVVT LG T+H  CF C  C  PF  GD+ T      LC  CA
Sbjct:   21 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 134          

HSP 2 Score: 87.8113 bits (216), Expect = 4.198e-17
Identity = 90/369 (24.39%), Postives = 157/369 (42.55%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSI-TESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQ----LHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKH--TPPNAVYCGSNR----NPNTVPPITSHFHRPENFSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKK 1238
            +L LD+++ H GCF C  C K L  G +  +D   +C +DYQ L+GVKC  C+++  G+V+      +H  C +C  CN  F  G++  L         C    + +E + P  +S +SI +     +  +    I   V     D  D     ++K    ++    +  E  YTS     ++ +S        SP  S    ++  +R     +S ++G+ N   Y   SY     R  +H   P N    G N      P++ P   ++   P++F +     IN+              ++KP   + +  +  QS      SE++ + + +P  + PDP+  P I+   +P PPSL+ V  D ++
Sbjct:  163 LLALDKQW-HLGCFKCKSCGKVL-TGEYISKDGSPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYEDKQERQSLGESPRTLSPTPSAEGYQD--VRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPGNEPSSGRNSPLPYRPDSRPLTPTYAQAPKHF-HVPDQGINI--------------YRKPPIYKQHAALAAQS----KASEDIIKFSKFPAAQAPDPNEIPKIETDHWPGPPSLAAVGTDPRR 508          

HSP 3 Score: 59.6918 bits (143), Expect = 2.180e-8
Identity = 27/65 (41.54%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 2190 ETFPYEKLKINNFS---LPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + FPYE L + N     + + +DR+RLE HL    F  +F MS   F +LP W+RND+K+K  L+
Sbjct:  637 KIFPYEMLMVTNRGRNKILRDVDRTRLERHLAPEVFWEIFGMSIQEFDKLPLWRRNDMKKKAKLF 701          
BLAST of Actin-binding LIM protein vs. Ensembl Mouse
Match: Ablim1 (actin-binding LIM protein 1 [Source:MGI Symbol;Acc:MGI:1194500])

HSP 1 Score: 117.857 bits (294), Expect = 1.690e-26
Identity = 50/114 (43.86%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            I C  C + CKG+VL++  K  H  CF C  C  +L +GGFF ++  Y C+ DYQ++YG +C  C ++ +GEVVT LG T+H  CF C  C  PF  GD+ T      LC  CA
Sbjct:   34 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 147          

HSP 2 Score: 87.8113 bits (216), Expect = 4.396e-17
Identity = 90/369 (24.39%), Postives = 157/369 (42.55%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSI-TESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQ----LHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKH--TPPNAVYCGSNR----NPNTVPPITSHFHRPENFSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKK 1238
            +L LD+++ H GCF C  C K L  G +  +D   +C +DYQ L+GVKC  C+++  G+V+      +H  C +C  CN  F  G++  L         C    + +E + P  +S +SI +     +  +    I   V     D  D     ++K    ++    +  E  YTS     ++ +S        SP  S    ++  +R     +S ++G+ N   Y   SY     R  +H   P N    G N      P++ P   ++   P++F +     IN+              ++KP   + +  +  QS      SE++ + + +P  + PDP+  P I+   +P PPSL+ V  D ++
Sbjct:  176 LLALDKQW-HLGCFKCKSCGKVL-TGEYISKDGSPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYEDKQERQSLGESPRTLSPTPSAEGYQD--VRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPGNEPSSGRNSPLPYRPDSRPLTPTYAQAPKHF-HVPDQGINI--------------YRKPPIYKQHAALAAQS----KASEDIIKFSKFPAAQAPDPNEIPKIETDHWPGPPSLAAVGTDPRR 521          

HSP 3 Score: 59.6918 bits (143), Expect = 2.219e-8
Identity = 27/65 (41.54%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 2190 ETFPYEKLKINNFS---LPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + FPYE L + N     + + +DR+RLE HL    F  +F MS   F +LP W+RND+K+K  L+
Sbjct:  650 KIFPYEMLMVTNRGRNKILRDVDRTRLERHLAPEVFWEIFGMSIQEFDKLPLWRRNDMKKKAKLF 714          
BLAST of Actin-binding LIM protein vs. Ensembl Mouse
Match: Ablim1 (actin-binding LIM protein 1 [Source:MGI Symbol;Acc:MGI:1194500])

HSP 1 Score: 116.701 bits (291), Expect = 4.306e-26
Identity = 50/114 (43.86%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            I C  C + CKG+VL++  K  H  CF C  C  +L +GGFF ++  Y C+ DYQ++YG +C  C ++ +GEVVT LG T+H  CF C  C  PF  GD+ T      LC  CA
Sbjct:   34 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 147          

HSP 2 Score: 88.1965 bits (217), Expect = 3.145e-17
Identity = 88/383 (22.98%), Postives = 153/383 (39.95%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVP---PLSSQKSITESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPS-----YLQIQERITKHTPPNAVYCGSNRNPNTVPPITS----HFHRPEN--FSYRSSPNINMKKGMSLLVNPFGQM---FKKP--------LPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKK 1238
            +L LD+++ H GCF C  C K L  G +  +D   +C +DYQ L+GVKC  C+++  G+V+      +H  C +C  CN  F  G++  L         C    + +E + P   P SS        ++ +   +P +     +++   S     +   P   +   ++N            K +  Y  +     ++    E F  S    K   +      R L+P+     Y  +++R+   +           + ++  P TS    HFHRP N   S R+SP +  +     L   + Q    F  P         P  Y +            SE++ + + +P  + PDP+  P I+   +P PPSL+ V  D ++
Sbjct:  176 LLALDKQW-HLGCFKCKSCGKVL-TGEYISKDGSPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPPNIPRSSSDFFYPKSLIRRTGRSPALQPTRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITY----EPFYTSGYEDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPGNEPSSGRNSP-LPYRPDSRPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHDAAALAAQSKASEDIIKFSKFPAAQAPDPNEIPKIETDHWPGPPSLAAVGTDPRR 551          

HSP 3 Score: 58.9214 bits (141), Expect = 3.103e-8
Identity = 27/65 (41.54%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 2190 ETFPYEKLKINNF---SLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + FPYE L + N     + + +DR+RLE HL    F  +F MS   F +LP W+RND+K+K  L+
Sbjct:  680 KIFPYEMLMVTNRGRNKILRDVDRTRLERHLAPEVFWEIFGMSIQEFDKLPLWRRNDMKKKAKLF 744          
BLAST of Actin-binding LIM protein vs. Ensembl Mouse
Match: Ablim1 (actin-binding LIM protein 1 [Source:MGI Symbol;Acc:MGI:1194500])

HSP 1 Score: 116.316 bits (290), Expect = 4.805e-26
Identity = 50/114 (43.86%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            I C  C + CKG+VL++  K  H  CF C  C  +L +GGFF ++  Y C+ DYQ++YG +C  C ++ +GEVVT LG T+H  CF C  C  PF  GD+ T      LC  CA
Sbjct:   21 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 134          

HSP 2 Score: 72.4034 bits (176), Expect = 2.520e-12
Identity = 37/113 (32.74%), Postives = 58/113 (51.33%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPP 503
            +L LD+++ H GCF C  C K L  G +  +D   +C +DYQ L+GVKC  C+++  G+V+      +H  C +C  CN  F  G++  L         C    + +E + PP
Sbjct:  163 LLALDKQW-HLGCFKCKSCGKVL-TGEYISKDGSPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPP 273          

HSP 3 Score: 59.3066 bits (142), Expect = 2.752e-8
Identity = 27/65 (41.54%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 2190 ETFPYEKLKINNFS---LPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + FPYE L + N     + + +DR+RLE HL    F  +F MS   F +LP W+RND+K+K  L+
Sbjct:  618 KIFPYEMLMVTNRGRNKILRDVDRTRLERHLAPEVFWEIFGMSIQEFDKLPLWRRNDMKKKAKLF 682          
BLAST of Actin-binding LIM protein vs. UniProt/SwissProt
Match: sp|O14639|ABLM1_HUMAN (Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1 PE=1 SV=3)

HSP 1 Score: 118.627 bits (296), Expect = 7.886e-26
Identity = 50/114 (43.86%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            I C  C + CKG+VL++  K  H  CF C  C  +L +GGFF ++  Y C+ DYQ++YG +C  C ++ +GEVVT LG T+H  CF C  C  PF  GD+ T      LC  CA
Sbjct:   97 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 210          

HSP 2 Score: 91.6633 bits (226), Expect = 1.881e-17
Identity = 92/369 (24.93%), Postives = 158/369 (42.82%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSI-TESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQ----LHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKH--TPPNAVYCGSNR----NPNTVPPITSHFHRPENFSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKK 1238
            +L LD+++ H GCF C  C K L  G +  +D   +C +DYQ L+GVKC  C+++  G+V+      +H  C +C  CN  F  G++  L         C    + +E + P  +S +SI +     +  +    I   V     D  D     ++K    ++    +  E  YTS     ++ +S        SP  S    ++  +R     +S ++G+ N   Y   SY     R  +H   P N    G N      P++ P   ++   P++F +     IN+              ++KP   + +  +  QS +    SE++ + + +P  + PDP   P I+   +P PPS +VV  DMK+
Sbjct:  239 LLALDKQW-HLGCFKCKSCGKVL-TGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQD--VRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPGNEPSSGRNSPLPYRPDSRPLTPTYAQAPKHF-HVPDQGINI--------------YRKPPIYKQHAALAAQSKS----SEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAVVGPDMKR 584          

HSP 3 Score: 60.8474 bits (146), Expect = 5.764e-8
Identity = 28/65 (43.08%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 2190 ETFPYEKLKINNFS---LPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + FPYE L + N     + + +DR+RLE HL    F  +F MS   F RLP W+RND+K+K  L+
Sbjct:  714 KIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF 778          
BLAST of Actin-binding LIM protein vs. UniProt/SwissProt
Match: sp|Q6H8Q1|ABLM2_HUMAN (Actin-binding LIM protein 2 OS=Homo sapiens OX=9606 GN=ABLIM2 PE=1 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 8.666e-25
Identity = 49/114 (42.98%), Postives = 69/114 (60.53%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            I C  C   CKG+VL++  K+ H  CF C  C  +L +GGFF R   Y C+ DYQ+LYG +C  C+++ +GEVV+ LG T+H  CF C  C  PF  GD+ T    + +C +C+
Sbjct:   22 ILCNTCGNVCKGEVLRVQDKYFHIKCFVCKACGCDLAEGGFFVRQGEYICTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKCS 135          

HSP 2 Score: 65.855 bits (159), Expect = 1.549e-9
Identity = 31/65 (47.69%), Postives = 42/65 (64.62%), Query Frame = 3
Query: 2190 ETFPYEKLKINN---FSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + +PY+ L + N     LPK +DR+RLE HL+  +F+ VF MS   F RL  WKRNDLK+K  L+
Sbjct:  547 KIYPYDSLIVTNRIRVKLPKDVDRTRLERHLSPEEFQEVFGMSIEEFDRLALWKRNDLKKKALLF 611          
BLAST of Actin-binding LIM protein vs. UniProt/SwissProt
Match: sp|Q8K4G5|ABLM1_MOUSE (Actin-binding LIM protein 1 OS=Mus musculus OX=10090 GN=Ablim1 PE=1 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 1.730e-24
Identity = 50/114 (43.86%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            I C  C + CKG+VL++  K  H  CF C  C  +L +GGFF ++  Y C+ DYQ++YG +C  C ++ +GEVVT LG T+H  CF C  C  PF  GD+ T      LC  CA
Sbjct:   97 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 210          

