GTP-binding protein

Overview
NameGTP-binding protein
Smed IDSMED30004841
Length (bp)1295
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GTP-binding protein (SMED30004841) t-SNE clustered cells

Violin plots show distribution of expression levels for GTP-binding protein (SMED30004841) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GTP-binding protein (SMED30004841) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GTP-binding protein (SMED30004841) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004841

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30004841SMESG000057130.1 Contig2392newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30004841SMESG000057130.1 Contig2392uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30004841SMESG000016036.1 Contig2392newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30004841SMESG000016036.1 Contig2392uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30004841SMESG000057130.1 SmedASXL_013114SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30004841SMESG000057130.1 dd_Smed_v4_18884_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004841SMESG000057130.1 dd_Smed_v4_18884_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004841SMESG000057130.1 dd_Smed_v4_18884_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004841SMESG000057130.1 dd_Smed_v4_18884_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004841SMESG000057130.1 dd_Smed_v4_18884_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30004841SMESG000057130.1 dd_Smed_v6_18884_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GTP-binding protein vs. Ensembl Human
Match: RRAD (RRAD, Ras related glycolysis inhibitor and calcium channel regulator [Source:HGNC Symbol;Acc:HGNC:10446])

HSP 1 Score: 80.4925 bits (197), Expect = 3.760e-16
Identity = 52/165 (31.52%), Postives = 86/165 (52.12%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLID--SENCENFIEPK--EVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPL-VILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G  GVGK++L +        V    E ++        +++D +E+ L + D   ++   ++      + DAY+++Y++ D  SFE   +L   L        + +ILV NKSDLVRSR VS D+G+  A +++ KF E S +L+H V  L   +V ++R
Sbjct:   92 YKVLLLGAPGVGKSALARIF----GGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIR 252          
BLAST of GTP-binding protein vs. Ensembl Human
Match: RRAD (RRAD, Ras related glycolysis inhibitor and calcium channel regulator [Source:HGNC Symbol;Acc:HGNC:10446])

HSP 1 Score: 80.4925 bits (197), Expect = 3.760e-16
Identity = 52/165 (31.52%), Postives = 86/165 (52.12%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLID--SENCENFIEPK--EVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPL-VILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G  GVGK++L +        V    E ++        +++D +E+ L + D   ++   ++      + DAY+++Y++ D  SFE   +L   L        + +ILV NKSDLVRSR VS D+G+  A +++ KF E S +L+H V  L   +V ++R
Sbjct:   92 YKVLLLGAPGVGKSALARIF----GGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIR 252          
BLAST of GTP-binding protein vs. Ensembl Human
Match: GEM (GTP binding protein overexpressed in skeletal muscle [Source:HGNC Symbol;Acc:HGNC:4234])

HSP 1 Score: 79.337 bits (194), Expect = 7.591e-16
Identity = 53/166 (31.93%), Postives = 85/166 (51.20%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLID-----SENCENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPL-VILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G+ GVGK++L          +    E+   +  +   +++D + + + L+D      EN        +V DAYL++Y+I D +SFE   +L   L        + +ILV NKSDLVR R VS  +G+  A +++ KF E S ++ H V EL   +V ++R
Sbjct:   76 YRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERT-LMVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVR 240          
BLAST of GTP-binding protein vs. Ensembl Human
Match: GEM (GTP binding protein overexpressed in skeletal muscle [Source:HGNC Symbol;Acc:HGNC:4234])

HSP 1 Score: 79.337 bits (194), Expect = 7.591e-16
Identity = 53/166 (31.93%), Postives = 85/166 (51.20%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLID-----SENCENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPL-VILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G+ GVGK++L          +    E+   +  +   +++D + + + L+D      EN        +V DAYL++Y+I D +SFE   +L   L        + +ILV NKSDLVR R VS  +G+  A +++ KF E S ++ H V EL   +V ++R
Sbjct:   76 YRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERT-LMVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVR 240          
BLAST of GTP-binding protein vs. Ensembl Human
Match: RIT2 (Ras like without CAAX 2 [Source:HGNC Symbol;Acc:HGNC:10017])