HSP 2 Score: 73.1738 bits (178), Expect = 1.228e-11
Identity = 37/113 (32.74%), Postives = 58/113 (51.33%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPP 503
            +L LD+++ H GCF C  C K L  G +  +D   +C +DYQ L+GVKC  C+++  G+V+      +H  C +C  CN  F  G++  L         C    + +E + PP
Sbjct:  239 LLALDKQW-HLGCFKCKSCGKVL-TGEYISKDGSPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPP 349          

HSP 3 Score: 59.3066 bits (142), Expect = 2.231e-7
Identity = 27/65 (41.54%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 2190 ETFPYEKLKINNF---SLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + FPYE L + N     + + +DR+RLE HL    F  +F MS   F +LP W+RND+K+K  L+
Sbjct:  797 KIFPYEMLMVTNRGRNKILRDVDRTRLERHLAPEVFWEIFGMSIQEFDKLPLWRRNDMKKKAKLF 861          
BLAST of Actin-binding LIM protein vs. UniProt/SwissProt
Match: sp|Q8BL65|ABLM2_MOUSE (Actin-binding LIM protein 2 OS=Mus musculus OX=10090 GN=Ablim2 PE=1 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 9.833e-24
Identity = 48/114 (42.11%), Postives = 69/114 (60.53%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            I C  C   CKG+VL++  K+ H  CF C  C  +L +GGFF R   + C+ DYQ+LYG +C  C+++ +GEVV+ LG T+H  CF C  C  PF  GD+ T    + +C +C+
Sbjct:   22 ILCNTCGNVCKGEVLRVQNKYFHIRCFVCKACGCDLAEGGFFVRQGEHICTRDYQRLYGTRCFSCDRFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKCS 135          

HSP 2 Score: 65.855 bits (159), Expect = 1.461e-9
Identity = 31/65 (47.69%), Postives = 42/65 (64.62%), Query Frame = 3
Query: 2190 ETFPYEKLKINN---FSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + +PY+ L + N     LPK +DR+RLE HL+  +F+ VF MS   F RL  WKRNDLK+K  L+
Sbjct:  548 KIYPYDSLIVTNRIRVKLPKDVDRTRLERHLSPEEFQEVFGMSIEEFDRLALWKRNDLKKKALLF 612          

HSP 3 Score: 56.9954 bits (136), Expect = 7.957e-7
Identity = 44/155 (28.39%), Postives = 64/155 (41.29%), Query Frame = 3
Query:  159 GDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCH---RCASVKQEK--------ENIVP-PLSSQKSITESDIVVQMTETPIIVRDVMA 587
            G  L    K  H GCF C  C K L    +  +D   +C  DY   +G++C  C KY  G V+      +H  C  C  C   F  G++  L  G  + H   R A+  ++K        E+IV  P SS        I  ++ +  +  RD+ A
Sbjct:  163 GQALVALDKHWHLGCFKCKTCGK-LLNAEYISKDGLPYCEADYHSKFGIRCDGCEKYITGRVLEAGEKHYHPSCALCVRCGQMFSEGEEMYL-QGSSIWHPACRQAARTEDKSKETRTSSESIVSVPASSTSGSPSRVIYAKLGDEILDYRDLAA 315          
BLAST of Actin-binding LIM protein vs. UniProt/SwissProt
Match: sp|Q6KC51|ABLM2_RAT (Actin-binding LIM protein 2 OS=Rattus norvegicus OX=10116 GN=Ablim2 PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 2.538e-22
Identity = 48/114 (42.11%), Postives = 66/114 (57.89%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            I C  C   CKG+VL++  K  H  CF C  C  +L +GGFF R   + C+ DYQ+LYG +C  C+ + +GEVV+ LG T+H  CF C  C  PF  GD+ T      +C +C+
Sbjct:   22 ILCNTCGNVCKGEVLRVQNKHFHIRCFVCKACGCDLAEGGFFVRQGEHICTRDYQRLYGTRCFSCDCFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKDCMCQKCS 135          

HSP 2 Score: 65.855 bits (159), Expect = 1.461e-9
Identity = 31/65 (47.69%), Postives = 42/65 (64.62%), Query Frame = 3
Query: 2190 ETFPYEKLKINN---FSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + +PY+ L + N     LPK +DR+RLE HL+  +F+ VF MS   F RL  WKRNDLK+K  L+
Sbjct:  548 KIYPYDSLIVTNRIRVKLPKDVDRTRLERHLSPEEFQEVFGMSIEEFDRLALWKRNDLKKKALLF 612          