HSP 1 Score: 77.0258 bits (188), Expect = 1.364e-15
Identity = 53/170 (31.18%), Postives = 85/170 (50.00%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLL---LPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKE----VSDAYLVIYAIDDNSSFETCRK---LIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V + G  GVGK+++  Q +    P+Y         +  +A   +V IDN+ + L ++D+     F   +E      + +++ Y++ D  SF+   K   LI  +  T   P  ++LV NK DL + R VST++G  LA  YN  F E S +L  C+D+    LV E+R
Sbjct:   21 YKVVMLGAGGVGKSAMTMQFISHQFPDY------HDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIP--LVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIR 182          
BLAST of GTP-binding protein vs. Ensembl Celegans
Match: Y52B11A.4 (pep chromosome:WBcel235:I:10979802:11004283:-1 gene:WBGene00013124.1 transcript:Y52B11A.4.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y52B11A.4)

HSP 1 Score: 73.1738 bits (178), Expect = 7.839e-14
Identity = 54/165 (32.73%), Postives = 84/165 (50.91%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEVSDAYLVIYAIDDNSSFETCR---KLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNA 1116
            Y + + G  G GK+SL  QL+  EY  + ADEI+ +     + + I   E  L   +S+  +      E+  A+LV+Y+ID  SS++      ++I +   T   P LV    NK DL R R V+  + +        +  EIS +L+H VD+LLV LV E++ A
Sbjct:  238 YKIYVVGDTGTGKSSLISQLITSEYKNAFADEIQDYENT--VSICIGGVECDLVFFESDMSDPCWLTNEIH-AFLVVYSIDSKSSWKQAMVALEMIRDRPGTRNLPTLV--AGNKIDLERKRTVTKQEVRAAKAAMGFEHFEISVALDHDVDDLLVGLVAEIQEA 397          
BLAST of GTP-binding protein vs. Ensembl Celegans
Match: Y52B11A.4 (pep chromosome:WBcel235:I:10979607:11004283:-1 gene:WBGene00013124.1 transcript:Y52B11A.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y52B11A.4)

HSP 1 Score: 73.1738 bits (178), Expect = 7.839e-14
Identity = 54/165 (32.73%), Postives = 84/165 (50.91%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEVSDAYLVIYAIDDNSSFETCR---KLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNA 1116
            Y + + G  G GK+SL  QL+  EY  + ADEI+ +     + + I   E  L   +S+  +      E+  A+LV+Y+ID  SS++      ++I +   T   P LV    NK DL R R V+  + +        +  EIS +L+H VD+LLV LV E++ A
Sbjct:  238 YKIYVVGDTGTGKSSLISQLITSEYKNAFADEIQDYENT--VSICIGGVECDLVFFESDMSDPCWLTNEIH-AFLVVYSIDSKSSWKQAMVALEMIRDRPGTRNLPTLV--AGNKIDLERKRTVTKQEVRAAKAAMGFEHFEISVALDHDVDDLLVGLVAEIQEA 397          
BLAST of GTP-binding protein vs. Ensembl Celegans
Match: rheb-1 (GTP-binding protein Rheb homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:P34443])