HSP 3 Score: 56.6102 bits (135), Expect = 9.856e-7
Identity = 44/155 (28.39%), Postives = 64/155 (41.29%), Query Frame = 3
Query:  159 GDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCH---RCASVKQEK--------ENIVP-PLSSQKSITESDIVVQMTETPIIVRDVMA 587
            G  L    K  H GCF C  C K L    +  +D   +C  DY   +G++C  C KY  G V+      +H  C  C  C   F  G++  L  G  + H   R A+  ++K        E+IV  P SS        I  ++ +  +  RD+ A
Sbjct:  163 GQALVALDKHWHLGCFKCKTCGK-LLNAEYISKDGLPYCEADYHTKFGIRCDGCEKYITGRVLEAGEKHYHPSCALCVRCGQMFSEGEEMYL-QGSSIWHPACRQAARTEDKSKETRTSSESIVSVPASSTSGSPSRVIYAKLGDEILDYRDLAA 315          
BLAST of Actin-binding LIM protein vs. TrEMBL
Match: A0A068YIX1 (Actin binding lim protein 1 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000983700 PE=4 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 1.118e-74
Identity = 235/834 (28.18%), Postives = 364/834 (43.65%), Query Frame = 3
Query:  117 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA----------------------SVKQEKENIV----------------PPLSSQKSITESDIV--VQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQE----RITKHTPPNAVYCGSNRNPNTVPPIT--SHFHRPENFSYRSSPNINMKKGMSLLVNPFGQMFKKPL------PGQYNRGIRPQSTNDVNLSE------------------EVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGTDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQXXXXXXXXXXXXYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYRVQYSNTGGRTGTLPSAYTSSSENESATRSYRSYHSYYPAPQPGYTQGYLSCTEDSASGRPTNGLNYRASSLPRPLNLYTPVCVNTTNYLLDGHMSPSMTTSGYSVDATTHSIDESTLIGGSGLLNATAHRNGYMSDMAPLSAPYGPKKTRPDWFYESENEAV-----FHS----NYPTVQSYLK--PSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            MGK+ CE+C+++CKG+VLK + KF HK CF C +C  +L+ GGFF ++N+YFC +DYQKL   KC  C +   G++V+ L  +FH  CF C  C +PF  G++ T+W  ++ C  C+                      S +Q  +N                   P+S  +   +S I   VQ T   I+   +  ++   S ++ P          + ++    S    V   +  + +TS   P  S  S + S      GR   ++    YGR+ N SY  I E    R+T     NA++      P T   I+   HFH P+   +   PN  +  GMS     F    +  L       G          TN V  +E                  E +RLA +P G+ PD    P I+RYD+PAP S +V    M  E   ++++ +   G +    Q+ +D         ES ++ S    V     + R +G   G+ + +L + E    + R  +  DP+SASRSP+A +EP  K RY  H+F SPSR+++      H L Y ++  N G R  T  S +     N +A+ S +S+         G   GY +                                         G +S  ++++  S  + +H      L     +L A  H NG + + AP+ +   P +      +  ++EA      FH+    + P+  S +   P  +    E  PA+  PY++L  +    PKG+DR+RLE +L+D++FE VFQ+SR AF RLPEWKRNDLKR+VDL+
Sbjct:    1 MGKVYCEVCKRRCKGNVLKANDKFFHKDCFKCSECKCSLKAGGFFLKNNKYFCQKDYQKLSAPKCKVCGEVLSGDIVSALSYSFHKGCFICSQCKTPFNPGNRVTVWKDEFYCVCCSQSLSSRQAAVAASGGKGPISPLSARQNHDNRQQPQSQQQPRLSFADYPSPVSFAEESMDSRITPPVQKTSGSILKSSLRQSRTMQSVSNAPNSRNSDFGGSVQLQQQKASATLPVGSFQGHLDHTS--VPTSSTFSPQHSQSLHGSGRHPLSE----YGRFYNLSYASIAEQPSRRLTDMYRRNALH-----TPATSNSISHLQHFHIPQGNRFPLEPNRIVPGGMSRTSRSFNSSLRDALMTQPSSAGHLTTVPVTSPTNGVGGAEGVTLSKRSTLVESEAASLEARRLASFPSGQPPDATLVPAIERYDWPAPASTAV----MTAELMRERRQRLREQGVL----QASSD---------ESVEDLSIDTSVGSHCDLDRISG---GIGRAILLEEERVRRKTRTAHLLDPVSASRSPNAKVEPPYKTRYATHSFASPSRESQRSSVSPHRLDYSLELVNLGNRVWTT-SDHHRYRRNGTASHSPQSFRRAVRCNSTGLRPGYTA-----------------------------------------GQLS--LSSAKTSSISGSHCFSSPRL----DVLQANGHTNGKICEDAPIQSQTSPIRRNG---HRVDDEATNLSQDFHTGLLGSVPSYSSVISSTPYTMSTKHEGSPAKEIPYKELVASLGRPPKGIDRTRLEMYLSDSEFEKVFQLSRVAFYRLPEWKRNDLKRRVDLF 752          
BLAST of Actin-binding LIM protein vs. TrEMBL
Match: A0A4S2MDM6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001727 PE=4 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 1.816e-60
Identity = 199/688 (28.92%), Postives = 300/688 (43.60%), Query Frame = 3
Query:  117 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITESDIVVQMTETPIIVRD---------------------------VMANQYDSSDTDGPVRIKPKEC-----------------------LQLH---IENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEES----------FLRSTRGRKSRAKG-------NYNYGRYLNPSYLQIQERITKHTPPNAVYCGSNRNPNTV----PPITSHFHRPENFSYRSSPNINMKKGMSLLVNPFGQ-----------MFKKPLPGQYNRGIRPQSTNDV----------------------------NLSEEV----KRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGTDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKY--SGLSQTVL-DQXXXXXXXXXXXXYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHH-LSYRVQYSNTGGRTGTLPSAYTSSSENESATRSYRSYHSYYPAPQPGYTQGYLSCTEDSASGRPTNGL 1817
            MGKI CE C++KC GDVL++  K+ HKGCF C KC  +LE GGF+ +D+ ++C +DY + +  KC  C K   GE+VT+L  +FH +CF+C +C+  F  GD+ T+W  ++ C  C     ++   VPP++  K  T   ++     +P+ V D                           V  N    S   G  R+   E                        L++H    ++G  STDSG+   +   G  +  +P   F S E +           L ST    + ++        N +YGRYLN SY+ +       +P    Y    RN ++     P    HFH PE+ S    P     +  SLL   FGQ           + +  +P    R   P+  +                              NL EE+    +RLA +P G +PDP+  PPI+RYD+P PP+ +V+L +M +E+  K++      G           T  + GD  ES++  S     E    V      +  SG+ Q ++ +Q    + R R+    DPISASRSP+A++EP  KPRY  H F SPSRD+ +   PA H L Y +++ + G R+ T     +S++ N                 +PGYT G LS  + +AS  PT+ L
Sbjct:    1 MGKIICERCKRKCCGDVLRVSNKYFHKGCFTCSKCKSSLETGGFYMKDDEFYCQKDYHRYFVAKCKACAKDLIGELVTVLDFSFHRECFKCTSCSITFHPGDRVTVWQERFFCPSCVG---QQGAPVPPITPTKHKTNGTLL-----SPLSVTDDEGCCVSAADASLPEFPSPHGSGLSPCVTGNHLTDSKNVGEFRLPSSEAKCMTSTGNPQKSKSILRKSGTDKLRVHESPRDHGGLSTDSGL--GERVFGSKTPEAPVNGFYSQERTNGVNYTTTPPVLSSTTLSLNNSRQSLLGRVPNSDYGRYLNQSYIHLNGGAV--SPSVDKY---KRNVSSTILNSPCRPKHFHLPESKSRFLPPGT---RTSSLL---FGQPTKTQTSSHVGVLRTQIPPPAIRSEAPKMASSAMELRRRPPSEHTLPNGHDNHSGMNGTQENLEEEMTVEARRLACFPSGHKPDPNVPPPIERYDWPGPPASAVILAEMMRERRCKRREQSRVNG-----------TLGDEGDDYESQEALSIDYSYEGGTNVTDAASVHQTSGIGQAIIREQANGQKRRSRSHQLLDPISASRSPNAAVEPLYKPRYSTHQFASPSRDSLHFQLPARHPLGYSMEFVHLGNRSWTTLPTQSSATSNHPI--------------KPGYTGGRLSEDQKTAS-LPTSSL 641          
BLAST of Actin-binding LIM protein vs. TrEMBL
Match: A0A158QFU9 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS9528 PE=4 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 5.515e-59
Identity = 225/814 (27.64%), Postives = 346/814 (42.51%), Query Frame = 3
Query:  186 FIHKGCFNCY-KCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIV------------PPLSSQKSITESDIVVQMTETPIIVRDVMANQYDSSDTDGP--VRIKPKE---------------CLQLHI-ENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYG--RYLNPSYLQIQ---------ERITKHTPPNAVY---CGSNRNPNTVPPITSHFHRPENFSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKK----QRSIVSTGDIF--YDTQSGTDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQXXXXXXXXXXXX-YFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHH---LSYRVQYSNTGGRTGTLPSAYTSSSENESATRSYRSYHSY------YPAPQPGYTQGYLSCTEDSASGRPTNGLNYRASSLPRPLNLYTPVCVNTTNYLLDGHMSPSMTTSGYSVDATTHSIDESTLIGG------SGLLNATAHRNGYMS-DMAPLSAPYG--PKKTRPDW--------------FYESENEAVFHSNYPTVQSYLKPSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
             +H    N   +C K L++  F  RD   FC EDY++ Y +KC  C    +G+VVT LG TFH  C +C +CN     G+K    + ++ C +C   +  ++  +            P   S +         + +  P    D+  ++   S T  P    +K ++                L++ + E    +TDSG+ K      +  + SP YS  SGE++ L   +     A G   Y   RY    + +            R  + +P  +       S R PN +        + + +S  S+PN+N ++  +++ +P       P  G   R + P++   ++   E +RLA YP  K PD +S P IDRYD+PAPPS +VV+ D ++EK  K        I +  D     DTQ+ +   A      + E   +    +E  +  L+ T   SG+S  + + +E  E R R+ +   DP+SASRSP A+ EP    RY  H F  P        RP +    LS R      G     +     SS+ + +  + Y S  S        PAP  G   G LS T        T+GL+                 ++    L +    P +TT   +  A TH    +TL GG      SGL         Y+S  + P+    G  P  T   W                  E+  +    YP VQS+LKP + L + E    +T+PY +LK++     KG+D  R ED+L+  DFE +F+M R+AF RLPEWK++DLKR++DLY
Sbjct:   11 LVHSRAINSIGECGKPLDEQNFQFRDRSLFCPEDYRQEYAIKCAACGSPVEGDVVTALGNTFHTFCLRCFSCNRTIVSGEKTVALNNRFYCEKCVPPQVPRDESMHNHFNNESPSKEPQSESSEKSPSKSKTPKSSSLPRRFGDIFRSKKSRSQTLQPNNRNLKTEDIDTSSKNTTLSNGTGVLRVDVDEKDLATTDSGILKK-----FEQEQSPSYSLYSGEDALLAKRQQEMQAANGGSGYMDIRYAPQVFGETDGGRPEKDRYARYRQLSPAGSSLGRAVSSGRGPNFL------IGKSQTYSSYSTPNVNSRRAETMMRSP-------PRSG---RSMSPEAA--LSAQAEARRLAAYPGAKIPDVNSEPAIDRYDWPAPPSPAVVMIDRRREKAMKSGTLPDAKITTKSDETDESDTQTLSPGTAHSMTPEKDEIATTVSTSLESRISTLKRTTGNSGMSAAIAEYVEEEEKRQRDSSPDLDPVSASRSPSANFEPPYSTRYTNHRFALP--------RPGYTSGILSSRPVSLPRGVNGNAIAPTGWSSTLSPAQRKIYASNTSRPLPINGGPAPLNGSRDGALSLT--------TSGLS-----------------MDGITGLAEPQTMPPLTTMAGTARA-THRARSTTLTGGLPPPSISGLRPTGRRSYNYLSGGVIPMEYSRGRPPLATTNGWRTLRTSSENNRRSAMAADESARLLDEEYPDVQSWLKPPSTLHSPE---PKTYPYAQLKVSADVKLKGIDNRRREDYLSSEDFEELFKMPRTAFQRLPEWKKSDLKRRLDLY 764          
BLAST of Actin-binding LIM protein vs. TrEMBL
Match: A0A075A1D9 (HP domain-containing protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_12597 PE=4 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 2.535e-54
Identity = 157/476 (32.98%), Postives = 244/476 (51.26%), Query Frame = 3
Query: 1113 EVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGTDTAAELGD-----FPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQXXXXXXXXXXXXYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYRVQYSNTGGRTGTLPSAYTSSSENESATRSYRSYHSYYPAPQPGYTQGYLSCTEDSASGRPTNGLNYRASSLPR-----PLN--------LYTPV-CVNTTNYLLDGHMSPSMTTSGY-----------SVDATTHSIDESTLIGGSGLLNATAHRNGYM-------------SDMAPLSAPYGPKK-----TRPD--------WFYESENEAVFHSNYPTVQSYLKPSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDL 2372
            E +RLA YP+ + PD  S P I+R+DFPAPPS +VV+ + ++EK    +RS V T D    ++ GT   A+L D      P S   K    +++  ++ L+  G+ SG++  ++ +LE ++         DPISASRSP+A  EPS K RY+RH F+SPSRD R + R AH LSYR+ YS TGGR+GT+P   ++     ++   Y    S  P P      G L+     +      G  +R+S+L       PL+        +Y     + + ++ L    S   T +G+           S+ A+  S+D  T+  G         R+ Y+             + + P+SA    ++     +RP           + S+++     +YP+VQS+L+PS+    ++K   +  PYE+L+++     KG+DR+RLE++L+  +FE +F M   AF RLPEWKRNDLKRKVDL
Sbjct:   25 EARRLASYPNARIPDSTSLPAIERFDFPAPPSPAVVMIEKRREKRLTGKRSNVGTLD-SEQSRDGTMIGADLTDTELSALPPSVSLK--LHQIDSEIETLKRLGESSGITGALIQELEASKLVYARAPELDPISASRSPNAGTEPSYKTRYERHVFSSPSRDTRRDHRAAHSLSYRMDYSCTGGRSGTIPIVASTPRPGYTSGALYGRAVSL-PRPALAGVNGDLTNASGPSQSVLPGGSAFRSSTLAATKHDAPLHTERTGGKLVYAGAGLLGSGDHTLTTDESLHTTLAGFESQAGVTEAVGSLTASAISMDGLTVCSGDDGTTLAPSRSAYVIKSGTLTGLPPSVTGLRPVSAMLKQQQQQFLSSRPRSRTLTPVRHGFASDSDMTDIDSYPSVQSWLRPSS---AQKKTSFKICPYEQLRVSAQRPLKGLDRTRLENYLSSTEFEALFGMPMHAFQRLPEWKRNDLKRKVDL 493          
BLAST of Actin-binding LIM protein vs. TrEMBL
Match: A0A4E0RGA4 (Villin-2 OS=Fasciola hepatica OX=6192 GN=D915_001323 PE=4 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.341e-53
Identity = 183/565 (32.39%), Postives = 276/565 (48.85%), Query Frame = 3
Query:  927 PPITSHFHRP-ENFSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQR--------SIVSTGDIFYDTQSGTDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQXXXXXXXXXXXXYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYRVQYSNTGGRTGTLPSAYTSSSENESATRSYRSYHSYYPAPQPGYTQGYLSCTEDS-------ASGRPTNGLNYRASSLPRPLNLYTPVC---------------------------------VNTTNYLL-------------DGHMSPSMTTSGYSVDA-TTHSIDESTLIGGSGLLNATAHRNGYMSDMAP----------------LSAPYGPKKTRP----DWFYESENEAVFHSNYPTVQSYLKPSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDL 2372
            P  TS F  P +   YRS+PN++ K+GM  L     +   +P P + +R + P S  +     E +RLA YP+ + PD  S P I+RYDFPAPPS +VV+ D ++EK    QR        S V  G     T   TDT  EL D P   +  ++  +++  ++ L+  G+ SG++  ++ +L+ ++         DP+SASRSP A+ EP  K RY+RH F SPSRD R + R AH LSYR+ YS+TGGR+GT+PS  +                     P+PGYT G L     S        +G  T   N+ AS+   PL+   P                                   +NT   LL             DG  S  + TS  SVD  T  S D++  +G SG       ++G M+ + P                L+  +  +   P      +  S++E +   +YP+VQS+L+PS+    ++K+  +T+PYE+L+ +     KG+DR+RLE++L+ ++FE +F+M  SAF RLPEWKR DLK++++L
Sbjct:  419 PSRTSPFALPSDTHPYRSTPNVHAKRGMVALA----ESLVRPRP-RPDRSLSPDSAAE--YWAEARRLACYPNARLPDSTSLPAIERYDFPAPPSPAVVMIDKRREKRLTAQRKKAADTLDSTVPNGGTM--TSELTDT--ELSDLPA--NITAKLHQIDSEIETLKRLGESSGITAALIQELQASKLVHARGPDLDPVSASRSPSANTEPGYKTRYERHVFASPSRDTRRDRRTAHELSYRMDYSSTGGRSGTIPSCAS--------------------IPRPGYTSGALYSRAVSLPRPVAVGAGGDTGQSNHLASTPRMPLSSAGPRVTGPGHLRAGVGLRPGERLLYSGGMLDSVSGDRTLNTDESLLTTLAGAESQQLTHDGIAS--LATSALSVDGLTVCSGDDTGTLGPSG--GTYCIKSGTMTGLPPSVTGLRPISSMLKQRSLTTRHRSRTQTPVRHAGAYGVSDSEILDVDSYPSVQSWLRPSS----QKKMSFKTYPYEQLRSSATQPIKGLDRTRLENYLSLDEFESLFRMPLSAFQRLPEWKRFDLKKRLEL 942          

HSP 2 Score: 166.392 bits (420), Expect = 3.924e-38
Identity = 103/293 (35.15%), Postives = 145/293 (49.49%), Query Frame = 3
Query:  117 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASV----------KQEKENIVP-----------PLSSQKSITESDIVVQMTETPIIVR-------DVMANQYDSSDTDGPVRIKPKECLQLHI---ENGYTST--DSGVEKTKSEMGY-----------TSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQER 863
            MGK+ C +C K+CKGD LK+++KF+H  CF+C KC KNL+KGGFF R+ R++C +DYQ  +GV C  C+ Y +GE VT+LG TFH  CF+C  C   F  G++ T+ DG Y C  CA+             E E++ P           P   +K    S +       P  +R         +    DSS T+G V+  P    QL +   ENGY +   D G +KT +               T   +P  +FS   ESF  S   R++   G  +YGR+   SYL + E+
Sbjct:    1 MGKVFCSVCNKRCKGDTLKIEEKFVHHKCFHCTKCKKNLQKGGFFVREQRFYCPDDYQNSFGVTCEACHAYVEGEAVTVLGKTFHTHCFRCSTCGRLFSSGERTTIIDGTYYCVSCATQISNGLPSSHPTSELESVTPSLSSPSKSKTYPERGRKDTISSTVSWSQKTLPSGLRPGAPPDASQVDEPVDSSLTNGVVKEYPLVSDQLTVQIHENGYLNAVPDLGKQKTATPSNTFGPAGDRGTMDTMFSTPGQTFSG--ESFTYSGSERRTCPPG-VDYGRHYPISYLHLAEQ 290          
BLAST of Actin-binding LIM protein vs. Ensembl Cavefish
Match: ablim1b (actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-GENE-050327-91])