HSP 1 Score: 68.9366 bits (167), Expect = 2.629e-13
Identity = 52/166 (31.33%), Postives = 88/166 (53.01%), Query Frame = 1
Query:  637 VTLFGQDGVGKTSLC---QQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENF-IEPKEVS---DAYLVIYAIDDNSSFETCRKLIANLVLT--NVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEM 1107
            V + G   VGK++L     Q + PE   S  ++  S + A   R      +  LR+ D+   + + + P+  S   + ++++YAIDD  SFE C  +   +V T  + + P+VI V NK+DL   RVV  ++G+ LA  ++ KF EI+   ++ V E+  LL+ E+
Sbjct:   16 VAVMGYPHVGKSALVLRFTQNIFPERYESTIEDQHSKHIAAFHR------DYHLRVTDTAGQQEYTVFPRSCSLDINGFILVYAIDDRKSFEMCSNIYEKIVRTYGDTSIPIVI-VGNKTDLSTQRVVRAEEGEELARQWDAKFVEITARESNRVHEVFELLLREI 174          
BLAST of GTP-binding protein vs. Ensembl Celegans
Match: F20D6.8 (pep chromosome:WBcel235:V:8164749:8168269:-1 gene:WBGene00017637.1 transcript:F20D6.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F20D6.8)

HSP 1 Score: 67.3958 bits (163), Expect = 4.137e-12
Identity = 64/243 (26.34%), Postives = 114/243 (46.91%), Query Frame = 1
Query:  430 VRLRSFRRTTKGIVCNKDTIEIESEKELSRSFDTRNLSNNNEHFHFKNDRKSELENQKLPNDGEIIRYTVTL--FGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNE-----AQMIRVLIDNQESILRLIDSENCENFIEP-KEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPL---VILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKR 1125
             RLRSF     G + +K   +  SEK+         LS N   F   ++R++   +  L +    +   V L  +G    GK SL  ++    +  S A E    +E      +M   L++ +E  L ++     EN   P ++    Y+V+Y +D+  SF    +++  + L N+N P+   + L+ NK DL R++V+ST++GK +A  +   F E+S  L    +E    ++ E++  S+R
Sbjct:  112 TRLRSFD-LRDGHIFDKGFQKKPSEKDF--------LSVNGTGFRRGDNRRATCPDIFLFDSQNCLMKHVVLRIYGARNCGKKSLANRIH--HFATSMAPERVDPDENGNDYTKMTTFLLNGREVTLEILLESTLEN--SPFRQSKTLYIVMYNMDNRQSFIYATQILERITLANLNNPVPLQLFLIGNKCDLKRNQVISTNEGKSVARTFKCDFLEVSALLGMNTEETWTTILKELQEPSER 341          
BLAST of GTP-binding protein vs. Ensembl Celegans
Match: rab-37 (RAB family [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASU7])

HSP 1 Score: 63.929 bits (154), Expect = 1.538e-11
Identity = 60/212 (28.30%), Postives = 91/212 (42.92%), Query Frame = 1
Query:  550 NEHFHFKNDRKSELENQKLPNDGEIIRYTVTLFGQDGVGKTSLC----QQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENF----IEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEKHKVNFISKG 1161
            NEH   K+  +SE+ +  +    E+  + V L G    GKT L         L    +S    I   N+     + + +++  L++ D+   E F          +DA L++Y I + +SFE CR  ++ +         V LV NK DL   R V TD+GKRLA  Y + F E S      VD   + L       ++R  K K  F+  G
Sbjct:    6 NEHASLKSKHRSEMLDLDM---AELTTFKVMLLGDSCTGKTCLLIRYKDGAFLNNNFISTVG-IDYRNKL----ITMGDKKVKLQIWDTAGQERFRSVTTSYYRDADALLLVYDIANRASFENCRNWLSQIKEYGKEAVQVTLVGNKCDL--PRAVPTDEGKRLAEAYQIPFMETSAKTGFNVDRAFLGL-------AERMLKLKYGFVPGG 200          
BLAST of GTP-binding protein vs. Ensembl Fly
Match: Rgk1 (gene:FBgn0264753 transcript:FBtr0334282)

HSP 1 Score: 112.849 bits (281), Expect = 9.480e-27
Identity = 87/278 (31.29%), Postives = 137/278 (49.28%), Query Frame = 1
Query:  340 GDMSSKDP--LVIEPEKDQLLSNVSSGEENKIVRLRSFRRTTKGIVCNKDTIE----IESEKELSRSFDTRNLSNNNE---------HFHFKNDRKSELENQKLPNDGEIIRYTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEV-----SDAYLVIYAIDDNSSFETCRKLIANLVL-TNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            G  +S  P  L +  ++ ++ S  ++G E +  RLR F  T KG+V   D+++      +    S +  T +L+   +              + R+S   N   P +G    Y V + G   VGK+SL  Q +  EYL +    I   +  + + VL+  +ES L  ID    E  + P E         Y VIY+  D SSF    +++  L    N+    VILV+NK+DL RSR+V++++GK +A  Y+ KF E S  +NH VDELLV L++++R
Sbjct:  134 GSRASGRPNQLCLPQQRSRVASMPNTGVEEEYYRLRHFSITGKGVVNRGDSLKSRRSRSNNSVASSNSSTEHLTTQQQLSAPASVSARTSLASSRESSTSN---PGNGP---YRVLMLGGPAVGKSSLVSQFMTSEYLHAYDTSIDDESGEKAVSVLLSGEESELIFIDHGYTE--MTPDECLTNYDPHGYCVIYSAADRSSFSVAEQVLQVLWTNQNIAQKAVILVSNKADLARSRLVTSEEGKAMATAYDCKFIETSVGINHNVDELLVGLLSQIR 403          
BLAST of GTP-binding protein vs. Ensembl Fly
Match: Rgk1 (gene:FBgn0264753 transcript:FBtr0334283)

HSP 1 Score: 113.235 bits (282), Expect = 2.180e-26
Identity = 87/278 (31.29%), Postives = 137/278 (49.28%), Query Frame = 1
Query:  340 GDMSSKDP--LVIEPEKDQLLSNVSSGEENKIVRLRSFRRTTKGIVCNKDTIE----IESEKELSRSFDTRNLSNNNE---------HFHFKNDRKSELENQKLPNDGEIIRYTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEV-----SDAYLVIYAIDDNSSFETCRKLIANLVL-TNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            G  +S  P  L +  ++ ++ S  ++G E +  RLR F  T KG+V   D+++      +    S +  T +L+   +              + R+S   N   P +G    Y V + G   VGK+SL  Q +  EYL +    I   +  + + VL+  +ES L  ID    E  + P E         Y VIY+  D SSF    +++  L    N+    VILV+NK+DL RSR+V++++GK +A  Y+ KF E S  +NH VDELLV L++++R
Sbjct: 1015 GSRASGRPNQLCLPQQRSRVASMPNTGVEEEYYRLRHFSITGKGVVNRGDSLKSRRSRSNNSVASSNSSTEHLTTQQQLSAPASVSARTSLASSRESSTSN---PGNGP---YRVLMLGGPAVGKSSLVSQFMTSEYLHAYDTSIDDESGEKAVSVLLSGEESELIFIDHGYTE--MTPDECLTNYDPHGYCVIYSAADRSSFSVAEQVLQVLWTNQNIAQKAVILVSNKADLARSRLVTSEEGKAMATAYDCKFIETSVGINHNVDELLVGLLSQIR 1284          
BLAST of GTP-binding protein vs. Ensembl Fly
Match: Rgk1 (gene:FBgn0264753 transcript:FBtr0334284)