HSP 1 Score: 116.701 bits (291), Expect = 2.537e-26
Identity = 50/114 (43.86%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            IQC  C + CKG+VL++  +  H  CF C  C  +L +GGFF ++  Y C+ DYQ+L+G +C  C  + +GEVVT LG T+H  CF C  C  PF  GD+ T      LC RC 
Sbjct:   20 IQCYKCGEPCKGEVLRVQSRHFHIKCFTCKVCGCDLAQGGFFMKNGEYLCTLDYQRLHGTRCNGCGDFVEGEVVTALGKTYHPACFVCTICKRPFPAGDRVTFNGKDCLCQRCV 133          

HSP 2 Score: 63.929 bits (154), Expect = 7.306e-10
Identity = 38/120 (31.67%), Postives = 57/120 (47.50%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSI 524
            +L LD+++ H GCF C  C K L  G +  +D   +C  DYQ  +GV+C  C ++  G+V+      +H  C +C  CN  F  G++  L         C    +  E   P  SS +SI
Sbjct:  162 LLALDRQW-HLGCFKCKACGKVLS-GEYISKDGAPYCERDYQIHFGVQCEACQQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKGNARVDEKHRPTRSSSESI 279          

HSP 3 Score: 58.5362 bits (140), Expect = 3.375e-8
Identity = 25/48 (52.08%), Postives = 33/48 (68.75%), Query Frame = 3
Query: 2232 LPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            LPK +DR+RLE HL+   F  +F+M    F RLP WKRND+K+K  L+
Sbjct:  605 LPKDVDRTRLERHLSSEVFFNIFRMEIHEFDRLPLWKRNDMKKKAKLF 652          
BLAST of Actin-binding LIM protein vs. Ensembl Cavefish
Match: ablim1b (actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-GENE-050327-91])

HSP 1 Score: 115.161 bits (287), Expect = 7.300e-26
Identity = 49/113 (43.36%), Postives = 66/113 (58.41%), Query Frame = 3
Query:  129 QCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            QC  C + CKG+VL++  +  H  CF C  C  +L +GGFF ++  Y C+ DYQ+L+G +C  C  + +GEVVT LG T+H  CF C  C  PF  GD+ T      LC RC 
Sbjct:    1 QCYKCGEPCKGEVLRVQSRHFHIKCFTCKVCGCDLAQGGFFMKNGEYLCTLDYQRLHGTRCNGCGDFVEGEVVTALGKTYHPACFVCTICKRPFPAGDRVTFNGKDCLCQRCV 113          

HSP 2 Score: 74.7146 bits (182), Expect = 3.442e-13
Identity = 91/379 (24.01%), Postives = 151/379 (39.84%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSI-TESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESF-LRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKHTPPNAVYCGSNRNPNTVPPITSHFHRPENFSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQS---TNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMK------KEKEYKKQRSI 1268
            +L LD+++ H GCF C  C K L  G +  +D   +C  DYQ  +GV+C  C ++  G+V+      +H  C +C  CN  F  G++  L         C    +  E   P  SS +SI +     +  +    I   V     D  D     R+K        IE     +   +  T S +    +HSP      GE +  L  T      A G Y+    +      +Q   ++ +  + VY   N  P ++     HFHRP         +    +  +  ++   + F   +P Q+ +   P S         S+++ + + +P    P PD  P I+   +P PPSL+ +  DM+      +E E  K+R +
Sbjct:  142 LLALDRQW-HLGCFKCKACGKVLS-GEYISKDGAPYCERDYQIHFGVQCEACQQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKGNARVDEKHRPTRSSSESICSRPGSSIPGSPGHTIYAKVDNEIIDYRDLAAIPRVKAI----YDIERPDMISYESLHSTFSTLDRQGRHSP------GEVTLKLLIT----ILANGCYDMRERI------MQRSTSQGSIGSPVYSRHNYTP-SLSKSPQHFHRPGTEPSSGRSSPLSSRPATPTLSLTPKHFH--IPVQFPQNTNPDSAALAAQSKSSDDIIKSSKFPAAHAPRPDETPKIETDYWPCPPSLAALGTDMRSRSRDEEEDESVKRRQL 495          

HSP 3 Score: 66.2402 bits (160), Expect = 1.465e-10
Identity = 34/76 (44.74%), Postives = 45/76 (59.21%), Query Frame = 3
Query: 2160 ILRTKEKIP-AETFPYEKLKINN---FSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            IL  K   P  + +PYE L + N     LPK +DR+RLE HL+   F  +F+M    F RLP WKRND+K+K  L+
Sbjct:  580 ILHNKTIPPFVKVYPYEMLTVTNRGRAKLPKDVDRTRLERHLSSEVFFNIFRMEIHEFDRLPLWKRNDMKKKAKLF 655          
BLAST of Actin-binding LIM protein vs. Ensembl Cavefish
Match: ablim1a (actin binding LIM protein 1a [Source:ZFIN;Acc:ZDB-GENE-080219-41])

HSP 1 Score: 115.161 bits (287), Expect = 7.857e-26
Identity = 50/114 (43.86%), Postives = 68/114 (59.65%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            IQC  C + CKG+VL++  K  H  CF C  C  +L +GGFF ++  Y C+ DYQ+++G +C  C ++ +GEVVT LG T+H  CF C  C  PF  GD+ T      LC  CA
Sbjct:   44 IQCYKCGEPCKGEVLRVQNKHFHIKCFTCKVCGCDLAQGGFFMKNGDYLCTLDYQRIHGTRCNSCGEFVEGEVVTALGKTYHPACFVCTICKRPFPAGDRVTFNGKDCLCQYCA 157          

HSP 2 Score: 69.707 bits (169), Expect = 1.179e-11
Identity = 71/295 (24.07%), Postives = 120/295 (40.68%), Query Frame = 3
Query:  132 CEICRKKCK-GDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITE-----------SDIVVQMTETPIIVRDVMANQYDSS--DTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESF-LRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKH-----TPPNAVYCGSNRNPNTVPPITSHFHRP 956
            C  C +  K G  L   ++  H GCF C  C K L  G +  +D   +C +DYQ  +GVKC  C+++  G+V+      +H  C +C  CN  F  G++  L         C S  + +E   P  SS +S+               I  ++    +  RD+ A     +  D + P  I  +      ++   T     V + K +   +S+     S +   +S+ +R    ++S ++G+     Y   SY     R  +H     T P++       + ++VPP   HFH P
Sbjct:  181 CAGCGRDIKNGQALLALERQWHLGCFKCKACGKVL-TGEYISKDGAPYCEKDYQIHFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPGCKSSTRTEERHRPTRSSSESMCSRPGSSIPGSPGHTIYAKVDNEILDYRDLAAIPKVKAIYDIERPDLINYEPLYTTSLDE--TEERESVGEVKHQRDLSSKTPRTMSPTPSADSYDIRGHILQRSTSQGSIGSPIYSRHSYTPTMSRSPQHFHRPGTEPSSGRSSPGASTSSVPPTPKHFHLP 472          

HSP 3 Score: 63.1586 bits (152), Expect = 1.276e-9
Identity = 29/65 (44.62%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 2190 ETFPYEKLKINNFS---LPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + +PYE L +       LP+ +DR+RLE HL    F  +F M    F RLP WKRND+K+KV L+
Sbjct:  598 KVYPYEMLMVTGRGRSKLPRDVDRTRLERHLAPETFFDIFGMEMKEFDRLPLWKRNDMKKKVRLF 662          
BLAST of Actin-binding LIM protein vs. Ensembl Cavefish
Match: ablim1b (actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-GENE-050327-91])

HSP 1 Score: 114.39 bits (285), Expect = 1.719e-25
Identity = 50/114 (43.86%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            IQC  C + CKG+VL++  +  H  CF C  C  +L +GGFF ++  Y C+ DYQ+L+G +C  C  + +GEVVT LG T+H  CF C  C  PF  GD+ T      LC RC 
Sbjct:   23 IQCYKCGEPCKGEVLRVQSRHFHIKCFTCKVCGCDLAQGGFFMKNGEYLCTLDYQRLHGTRCNGCGDFVEGEVVTALGKTYHPACFVCTICKRPFPAGDRVTFNGKDCLCQRCV 136          

HSP 2 Score: 63.5438 bits (153), Expect = 1.052e-9
Identity = 32/96 (33.33%), Postives = 51/96 (53.12%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDK-----ATLW 437
            +L LD+++ H GCF C  C K L  G +  +D   +C  DYQ  +GV+C  C ++  G+V+      +H  C +C  CN  F  G++     +T+W
Sbjct:  165 LLALDRQW-HLGCFKCKACGKVLS-GEYISKDGAPYCERDYQIHFGVQCEACQQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVW 258          
BLAST of Actin-binding LIM protein vs. Ensembl Cavefish
Match: ablim1b (actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-GENE-050327-91])

HSP 1 Score: 114.39 bits (285), Expect = 1.736e-25
Identity = 50/114 (43.86%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCA 467
            IQC  C + CKG+VL++  +  H  CF C  C  +L +GGFF ++  Y C+ DYQ+L+G +C  C  + +GEVVT LG T+H  CF C  C  PF  GD+ T      LC RC 
Sbjct:   20 IQCYKCGEPCKGEVLRVQSRHFHIKCFTCKVCGCDLAQGGFFMKNGEYLCTLDYQRLHGTRCNGCGDFVEGEVVTALGKTYHPACFVCTICKRPFPAGDRVTFNGKDCLCQRCV 133          

HSP 2 Score: 63.5438 bits (153), Expect = 1.105e-9
Identity = 32/96 (33.33%), Postives = 51/96 (53.12%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDK-----ATLW 437
            +L LD+++ H GCF C  C K L  G +  +D   +C  DYQ  +GV+C  C ++  G+V+      +H  C +C  CN  F  G++     +T+W
Sbjct:  162 LLALDRQW-HLGCFKCKACGKVLS-GEYISKDGAPYCERDYQIHFGVQCEACQQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVW 255          
BLAST of Actin-binding LIM protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006267.1 (pep scaffold:Pmarinus_7.0:GL478686:5064:37345:-1 gene:ENSPMAG00000005668.1 transcript:ENSPMAT00000006267.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.145 bits (261), Expect = 1.163e-25
Identity = 50/122 (40.98%), Postives = 70/122 (57.38%), Query Frame = 3
Query:   99 QLLLFIMGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRC 464
            Q +L     I C  CR  C+G+VL+++ +  H  CF C  C  +L + GFF ++  Y C+ DYQ+LYG +C  C  + +GEVVT LG T+H +CF C  C  PF  G + T    + LCH C
Sbjct:   14 QSVLVDKPAIHCYKCRDLCRGEVLRVENRHFHVSCFTCKVCGCDLAQCGFFVKNGEYVCTLDYQRLYGTRCQACGDFVEGEVVTALGRTYHPRCFVCSVCRQPFPSGARVTFNGRECLCHEC 135          
BLAST of Actin-binding LIM protein vs. Ensembl Sea Lamprey
Match: ablim1a (actin binding LIM protein 1a [Source:ZFIN;Acc:ZDB-GENE-080219-41])

HSP 1 Score: 107.071 bits (266), Expect = 8.190e-24
Identity = 47/113 (41.59%), Postives = 63/113 (55.75%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRC 464
            I C  C + CKG+ L++  +  H  CF C  C  +L + GFF +   Y C+ DYQ+ +G +C  C  + +GEVVT LG T+H QCF C  C  PF  GD+ T      LC RC
Sbjct:   12 ILCHKCSEPCKGEALRVQDRHFHIKCFICKVCGCDLAQNGFFMKSGEYLCTHDYQQQHGTRCTGCGDFVEGEVVTALGKTYHPQCFVCAVCRCPFPAGDRVTFNGKDCLCQRC 124          

HSP 2 Score: 63.1586 bits (152), Expect = 3.012e-10
Identity = 28/65 (43.08%), Postives = 42/65 (64.62%), Query Frame = 3
Query: 2190 ETFPYEKLKINNF---SLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + +PYE L + N     LP+ +DR+RLE HL+  +F+ +F M+   F RL  WK+NDLK+K  L+
Sbjct:  732 KVYPYEALLVTNRVRSKLPRDVDRARLERHLSPEEFDNIFGMTIQEFDRLALWKKNDLKKKARLF 796          

HSP 3 Score: 62.003 bits (149), Expect = 6.882e-10
Identity = 37/117 (31.62%), Postives = 60/117 (51.28%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDK-----ATLWDGKYLCHRC--ASVKQEKENI 494
            +L LD+++ H GCF C  C K L  G +  +D   +C +DYQ  +G+KC  C K+  G+V+      +H  C +C  C   F  G++     +++W  +  C R   A  KQ+  N+
Sbjct:  154 LLALDKQW-HLGCFKCKTCGKVL-TGEYISKDGVPYCEQDYQSQFGIKCEECGKFITGKVLEAGEKHYHPSCARCVRCKQMFSEGEEMFMQGSSIWHPE--CKRAERAEEKQKTPNL 266          
BLAST of Actin-binding LIM protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007081.1 (pep scaffold:Pmarinus_7.0:GL476780:360940:430661:-1 gene:ENSPMAG00000006392.1 transcript:ENSPMAT00000007081.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 2.511e-10
Identity = 30/93 (32.26%), Postives = 42/93 (45.16%), Query Frame = 3
Query:  132 CEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPF 410
            C  C +  +G  L    K  H   FNC +C+  L + GF       +C   Y+K +   C  C K   GE++  L  T+H  CF C +C  PF
Sbjct:  419 CGQCNQIIRGPFLVALGKSWHPAEFNCAQCHTTLTETGFVEEQGNVYCETCYEKYFAPDCAKCRKKIMGEIMHALRQTWHTTCFVCASCGKPF 511          

HSP 2 Score: 61.2326 bits (147), Expect = 8.492e-10
Identity = 30/92 (32.61%), Postives = 43/92 (46.74%), Query Frame = 3
Query:  132 CEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCN--KYADGEVVTILGGTFHIQCFQCQNCN 401
            C  CRKK  G+++   ++  H  CF C  C K      F   D   +C +DY  L+  KC  C+    A  + +  LG T+H  CF C  C+
Sbjct:  478 CAKCRKKIMGEIMHALRQTWHTTCFVCASCGKPFGNSLFHMEDGEPYCEKDYVVLFSTKCHGCDFPVEAGDKFIEALGHTWHDTCFICAVCH 569          
BLAST of Actin-binding LIM protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002837.1 (pep scaffold:Pmarinus_7.0:GL478058:1594:18484:1 gene:ENSPMAG00000002578.1 transcript:ENSPMAT00000002837.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 3.134e-9
Identity = 30/76 (39.47%), Postives = 44/76 (57.89%), Query Frame = 3
Query: 2157 NILRTKEKIPAETFPYEKLKI---NNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            NIL  K       +PYE L +       LP+ +DR+ LE HL+  +F  +F MS   F RLP WK+N++KR++ L+
Sbjct:  186 NILEPK------IYPYEILIVTTRGRSKLPRAVDRTTLERHLSPEEFYRLFGMSIQEFDRLPLWKKNEMKRRLRLF 255          
BLAST of Actin-binding LIM protein vs. Ensembl Sea Lamprey
Match: PXN (paxillin [Source:HGNC Symbol;Acc:HGNC:9718])

HSP 1 Score: 58.5362 bits (140), Expect = 6.287e-9
Identity = 37/116 (31.90%), Postives = 54/116 (46.55%), Query Frame = 3
Query:  117 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLW-DGKYLCHR 461
            + K QC  C K   G V+    +  H   F C +C + +    FF RD   +C +DY  L+  +C +C+     +VVT L  T+H + F C  C   F  GD+     DGK  C +
Sbjct:  317 LAKGQCAACLKPIAGQVVTAMGRTWHPEHFVCTECQEEIGARNFFERDGLPYCEKDYHFLFSPRCAYCSGPILDKVVTALDKTWHPEHFFCVQCGHFF--GDEGFHEKDGKPYCRQ 430          

HSP 2 Score: 55.4546 bits (132), Expect = 5.862e-8
Identity = 27/97 (27.84%), Postives = 45/97 (46.39%), Query Frame = 3
Query:  129 QCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCG 419
            +C  C       V+    K  H   F C +C       GF  +D + +C +DY +++  KCG C++      ++ L   +H +CF C+ C +PF  G
Sbjct:  380 RCAYCSGPILDKVVTALDKTWHPEHFFCVQCGHFFGDEGFHEKDGKPYCRQDYFEMFAPKCGGCSRAIVENYISALSALWHPECFVCRECFTPFING 476          
BLAST of Actin-binding LIM protein vs. Ensembl Nematostella
Match: EDO43201 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ98])

HSP 1 Score: 87.0409 bits (214), Expect = 1.024e-18
Identity = 41/117 (35.04%), Postives = 59/117 (50.43%), Query Frame = 3
Query:  114 IMGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRC 464
            ++ ++ C  C K C G+ L  +  + H+ C  C  C + L    F+    +Y+C +DYQ  YG KC  C  Y +GE+++I G  FH  CF C +C  PF   DK       YLC  C
Sbjct:    1 MIAEVLCRKCTKPCSGEALLHENAYYHENCLCCSVCGQGLRSKPFYVMGEQYYCKDDYQNQYGKKCDSCQLYLEGEIISIHGKNFHEACFACNSCRQPFPPSDKIIFTGTDYLCQTC 117          

HSP 2 Score: 59.6918 bits (143), Expect = 1.546e-9
Identity = 36/102 (35.29%), Postives = 57/102 (55.88%), Query Frame = 3
Query:  117 MGKIQCEICRKKCKGD--VLKLDQKFIHKGCFNCYKCN--KNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPF 410
            M  + C  C +  KG   +L L++++ H  CF+C KC+   +LE  G    D + +C +DYQ+L+GV C  CN Y  G+V+      +H +C +C  CN+ F
Sbjct:  145 MANVACAGCGEAIKGSQALLALEKQW-HLWCFSCTKCHCLLSLEYMGM---DGKPYCEKDYQELFGVTCAACNGYITGKVLQAGNKHYHPKCSRCARCNNIF 242          
BLAST of Actin-binding LIM protein vs. Ensembl Nematostella
Match: EDO47660 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT9])

HSP 1 Score: 62.7734 bits (151), Expect = 2.359e-10
Identity = 35/121 (28.93%), Postives = 56/121 (46.28%), Query Frame = 3
Query:  183 KFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPF----------------CCGDKATLWDGKYLCHRCASVKQEKENIV 497
            + +H+ CF C +C +    G F+  D R FC  D+Q L+   C  C K+  G V+  +   +H  CF+C+ CN                   C  D+ T   G+Y+C +C +   E E+I+
Sbjct:   40 QILHERCFVCVQCFQAFPDGLFYEYDGRRFCEHDFQTLFAPCCKQCGKFVIGRVIKAMQANWHPDCFRCEICNDCLADTGFVKNAGRALCKKCNADEKTKKTGRYVCRKCHTYIPEGEHIM 160          

HSP 2 Score: 50.8322 bits (120), Expect = 1.916e-6
Identity = 36/117 (30.77%), Postives = 51/117 (43.59%), Query Frame = 3
Query:  114 IMGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRC 464
            ++G   C  CR+  +  V+    K  H   F C KC K      ++ R    +C   Y +LYG  C  CNK   G+VV  L   + +Q F C  CN       K   +D + LC +C
Sbjct:  199 LLGTPICGACRRPVEDRVVHALGKAWHVEHFVCAKCEKPFYGHRYYERKGLAYCETHYNELYGDICFECNKAITGDVVNALNKCWCVQHFTCIGCNISLTLKSKFHEFDMQPLCKKC 315          
BLAST of Actin-binding LIM protein vs. Ensembl Nematostella
Match: EDO48809 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIH4])

HSP 1 Score: 57.7658 bits (138), Expect = 1.013e-9
Identity = 34/104 (32.69%), Postives = 52/104 (50.00%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGG--FFCRDNRYFCSEDYQKLYGVKCGFCNKY-----ADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLC 455
            +LK   ++ H+ C  C  C   L + G   + + N   C  DY +L+G + GFC+       A   V+      +H++CF CQ CN  FC GDK  L++ + LC
Sbjct:   32 LLKALDRYWHEDCLKCSCCECRLGEVGSTLYTKANLILCKRDYLRLFGTR-GFCSVCCKTIPAFEMVMRARDNVYHLECFSCQRCNQRFCVGDKFYLFNNRILC 134          
BLAST of Actin-binding LIM protein vs. Ensembl Nematostella
Match: EDO39581 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9J0])

HSP 1 Score: 56.9954 bits (136), Expect = 8.084e-9
Identity = 39/129 (30.23%), Postives = 62/129 (48.06%), Query Frame = 3
Query:  132 CEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRD-NRYFCSEDYQKLYGVKCGFCNKY---ADGEVVTI----LGGTFHIQCFQCQNCNSPFCC---GDKATLWDGKYLCHRCASVKQEK 485
            C  C +     +L+   K  H  CFNC +C+KNL+   F   + N+  C EDY + Y  +C  C++     DG+  T+    +   FH++C++C++CN        G      DG  LC  C + K +K
Sbjct:   96 CWYCHQHITDRILRATGKCFHPHCFNCEECHKNLDGVPFTLDNFNKVHCLEDYYRKYSPRCASCHQLILPEDGQDETVRIVSMNKDFHVRCYKCEDCNKQLSSEKGGSGCYPLDGHLLCQDCNAKKIQK 224          
BLAST of Actin-binding LIM protein vs. Ensembl Nematostella
Match: EDO34370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPK5])

HSP 1 Score: 57.3806 bits (137), Expect = 1.149e-8
Identity = 28/100 (28.00%), Postives = 47/100 (47.00%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGF-FCRDNRYFCSEDYQKLYGVKCGFCNK--YADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLC 455
            ++K+  +  H  C  C  C+  L +    + +D + +C  DY + +G KC  C +  +A+  V       +H+ CF C NC      G++  L DG  LC
Sbjct:   40 LVKVSGRAWHTKCLKCCLCSDELGREATCYTKDGKIYCKADYARQFGTKCARCGRSIHANDWVRRAKNCVYHLACFACDNCKRQLSTGEEFALKDGHVLC 139          
BLAST of Actin-binding LIM protein vs. Ensembl Medaka
Match: ablim3 (actin binding LIM protein family member 3 [Source:NCBI gene;Acc:101163501])