HSP 1 Score: 104.375 bits (259), Expect = 6.939e-24
Identity = 90/296 (30.41%), Postives = 141/296 (47.64%), Query Frame = 1
Query:  340 GDMSSKDP--LVIEPEKDQLLSNVSSGEENKIVRLRSFRRTTKGIVCNKDTIE----IESEKELSRSFDTRNLSNNNE---------HFHFKNDRKSELENQKLPNDGEIIRYTVTLFGQDGVGKTSLCQQLLLPEYLVS------------------QADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEV-----SDAYLVIYAIDDNSSFETCRKLIANLVL-TNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            G  +S  P  L +  ++ ++ S  ++G E +  RLR F  T KG+V   D+++      +    S +  T +L+   +              + R+S   N   P +G    Y V + G   VGK+SL  Q +  EYL +                   AD+ +S  +A  + VL+  +ES L  ID    E  + P E         Y VIY+  D SSF    +++  L    N+    VILV+NK+DL RSR+V++++GK +A  Y+ KF E S  +NH VDELLV L++++R
Sbjct:  134 GSRASGRPNQLCLPQQRSRVASMPNTGVEEEYYRLRHFSITGKGVVNRGDSLKSRRSRSNNSVASSNSSTEHLTTQQQLSAPASVSARTSLASSRESSTSN---PGNGP---YRVLMLGGPAVGKSSLVSQFMTSEYLHAYDTSIDLGNCDIRILIEKAADDDESGEKA--VSVLLSGEESELIFIDHGYTE--MTPDECLTNYDPHGYCVIYSAADRSSFSVAEQVLQVLWTNQNIAQKAVILVSNKADLARSRLVTSEEGKAMATAYDCKFIETSVGINHNVDELLVGLLSQIR 419          
BLAST of GTP-binding protein vs. Ensembl Fly
Match: CG42541 (gene:FBgn0260658 transcript:FBtr0332389)

HSP 1 Score: 100.908 bits (250), Expect = 2.020e-22
Identity = 72/233 (30.90%), Postives = 114/233 (48.93%), Query Frame = 1
Query:  433 RLRSFRRTTKGIVCNKDTIEIESEKELSRSFDTRNLSNNNEHFHFKNDRKSELENQKLPNDGEIIRYTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEVS---DAYLVIYAIDDNSSFETCRKLIANL----VLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            RLRSF  T+ GI CN              S  +   SN+    H  N   S    + +  D  +  Y + + G  GVGKT+L  Q    +Y+ +    +      + + VL+DN E+ L +ID   CE   E    +   D ++V+Y++ D ++F    +++  L    +L +      ILVANK+DL R RVV+   G+++A     KF E S+ L+H VDELLV +V +++
Sbjct:  926 RLRSFSITSHGI-CNLGDSLRSRRSRSINSVTSTGTSNSGVDRH--NSNASGASGEVIDGDPNVPAYKIAMLGASGVGKTTLTYQFTTSDYICAYDLSLDDDYGQKTVSVLVDNIETDLEIIDHPACEMSTEAFCATYNIDLFVVVYSVIDRNTFAAAERVLQYLKENEMLLSRG---AILVANKTDLQRHRVVTRQMGRKVAKEIACKFIETSSGLDHNVDELLVGIVAQVK 1152          
BLAST of GTP-binding protein vs. Ensembl Fly
Match: Rgk2 (gene:FBgn0085419 transcript:FBtr0112633)

HSP 1 Score: 100.523 bits (249), Expect = 2.438e-22
Identity = 63/186 (33.87%), Postives = 100/186 (53.76%), Query Frame = 1
Query:  607 PNDGEII------RYTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIE---PKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTN-VNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEK 1134
            P+D E +      RY V + G  GVGKT+L  Q +  EY+ +    +      + + VL+D++ES +  ID  + E  +E           +V++++ D SSF    ++I  L   N      VILV NK+DL R+R++++ +GK LA   + KF E S+ + H VDELLV ++ +MR   KR +K
Sbjct:  513 PDDSENLDPPPPARYRVVMLGDAGVGKTALVNQFMTSEYMHTYDASLDDEFGEKTVSVLLDDEESDMVFIDHPSVEMSVENSLSTYEPHGCVVVFSVVDRSSFRVAEEIINYLWQENYTKDKAVILVGNKADLARARLITSQEGKALAASRDAKFIETSSGIQHNVDELLVGILKQMRLKEKREKK 698          
BLAST of GTP-binding protein vs. Ensembl Zebrafish
Match: rem1 (RAS (RAD and GEM)-like GTP-binding 1 [Source:ZFIN;Acc:ZDB-GENE-040317-1])