HSP 1 Score: 117.087 bits (292), Expect = 1.921e-26
Identity = 50/122 (40.98%), Postives = 74/122 (60.66%), Query Frame = 3
Query:  120 GKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEK 485
            G I+C+ CR+ CKG+V+++ +   H  CF C  CN +L + GFF +   Y C+ DYQ+LYG +C  CN +  GEVV+ LG T+H +CF C  C+ PF  GD+ T      +C +C+    +K
Sbjct:   18 GPIRCQRCREICKGEVVRVQETHFHVKCFTCTVCNCDLARSGFFQKKGEYICTADYQRLYGTRCDRCNSFITGEVVSALGRTYHPKCFVCSVCSKPFPIGDRVTFSGKDCVCQQCSQTLVKK 139          

HSP 2 Score: 61.6178 bits (148), Expect = 3.591e-9
Identity = 36/108 (33.33%), Postives = 50/108 (46.30%), Query Frame = 3
Query:  114 IMGKIQCEICRKKCK-GDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATL 434
            I G   C  C  + K G  L   +K  H  CF C  C+  L  G +  +D   +C  DY   +GVKC  C++Y  G V+   G  +H  C +C  CN  F  G++  L
Sbjct:  145 IHGPSHCAGCGAEIKQGQSLLALEKQWHVSCFRCQTCSMVL-TGEYISKDGVPYCEADYHAQFGVKCEGCSRYISGRVLEAGGKHYHPSCARCARCNMMFKEGEEMYL 251          

HSP 3 Score: 60.8474 bits (146), Expect = 7.121e-9
Identity = 28/65 (43.08%), Postives = 40/65 (61.54%), Query Frame = 3
Query: 2190 ETFPYEKLKINNFS---LPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + +PYE L +       LPK +DR+RLE HL+  +F  VF M+   F RL  WKRN+LK++  L+
Sbjct:  577 KIYPYEALIVTTRGRNKLPKDVDRARLERHLSPEEFVQVFGMTVEEFDRLALWKRNELKKQARLF 641          
BLAST of Actin-binding LIM protein vs. Ensembl Medaka
Match: ablim2 (actin binding LIM protein family member 2 [Source:NCBI gene;Acc:101171731])

HSP 1 Score: 115.931 bits (289), Expect = 3.357e-26
Identity = 50/113 (44.25%), Postives = 68/113 (60.18%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRC 464
            I C+ CRK CKG+ L++  K  H  CF C  C   L +GGFF R   Y C+ DYQ+LYG +C  C  + +GEVV+ LG T+H +CF C +C  PF  GD+ T    + +C +C
Sbjct:   34 IPCQNCRKPCKGEALRVQNKHFHIKCFVCKVCGGELAQGGFFVRQGEYICTLDYQRLYGTRCFGCQDFIEGEVVSALGKTYHPRCFVCSSCRQPFPAGDRVTFNGKECICQKC 146          

HSP 2 Score: 62.7734 bits (151), Expect = 1.707e-9
Identity = 40/136 (29.41%), Postives = 64/136 (47.06%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCH---RCASVKQEKENIVPPLSSQKSITESDIVVQMTETP 563
            ++ LD K  H GCF C  CNK L    +  +D   +C  DY  ++G+KC  C KY  G+V+      +H  C +C  C   F  G++  L  G  + H   R A+ ++EK             ++  + +Q+T+ P
Sbjct:  177 LVALD-KHWHLGCFKCKLCNKVL-NAEYISKDGIPYCETDYHAMFGIKCESCQKYITGKVLEAGEKHYHPACARCARCEQMFAEGEEMYL-QGSSIWHPPCRQAAKQEEK-------------SKKQVRIQLTDVP 296          

HSP 3 Score: 61.2326 bits (147), Expect = 4.533e-9
Identity = 28/65 (43.08%), Postives = 40/65 (61.54%), Query Frame = 3
Query: 2190 ETFPYEKLKINN---FSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + +PYE L + +     LP+ +DR+RLE HL+  DF  VF M+   F RL  WK+NDLK+   L+
Sbjct:  562 KVYPYEVLAVTHRVKVKLPRDVDRTRLERHLSPEDFLQVFGMTLEQFDRLALWKKNDLKKAARLF 626          
BLAST of Actin-binding LIM protein vs. Ensembl Medaka
Match: ablim2 (actin binding LIM protein family member 2 [Source:NCBI gene;Acc:101171731])

HSP 1 Score: 116.316 bits (290), Expect = 3.695e-26
Identity = 50/113 (44.25%), Postives = 68/113 (60.18%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRC 464
            I C+ CRK CKG+ L++  K  H  CF C  C   L +GGFF R   Y C+ DYQ+LYG +C  C  + +GEVV+ LG T+H +CF C +C  PF  GD+ T    + +C +C
Sbjct:   34 IPCQNCRKPCKGEALRVQNKHFHIKCFVCKVCGGELAQGGFFVRQGEYICTLDYQRLYGTRCFGCQDFIEGEVVSALGKTYHPRCFVCSSCRQPFPAGDRVTFNGKECICQKC 146          

HSP 2 Score: 62.7734 bits (151), Expect = 1.902e-9
Identity = 40/136 (29.41%), Postives = 64/136 (47.06%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCH---RCASVKQEKENIVPPLSSQKSITESDIVVQMTETP 563
            ++ LD K  H GCF C  CNK L    +  +D   +C  DY  ++G+KC  C KY  G+V+      +H  C +C  C   F  G++  L  G  + H   R A+ ++EK             ++  + +Q+T+ P
Sbjct:  177 LVALD-KHWHLGCFKCKLCNKVL-NAEYISKDGIPYCETDYHAMFGIKCESCQKYITGKVLEAGEKHYHPACARCARCEQMFAEGEEMYL-QGSSIWHPPCRQAAKQEEK-------------SKKQVRIQLTDVP 296          

HSP 3 Score: 62.003 bits (149), Expect = 3.123e-9
Identity = 28/65 (43.08%), Postives = 40/65 (61.54%), Query Frame = 3
Query: 2190 ETFPYEKLKINN---FSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + +PYE L + +     LP+ +DR+RLE HL+  DF  VF M+   F RL  WK+NDLK+   L+
Sbjct:  621 KVYPYEVLAVTHRVKVKLPRDVDRTRLERHLSPEDFLQVFGMTLEQFDRLALWKKNDLKKAARLF 685          
BLAST of Actin-binding LIM protein vs. Ensembl Medaka
Match: ablim3 (actin binding LIM protein family member 3 [Source:NCBI gene;Acc:101163501])

HSP 1 Score: 116.316 bits (290), Expect = 3.842e-26
Identity = 50/126 (39.68%), Postives = 75/126 (59.52%), Query Frame = 3
Query:  120 GKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIV 497
            G I+C+ CR+ CKG+V+++ +   H  CF C  CN +L + GFF +   Y C+ DYQ+LYG +C  CN +  GEVV+ LG T+H +CF C  C+ PF  GD+ T      +C +C+    +K   +
Sbjct:   19 GPIRCQRCREICKGEVVRVQETHFHVKCFTCTVCNCDLARSGFFQKKGEYICTADYQRLYGTRCDRCNSFITGEVVSALGRTYHPKCFVCSVCSKPFPIGDRVTFSGKDCVCQQCSQTLVKKNEPI 144          

HSP 2 Score: 61.6178 bits (148), Expect = 4.051e-9
Identity = 36/108 (33.33%), Postives = 50/108 (46.30%), Query Frame = 3
Query:  114 IMGKIQCEICRKKCK-GDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATL 434
            I G   C  C  + K G  L   +K  H  CF C  C+  L  G +  +D   +C  DY   +GVKC  C++Y  G V+   G  +H  C +C  CN  F  G++  L
Sbjct:  146 IHGPSHCAGCGAEIKQGQSLLALEKQWHVSCFRCQTCSMVL-TGEYISKDGVPYCEADYHAQFGVKCEGCSRYISGRVLEAGGKHYHPSCARCARCNMMFKEGEEMYL 252          

HSP 3 Score: 61.2326 bits (147), Expect = 4.974e-9
Identity = 28/66 (42.42%), Postives = 41/66 (62.12%), Query Frame = 3
Query: 2187 AETFPYEKLKINNFS---LPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            ++ +PYE L +       LPK +DR+RLE HL+  +F  VF M+   F RL  WKRN+LK++  L+
Sbjct:  595 SQIYPYEALIVTTRGRNKLPKDVDRARLERHLSPEEFVQVFGMTVEEFDRLALWKRNELKKQARLF 660          
BLAST of Actin-binding LIM protein vs. Ensembl Medaka
Match: ablim2 (actin binding LIM protein family member 2 [Source:NCBI gene;Acc:101171731])

HSP 1 Score: 116.316 bits (290), Expect = 3.988e-26
Identity = 50/113 (44.25%), Postives = 68/113 (60.18%), Query Frame = 3
Query:  126 IQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRC 464
            I C+ CRK CKG+ L++  K  H  CF C  C   L +GGFF R   Y C+ DYQ+LYG +C  C  + +GEVV+ LG T+H +CF C +C  PF  GD+ T    + +C +C
Sbjct:   34 IPCQNCRKPCKGEALRVQNKHFHIKCFVCKVCGGELAQGGFFVRQGEYICTLDYQRLYGTRCFGCQDFIEGEVVSALGKTYHPRCFVCSSCRQPFPAGDRVTFNGKECICQKC 146          

HSP 2 Score: 62.3882 bits (150), Expect = 2.268e-9
Identity = 37/114 (32.46%), Postives = 56/114 (49.12%), Query Frame = 3
Query:  165 VLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCH---RCASVKQEKENIV 497
            ++ LD K  H GCF C  CNK L    +  +D   +C  DY  ++G+KC  C KY  G+V+      +H  C +C  C   F  G++  L  G  + H   R A+ ++EK  + 
Sbjct:  177 LVALD-KHWHLGCFKCKLCNKVL-NAEYISKDGIPYCETDYHAMFGIKCESCQKYITGKVLEAGEKHYHPACARCARCEQMFAEGEEMYL-QGSSIWHPPCRQAAKQEEKSKMA 287          

HSP 3 Score: 62.003 bits (149), Expect = 2.956e-9
Identity = 28/65 (43.08%), Postives = 40/65 (61.54%), Query Frame = 3
Query: 2190 ETFPYEKLKINN---FSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            + +PYE L + +     LP+ +DR+RLE HL+  DF  VF M+   F RL  WK+NDLK+   L+
Sbjct:  607 KVYPYEVLAVTHRVKVKLPRDVDRTRLERHLSPEDFLQVFGMTLEQFDRLALWKKNDLKKAARLF 671          
BLAST of Actin-binding LIM protein vs. Planmine SMEST
Match: SMESG000080177.1 (SMESG000080177.1)

HSP 1 Score: 1537.7 bits (3980), Expect = 0.000e+0
Identity = 751/753 (99.73%), Postives = 751/753 (99.73%), Query Frame = 3
Query:  117 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKHTPPNAVYCGSNRNPNTVPPITSHFHRPENFSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGTDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQXXXXXXXXXXXXYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYRVQYSNTGGRTGTLPSAYTSSSENESATRSYRSYHSYYPAPQPGYTQGYLSCTEDSASGRPTNGLNYRASSLPRPLNLYTPVCVNTTNYLLDGHMSPSMTTSGYSVDATTHSIDESTLIGGSGLLNATAHRNGYMSDMAPLSAPYGPKKTRPDWFYESENEAVFHSNYPTVQSYLKPSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKHTPPNAVYCGSNRNPNTVPPITSHFHRPENFSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSG DTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQLENNENRLRNENYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYRVQYSNTGGRTGTLP AYTSSSENESATRSYRSYHSYYPAPQPGYTQGYLSCTEDSASGRPTNGLNYRASSLPRPLNLYTPVCVNTTNYLLDGHMSPSMTTSGYSVDATTHSIDESTLIGGSGLLNATAHRNGYMSDMAPLSAPYGPKKTRPDWFYESENEAVFHSNYPTVQSYLKPSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY
Sbjct:    1 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKHTPPNAVYCGSNRNPNTVPPITSHFHRPENFSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGIDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQLENNENRLRNENYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYRVQYSNTGGRTGTLPGAYTSSSENESATRSYRSYHSYYPAPQPGYTQGYLSCTEDSASGRPTNGLNYRASSLPRPLNLYTPVCVNTTNYLLDGHMSPSMTTSGYSVDATTHSIDESTLIGGSGLLNATAHRNGYMSDMAPLSAPYGPKKTRPDWFYESENEAVFHSNYPTVQSYLKPSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 753          
BLAST of Actin-binding LIM protein vs. Planmine SMEST
Match: SMESG000080177.1 (SMESG000080177.1)