HSP 1 Score: 87.4261 bits (215), Expect = 7.223e-19
Identity = 62/171 (36.26%), Postives = 94/171 (54.97%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVL-IDNQESILRLID------SENCENFIEP--KEVSDAYLVIYAIDDNSSFETCRKLIANL--VLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G  GVGK+SL          + + D  K   E    R L +D +++ L ++D       E+ E F++    +V +AY+++Y+I D SSFE+  +L   L  +    N P +ILV NKSDLVRSR V+ ++G+  A +++ KF E S SL+H V EL    V ++R
Sbjct:   77 YRVVLLGDHGVGKSSLANIFAG----IQEKDAHKHIGEDAYERTLMVDGEDTTLVVMDPWETDKQEDDEKFLQDYCMQVGNAYIIVYSITDRSSFESASELRIQLRRIRQAENIP-IILVGNKSDLVRSREVAVEEGRACAVMFDCKFIETSASLHHNVHELFEGTVRQIR 242          
BLAST of GTP-binding protein vs. Ensembl Zebrafish
Match: rem1 (RAS (RAD and GEM)-like GTP-binding 1 [Source:ZFIN;Acc:ZDB-GENE-040317-1])

HSP 1 Score: 87.4261 bits (215), Expect = 7.223e-19
Identity = 62/171 (36.26%), Postives = 94/171 (54.97%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVL-IDNQESILRLID------SENCENFIEP--KEVSDAYLVIYAIDDNSSFETCRKLIANL--VLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G  GVGK+SL          + + D  K   E    R L +D +++ L ++D       E+ E F++    +V +AY+++Y+I D SSFE+  +L   L  +    N P +ILV NKSDLVRSR V+ ++G+  A +++ KF E S SL+H V EL    V ++R
Sbjct:   77 YRVVLLGDHGVGKSSLANIFAG----IQEKDAHKHIGEDAYERTLMVDGEDTTLVVMDPWETDKQEDDEKFLQDYCMQVGNAYIIVYSITDRSSFESASELRIQLRRIRQAENIP-IILVGNKSDLVRSREVAVEEGRACAVMFDCKFIETSASLHHNVHELFEGTVRQIR 242          
BLAST of GTP-binding protein vs. Ensembl Zebrafish
Match: rrad (Ras-related associated with diabetes [Source:ZFIN;Acc:ZDB-GENE-030131-5607])

HSP 1 Score: 83.1889 bits (204), Expect = 2.024e-17
Identity = 57/166 (34.34%), Postives = 94/166 (56.63%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCEN--FIEPK--EVSDAYLVIYAIDDNSSFETCRKLIANL--VLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G+ GVGK+SL +        V  +++ +         +++D++E+ + L D    +N  +++ +   + DAY+++Y++ D SSFE   +L   L     + N P +ILV NKSDLVRSR VS D+G   A +++ KF E S SL+H V +L   +V ++R
Sbjct:   84 YKVVLLGEHGVGKSSLARIF----GGVEDSNDCEETGNTYDRSLVVDDEETSILLYDIWEQDNSQWLQDQCMRMGDAYIIVYSVTDKSSFEKASELRIQLRRARQSENIP-IILVGNKSDLVRSREVSMDEGSACAVVFDCKFIETSASLHHNVRDLFEGIVRQIR 244          
BLAST of GTP-binding protein vs. Ensembl Zebrafish
Match: rrad (Ras-related associated with diabetes [Source:ZFIN;Acc:ZDB-GENE-030131-5607])