HSP 1 Score: 1487.63 bits (3850), Expect = 0.000e+0
Identity = 731/753 (97.08%), Postives = 732/753 (97.21%), Query Frame = 3
Query:  117 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKHTPPNAVYCGSNRNPNTVPPITSHFHRPENFSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGTDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQXXXXXXXXXXXXYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYRVQYSNTGGRTGTLPSAYTSSSENESATRSYRSYHSYYPAPQPGYTQGYLSCTEDSASGRPTNGLNYRASSLPRPLNLYTPVCVNTTNYLLDGHMSPSMTTSGYSVDATTHSIDESTLIGGSGLLNATAHRNGYMSDMAPLSAPYGPKKTRPDWFYESENEAVFHSNYPTVQSYLKPSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKHTPPNAVYCGSNRNPNTVPPITSHFHRPENFSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSG DTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQLENNENRLRNENYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYRVQYSNTGGRTGTLP AYTS+                   PQPGYTQGYLSCTEDSASGRPTNGLNYRASSLPRPLNLYTPVCVNTTNYLLDGHMSPSMTTSGYSVDATTHSIDESTLIGGSGLLNATAHRNGYMSDMAPLSAPYGPKKTRPDWFYESENEAVFHSNYPTVQSYLKPSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY
Sbjct:    1 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKHTPPNAVYCGSNRNPNTVPPITSHFHRPENFSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGIDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQLENNENRLRNENYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYRVQYSNTGGRTGTLPGAYTST-------------------PQPGYTQGYLSCTEDSASGRPTNGLNYRASSLPRPLNLYTPVCVNTTNYLLDGHMSPSMTTSGYSVDATTHSIDESTLIGGSGLLNATAHRNGYMSDMAPLSAPYGPKKTRPDWFYESENEAVFHSNYPTVQSYLKPSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 734          
BLAST of Actin-binding LIM protein vs. Planmine SMEST
Match: SMESG000080177.1 (SMESG000080177.1)

HSP 1 Score: 1471.45 bits (3808), Expect = 0.000e+0
Identity = 726/753 (96.41%), Postives = 727/753 (96.55%), Query Frame = 3
Query:  117 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKHTPPNAVYCGSNRNPNTVPPITSHFHRPENFSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGTDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQXXXXXXXXXXXXYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYRVQYSNTGGRTGTLPSAYTSSSENESATRSYRSYHSYYPAPQPGYTQGYLSCTEDSASGRPTNGLNYRASSLPRPLNLYTPVCVNTTNYLLDGHMSPSMTTSGYSVDATTHSIDESTLIGGSGLLNATAHRNGYMSDMAPLSAPYGPKKTRPDWFYESENEAVFHSNYPTVQSYLKPSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKHTPPNAVYCGSNRNPNTVPPITSHFHRPENFSYRSSPNINMKK     VNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSG DTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQLENNENRLRNENYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYRVQYSNTGGRTGTLP AYTS+                   PQPGYTQGYLSCTEDSASGRPTNGLNYRASSLPRPLNLYTPVCVNTTNYLLDGHMSPSMTTSGYSVDATTHSIDESTLIGGSGLLNATAHRNGYMSDMAPLSAPYGPKKTRPDWFYESENEAVFHSNYPTVQSYLKPSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY
Sbjct:    1 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKHTPPNAVYCGSNRNPNTVPPITSHFHRPENFSYRSSPNINMKK-----VNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGIDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQLENNENRLRNENYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYRVQYSNTGGRTGTLPGAYTST-------------------PQPGYTQGYLSCTEDSASGRPTNGLNYRASSLPRPLNLYTPVCVNTTNYLLDGHMSPSMTTSGYSVDATTHSIDESTLIGGSGLLNATAHRNGYMSDMAPLSAPYGPKKTRPDWFYESENEAVFHSNYPTVQSYLKPSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 729          
BLAST of Actin-binding LIM protein vs. Planmine SMEST
Match: SMESG000080177.1 (SMESG000080177.1)

HSP 1 Score: 1434.47 bits (3712), Expect = 0.000e+0
Identity = 711/753 (94.42%), Postives = 712/753 (94.56%), Query Frame = 3
Query:  117 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKHTPPNAVYCGSNRNPNTVPPITSHFHRPENFSYRSSPNINMKKGMSLLVNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGTDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQXXXXXXXXXXXXYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYRVQYSNTGGRTGTLPSAYTSSSENESATRSYRSYHSYYPAPQPGYTQGYLSCTEDSASGRPTNGLNYRASSLPRPLNLYTPVCVNTTNYLLDGHMSPSMTTSGYSVDATTHSIDESTLIGGSGLLNATAHRNGYMSDMAPLSAPYGPKKTRPDWFYESENEAVFHSNYPTVQSYLKPSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 2375
            MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKHTPPNAVYCGSNRNPNTVPPITSHFHRP                    VNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSG DTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQLENNENRLRNENYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYRVQYSNTGGRTGTLP AYTS+                   PQPGYTQGYLSCTEDSASGRPTNGLNYRASSLPRPLNLYTPVCVNTTNYLLDGHMSPSMTTSGYSVDATTHSIDESTLIGGSGLLNATAHRNGYMSDMAPLSAPYGPKKTRPDWFYESENEAVFHSNYPTVQSYLKPSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY
Sbjct:    1 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKHTPPNAVYCGSNRNPNTVPPITSHFHRP--------------------VNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGIDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQLENNENRLRNENYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYRVQYSNTGGRTGTLPGAYTST-------------------PQPGYTQGYLSCTEDSASGRPTNGLNYRASSLPRPLNLYTPVCVNTTNYLLDGHMSPSMTTSGYSVDATTHSIDESTLIGGSGLLNATAHRNGYMSDMAPLSAPYGPKKTRPDWFYESENEAVFHSNYPTVQSYLKPSNILRTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 714          
BLAST of Actin-binding LIM protein vs. Planmine SMEST
Match: SMESG000080177.1 (SMESG000080177.1)