HSP 1 Score: 83.1889 bits (204), Expect = 2.024e-17
Identity = 57/166 (34.34%), Postives = 94/166 (56.63%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCEN--FIEPK--EVSDAYLVIYAIDDNSSFETCRKLIANL--VLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G+ GVGK+SL +        V  +++ +         +++D++E+ + L D    +N  +++ +   + DAY+++Y++ D SSFE   +L   L     + N P +ILV NKSDLVRSR VS D+G   A +++ KF E S SL+H V +L   +V ++R
Sbjct:   84 YKVVLLGEHGVGKSSLARIF----GGVEDSNDCEETGNTYDRSLVVDDEETSILLYDIWEQDNSQWLQDQCMRMGDAYIIVYSVTDKSSFEKASELRIQLRRARQSENIP-IILVGNKSDLVRSREVSMDEGSACAVVFDCKFIETSASLHHNVRDLFEGIVRQIR 244          
BLAST of GTP-binding protein vs. Ensembl Zebrafish
Match: rit1 (Ras-like without CAAX 1 [Source:ZFIN;Acc:ZDB-GENE-070912-329])

HSP 1 Score: 80.1073 bits (196), Expect = 6.357e-17
Identity = 50/170 (29.41%), Postives = 88/170 (51.76%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLL---LPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKE----VSDAYLVIYAIDDNSSFETCR--KLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRN 1113
            Y + + G+ GVGK+++  Q +    PE      D   +  +A   ++ ID++ + L ++D+     F   ++      + +++ Y+I D  SF+  R  K +   V   V+ P V+LV NKSDLV  R VS ++GK+LA  +   F E S +  + +DE+   LV ++R 
Sbjct:   14 YKLVMLGEGGVGKSAIIMQFISHRFPE------DHDPTIEDAYKTQIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIISYSITDRRSFQEARHFKQLIYRVRRTVDTP-VVLVGNKSDLVHLRQVSVEEGKQLAREFQCPFFETSAAFRYYIDEVFAALVRQIRQ 176          
BLAST of GTP-binding protein vs. Ensembl Xenopus
Match: plekhf2 (pleckstrin homology and FYVE domain containing 2 [Source:Xenbase;Acc:XB-GENE-959911])

HSP 1 Score: 85.8853 bits (211), Expect = 3.479e-18
Identity = 56/167 (33.53%), Postives = 93/167 (55.69%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLL-LPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLID---SENCENFIEPK--EVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPL-VILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G+ GVGK++L      +P+ +    D +  +   +   +++D + + L LID   ++  +N+I  +  +V DAYL++Y+I D +SFE   +L   L        + +ILV NKSDLVR R VS  +G+  A +++ KF E S ++ H V EL   +V ++R
Sbjct:   79 YRVVLIGEQGVGKSTLANIFAGVPDSVDGDCDMLAENTYER--NLMVDGESATLILIDMWENKAQDNWIREQCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVR 243          
BLAST of GTP-binding protein vs. Ensembl Xenopus
Match: mark4 (MAP/microtubule affinity-regulating kinase 4 [Source:Xenbase;Acc:XB-GENE-6042140])

HSP 1 Score: 85.1149 bits (209), Expect = 7.943e-18
Identity = 55/165 (33.33%), Postives = 94/165 (56.97%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLID-SENCENFI---EPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPL-VILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G+ GVGK+SL +     E L    +   +++ +    +++D +E+ L + D  E  +N     +  ++ DAY+++Y++ D +SFE   +L   L     +  + +ILV NKSDLVRSR VS ++G+  A +++ KF E S SL+H V +L   +V ++R
Sbjct:   87 YKVILLGEHGVGKSSLARIFGGVEDLHDVEEAGNTYDRS----IVVDGEEACLLVFDIWEQDDNHWLHNQCMKMGDAYVIVYSVTDKASFEKASELRIQLRRARQSEDIPIILVGNKSDLVRSREVSVEEGRACAVVFDCKFIETSASLHHNVKDLFEGIVRQIR 247          
BLAST of GTP-binding protein vs. Ensembl Xenopus
Match: rem1 (RAS (RAD and GEM)-like GTP-binding 1 [Source:NCBI gene;Acc:100124825])