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 296/296 (100.00%), Postives = 296/296 (100.00%), Query Frame = 3
Query:  117 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKHTPPNAVYCGSNRNPNTVPPITSHFHRPENFSYRSSPNINMKKG 1004
            MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKHTPPNAVYCGSNRNPNTVPPITSHFHRPENFSYRSSPNINMKKG
Sbjct:    1 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITESDIVVQMTETPIIVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMGYTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERITKHTPPNAVYCGSNRNPNTVPPITSHFHRPENFSYRSSPNINMKKG 296          
The following BLAST results are available for this feature:
BLAST of Actin-binding LIM protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABLIM17.855e-2743.86actin binding LIM protein 1 [Source:HGNC Symbol;Ac... [more]
ABLIM19.490e-2743.86actin binding LIM protein 1 [Source:HGNC Symbol;Ac... [more]
ABLIM11.063e-2643.86actin binding LIM protein 1 [Source:HGNC Symbol;Ac... [more]
ABLIM11.642e-2643.86actin binding LIM protein 1 [Source:HGNC Symbol;Ac... [more]
ABLIM12.595e-2643.86actin binding LIM protein 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pxl-14.780e-1235.42Paxillin homolog 1 [Source:UniProtKB/Swiss-Prot;A... [more]
unc-1155.054e-1246.03pep chromosome:WBcel235:X:10147492:10153085:1 gene... [more]
pxl-17.417e-1235.42Paxillin homolog 1 [Source:UniProtKB/Swiss-Prot;A... [more]
unc-1151.402e-1147.54pep chromosome:WBcel235:X:10146889:10153142:1 gene... [more]
pxl-11.624e-1135.42Paxillin homolog 1 [Source:UniProtKB/Swiss-Prot;A... [more]
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Unc-115b3.502e-3147.41gene:FBgn0260463 transcript:FBtr0082094[more]
Unc-115b3.550e-3147.41gene:FBgn0260463 transcript:FBtr0082095[more]
Unc-115b3.550e-3147.41gene:FBgn0260463 transcript:FBtr0303039[more]
Unc-115a3.972e-3147.41gene:FBgn0051352 transcript:FBtr0346714[more]
Unc-115b4.032e-3147.41gene:FBgn0260463 transcript:FBtr0082097[more]
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ablim21.574e-2743.48actin binding LIM protein family, member 2 [Source... [more]
BX465192.13.328e-2641.79actin binding LIM protein family, member 2 [Source... [more]
ablim25.696e-2643.10actin binding LIM protein family, member 2 [Source... [more]
BX465192.16.889e-2643.10actin binding LIM protein family, member 2 [Source... [more]
BX465192.17.580e-2643.10actin binding LIM protein family, member 2 [Source... [more]
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uck21.801e-2441.38uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-G... [more]
uck22.159e-2441.38uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-G... [more]
uck26.929e-2441.38uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-G... [more]
uck27.563e-2441.38uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-G... [more]
uck28.251e-2441.38uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ablim19.876e-2743.86actin-binding LIM protein 1 [Source:MGI Symbol;Acc... [more]
Ablim11.673e-2643.86actin-binding LIM protein 1 [Source:MGI Symbol;Acc... [more]
Ablim11.690e-2643.86actin-binding LIM protein 1 [Source:MGI Symbol;Acc... [more]
Ablim14.306e-2643.86actin-binding LIM protein 1 [Source:MGI Symbol;Acc... [more]
Ablim14.805e-2643.86actin-binding LIM protein 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Actin-binding LIM protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O14639|ABLM1_HUMAN7.886e-2643.86Actin-binding LIM protein 1 OS=Homo sapiens OX=960... [more]
sp|Q6H8Q1|ABLM2_HUMAN8.666e-2542.98Actin-binding LIM protein 2 OS=Homo sapiens OX=960... [more]
sp|Q8K4G5|ABLM1_MOUSE1.730e-2443.86Actin-binding LIM protein 1 OS=Mus musculus OX=100... [more]
sp|Q8BL65|ABLM2_MOUSE9.833e-2442.11Actin-binding LIM protein 2 OS=Mus musculus OX=100... [more]
sp|Q6KC51|ABLM2_RAT2.538e-2242.11Actin-binding LIM protein 2 OS=Rattus norvegicus O... [more]
back to top
BLAST of Actin-binding LIM protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068YIX11.118e-7428.18Actin binding lim protein 1 OS=Echinococcus multil... [more]
A0A4S2MDM61.816e-6028.92Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A158QFU95.515e-5927.64Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A075A1D92.535e-5432.98HP domain-containing protein (Fragment) OS=Opistho... [more]
A0A4E0RGA41.341e-5332.39Villin-2 OS=Fasciola hepatica OX=6192 GN=D915_0013... [more]
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ablim1b2.537e-2643.86actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-... [more]
ablim1b7.300e-2643.36actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-... [more]
ablim1a7.857e-2643.86actin binding LIM protein 1a [Source:ZFIN;Acc:ZDB-... [more]
ablim1b1.719e-2543.86actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-... [more]
ablim1b1.736e-2543.86actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006267.11.163e-2540.98pep scaffold:Pmarinus_7.0:GL478686:5064:37345:-1 g... [more]
ablim1a8.190e-2441.59actin binding LIM protein 1a [Source:ZFIN;Acc:ZDB-... [more]
ENSPMAT00000007081.12.511e-1032.26pep scaffold:Pmarinus_7.0:GL476780:360940:430661:-... [more]
ENSPMAT00000002837.13.134e-939.47pep scaffold:Pmarinus_7.0:GL478058:1594:18484:1 ge... [more]
PXN6.287e-931.90paxillin [Source:HGNC Symbol;Acc:HGNC:9718][more]
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO432011.024e-1835.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476602.359e-1028.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488091.013e-932.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395818.084e-930.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343701.149e-828.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ablim31.921e-2640.98actin binding LIM protein family member 3 [Source:... [more]
ablim23.357e-2644.25actin binding LIM protein family member 2 [Source:... [more]
ablim23.695e-2644.25actin binding LIM protein family member 2 [Source:... [more]
ablim33.842e-2639.68actin binding LIM protein family member 3 [Source:... [more]
ablim23.988e-2644.25actin binding LIM protein family member 2 [Source:... [more]
back to top
BLAST of Actin-binding LIM protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080177.10.000e+099.73SMESG000080177.1[more]
SMESG000080177.10.000e+097.08SMESG000080177.1[more]
SMESG000080177.10.000e+096.41SMESG000080177.1[more]
SMESG000080177.10.000e+094.42SMESG000080177.1[more]
SMESG000080177.10.000e+0100.00SMESG000080177.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004846 ID=SMED30004846|Name=Actin-binding LIM protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3287bp
GCATATTTTAATCGATTAAATGACCTAGAAATACTTGTTTTACTAATAAA
ATCATTTCAACTTTTTACTAAACATTTTTAAAGTTTGACGTACACTTTCA
GTTGCTGCTTTTCATAATGGGCAAAATTCAATGCGAAATATGCAGAAAGA
AATGTAAAGGAGATGTCTTAAAGTTGGATCAGAAATTTATTCATAAAGGA
TGCTTTAATTGCTATAAATGCAATAAAAATCTTGAAAAAGGTGGCTTTTT
CTGCAGAGACAATCGTTACTTCTGTTCTGAAGACTATCAGAAATTATATG
GGGTAAAATGTGGATTCTGCAACAAATATGCGGACGGCGAAGTCGTTACA
ATTCTTGGTGGAACATTCCATATTCAATGTTTTCAATGTCAAAATTGCAA
TTCCCCATTCTGCTGTGGAGATAAGGCTACTCTTTGGGATGGGAAATATT
TATGCCACCGGTGCGCCTCAGTGAAGCAGGAAAAGGAGAACATCGTTCCT
CCATTGTCTAGTCAAAAGTCAATTACTGAATCAGATATCGTGGTACAAAT
GACAGAAACCCCAATCATTGTCAGAGACGTCATGGCAAATCAGTACGATT
CCAGTGACACGGACGGACCGGTTAGAATTAAGCCGAAGGAATGTTTACAA
CTGCACATCGAAAACGGCTACACAAGCACTGATTCCGGCGTTGAAAAAAC
AAAATCGGAAATGGGCTACACGAGTCAACATAGTCCTTGCTACAGTTTCT
CGTCCGGTGAAGAAAGCTTTTTGCGCTCTACTAGGGGCAGAAAGAGTAGA
GCAAAAGGCAATTACAATTACGGCAGATATCTCAATCCATCATATTTACA
AATTCAAGAACGTATCACAAAACATACGCCGCCAAATGCCGTATATTGCG
GCAGCAATCGAAATCCAAACACCGTTCCTCCTATTACATCACATTTCCAT
AGACCAGAAAATTTTTCATATCGATCATCTCCAAATATCAATATGAAAAA
AGGTATGTCCTTATTGGTGAACCCTTTCGGACAAATGTTTAAAAAGCCTT
TGCCAGGACAATATAACCGAGGGATCCGACCTCAATCAACCAATGATGTC
AATCTATCAGAAGAAGTCAAGCGGCTTGCTCATTATCCAGACGGGAAACG
ACCAGATCCAGATTCAGCCCCCCCTATTGATCGATATGATTTTCCTGCAC
CTCCTTCACTGAGTGTTGTGCTCCAAGACATGAAGAAAGAAAAGGAATAC
AAAAAACAACGGTCAATCGTATCTACTGGAGATATATTTTATGATACGCA
GAGTGGAACAGATACTGCGGCAGAATTAGGAGATTTTCCAGAGAGTGAAG
ACGAAAAATCTCGAAAGAAAAAAGTAGAATTAACTTTAAAAGTACTTCGG
GAAACAGGAAAATATTCTGGCTTATCTCAGACTGTACTCGATCAATTAGA
GAATAATGAAAACAGATTACGCAATGAAAATTATTTTGATCCGATATCTG
CTTCCCGATCACCAGATGCATCAATGGAACCTTCTCAGAAACCTCGTTAT
GATAGGCACACTTTTACTTCTCCTTCCCGGGATAATCGCTACGAAGGCCG
GCCTGCACATCACCTATCGTATCGGGTGCAATATTCAAATACTGGTGGCC
GTACTGGCACTCTGCCGAGCGCTTACACATCGAGTTCTGAAAATGAATCA
GCTACCAGATCATATCGCAGTTATCATTCGTATTATCCAGCTCCTCAGCC
TGGGTACACTCAAGGCTATTTATCTTGTACTGAAGACTCAGCTAGTGGCC
GGCCCACTAACGGACTAAATTATCGAGCTTCAAGTTTGCCCCGTCCATTG
AACTTATATACCCCTGTCTGTGTTAACACCACCAATTATTTATTGGATGG
CCATATGTCTCCAAGCATGACAACTTCCGGTTATTCTGTTGACGCTACTA
CGCATTCAATTGATGAGTCAACGCTGATTGGTGGATCGGGACTTTTGAAT
GCGACTGCCCACAGAAACGGTTACATGAGTGATATGGCACCGTTATCGGC
TCCTTATGGTCCAAAGAAAACTCGTCCTGATTGGTTTTATGAATCAGAAA
ACGAAGCAGTTTTCCATTCCAATTATCCAACTGTACAAAGCTATTTAAAA
CCTAGCAATATACTTCGAACAAAAGAAAAAATTCCTGCAGAAACGTTTCC
TTATGAAAAATTAAAAATTAATAATTTTTCTTTGCCCAAAGGTATGGATC
GCTCAAGATTAGAGGATCATTTGACTGACAATGACTTCGAATTGGTATTC
CAAATGTCCCGGTCAGCATTCAGTCGGCTGCCAGAATGGAAACGAAATGA
TTTAAAGAGAAAAGTTGATCTTTATTGATTTGAGTGTGCTCGTCACTGAA
CCAAATACTACTACTACTAATACTACTATTACTACTATAAACAGCTGATG
AATGATATCAATGGGATTAGTGTATGAACTCGCCAATATTCAGTCAGTTG
CAGTCTGCAATATCTATTCATTTACCTAGTTTATATTCACTTATCACTTG
TTTGAGATTTTTCAAATTCTTTTCTCCAGTTTTTCCCCGTTTTTTTGTTT
TTCTTGCTGAAAAGCTTGATGTCTGTGTTTTCGTTTAGTTTTTGCCTATG
AGCGTTTTATTTTTCTACTGAATGATTTGTTTGTGTATTTGTTTCGAAGC
TCAAGTTATCGATTGCTACTTTTTCCTTTCCCGGAAGATGAAGCTTCGAT
TTTTTTTGTGTTAATTCGGTAGTTCGTGTAACTTTTTCCGTGTTTAAATG
ACTCGATTTTTTTGCCATGAAATAATACGGTATTCGTTAGCGATCTGAAT
ATGATGAATATGATGGAGAGGTATATTATTTATTGTCTGCATTTTCATGG
AGTTCTGAAAATTCTACAAGCGACTAGCTCAATTTATTTCTGGAAACTAA
TCGTTATTATCCCATTGTTAATTGTTTCATTGCTGCCATTGTGTGTATGT
GCTCGTGTGCGTGAATGTGTGTGTATGCCTGTGCGTGTGTGCTCACTGAA
ACAAATTGGCCATTAATTCAGTCAGATGGTAAATCGCTATGTAACAGTTT
TTTCTTAGAAAATATCTTTTGTTCTTTTTAGAGAATTACAGATAATATTA
TTCATATTTGTTGATTTGTTTGTGTTATTGTTTAAAATGTTTGGATCAAT
TTGTTTGTGATTGCAAATCCGAATTCGATCCGATTGATAGTTGAATTTGT
TGGCACATTTATTTAAAAATATAAATTTGAGTTATTA
back to top

protein sequence of SMED30004846-orf-1

>SMED30004846-orf-1 ID=SMED30004846-orf-1|Name=SMED30004846-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=754bp
MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNR
YFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCC
GDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSITESDIVVQMTETPI
IVRDVMANQYDSSDTDGPVRIKPKECLQLHIENGYTSTDSGVEKTKSEMG
YTSQHSPCYSFSSGEESFLRSTRGRKSRAKGNYNYGRYLNPSYLQIQERI
TKHTPPNAVYCGSNRNPNTVPPITSHFHRPENFSYRSSPNINMKKGMSLL
VNPFGQMFKKPLPGQYNRGIRPQSTNDVNLSEEVKRLAHYPDGKRPDPDS
APPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGTDT
AAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQLENNENR
LRNENYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHL
SYRVQYSNTGGRTGTLPSAYTSSSENESATRSYRSYHSYYPAPQPGYTQG
YLSCTEDSASGRPTNGLNYRASSLPRPLNLYTPVCVNTTNYLLDGHMSPS
MTTSGYSVDATTHSIDESTLIGGSGLLNATAHRNGYMSDMAPLSAPYGPK
KTRPDWFYESENEAVFHSNYPTVQSYLKPSNILRTKEKIPAETFPYEKLK
INNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKV
DLY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036886Villin_headpiece_dom_sf
IPR017919TFIIE/TFIIEa_HTH
IPR003128Villin_headpiece
IPR001781Znf_LIM
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003779actin binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007010cytoskeleton organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003128Villin headpieceSMARTSM00153VHP_1coord: 718..753
e-value: 1.7E-13
score: 60.9
IPR003128Villin headpiecePFAMPF02209VHPcoord: 718..752
e-value: 2.0E-14
score: 53.3
IPR003128Villin headpiecePROSITEPS51089HPcoord: 688..753
score: 20.23
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 5..56
e-value: 2.6E-4
score: 30.3
coord: 64..116
e-value: 2.3E-6
score: 37.1
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 65..116
e-value: 2.5E-6
score: 27.6
coord: 6..59
e-value: 3.6E-6
score: 27.1
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 65..98
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 64..123
score: 8.316
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 4..63
score: 11.92
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 60..164
e-value: 7.9E-14
score: 53.9
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 3..59
e-value: 2.0E-10
score: 42.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 473..493
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 338..359
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 457..493
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 338..352
NoneNo IPR availablePANTHERPTHR24213FAMILY NOT NAMEDcoord: 2..122
coord: 231..752
NoneNo IPR availableCDDcd09327LIM1_abLIMcoord: 6..57
e-value: 5.31308E-20
score: 81.9187
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 32..95
IPR036886Villin headpiece domain superfamilyGENE3DG3DSA:1.10.950.10coord: 690..753
e-value: 3.0E-23
score: 83.3
IPR036886Villin headpiece domain superfamilySUPERFAMILYSSF47050VHP, Villin headpiece domaincoord: 690..753