HSP 1 Score: 83.9593 bits (206), Expect = 1.527e-17
Identity = 57/170 (33.53%), Postives = 95/170 (55.88%), Query Frame = 1
Query:  637 VTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQM----IRVLIDNQESILRLIDSE--NCENFIE----PKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNV--NPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            V L G  GVGK+SL          + + ++ +   E Q+      +++D +E+ L ++D++  N +  IE    P  + +AY+++Y++ D +SFE+  +L   L  T    N P +ILV NK+DLVRSR VS ++G+  A +++ KF E S  L H V EL   +V ++R
Sbjct:   64 VVLLGDPGVGKSSL--------VAIFRREQDREAAEQQLEVFDCTLMVDGKETTLLVMDTDERNMKKAIESSDSPMRLGNAYIIVYSVTDRASFESASELRIQLRRTRQAENIP-IILVGNKTDLVRSREVSVEEGRACAVVFDCKFIETSAVLQHNVQELFEGMVRQIR 224          
BLAST of GTP-binding protein vs. Ensembl Xenopus
Match: LRP10 (RAS (RAD and GEM)-like GTP binding 2 [Source:NCBI gene;Acc:100488324])

HSP 1 Score: 82.4185 bits (202), Expect = 5.135e-17
Identity = 55/167 (32.93%), Postives = 92/167 (55.09%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIR-VLIDNQESILRLID---SENCENFIEPK--EVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPL-VILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G  GVGK++L       E       E   H E    R +L+D +++ L + D       +++++    ++ DA+L+I+++ D S+F+    L+  L     +  + +ILV NK DLVRSR V+ ++G+ LAG+ N K+ EIS +L+H   ELL  +V ++R
Sbjct:   73 YKVMLLGDSGVGKSTLAGIFGGVEDTFPHGSE---HPEDTYERNLLVDGEKTTLIVYDIWEEAGSQSWMQDSCLQMGDAFLLIFSVTDRSTFQRLPSLLLQLRTARPHRHIPIILVGNKGDLVRSREVNMEEGRSLAGMLNCKYTEISAALHHNTHELLEGVVRQIR 236          
BLAST of GTP-binding protein vs. Ensembl Xenopus
Match: LRP10 (RAS (RAD and GEM)-like GTP binding 2 [Source:NCBI gene;Acc:100488324])

HSP 1 Score: 79.337 bits (194), Expect = 3.591e-15
Identity = 58/170 (34.12%), Postives = 93/170 (54.71%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIR-VLIDNQESILRLID---SENCENFIEPK--EVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNP----PLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G  GVGK++L       E       E   H E    R +L+D +++ L + D       +++++    ++ DA+L+I+++ D S+F+    L+  L L    P    P +ILV NK DLVRSR V+ ++G+ LAG+ N K+ EIS +L+H   ELL  +V ++R
Sbjct:  697 YKVMLLGDSGVGKSTLAGIFGGVEDTFPHGSE---HPEDTYERNLLVDGEKTTLIVYDIWEEAGSQSWMQDSCLQMGDAFLLIFSVTDRSTFQRLPSLL--LQLRTARPHRHIP-IILVGNKGDLVRSREVNMEEGRSLAGMLNCKYTEISAALHHNTHELLEGVVRQIR 860          
BLAST of GTP-binding protein vs. Ensembl Mouse
Match: Rem1 (rad and gem related GTP binding protein 1 [Source:MGI Symbol;Acc:MGI:1097696])

HSP 1 Score: 84.3445 bits (207), Expect = 8.353e-18
Identity = 57/170 (33.53%), Postives = 89/170 (52.35%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMI--RVL-IDNQESILRLIDSENCENFIEPK------EVSDAYLVIYAIDDNSSFETCRKLIANLVLTN-VNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G  GVGKTSL         L ++  +   H +   +  R L +D +++ L ++D+   E   E        +   AY+++Y+I D SSFE+  +L   L  T+  N   +ILV NK+DL R R VS ++G+  A +++ KF E S +L H V EL   +V ++R
Sbjct:   81 YRVVLLGDPGVGKTSLAS-------LFAEKQDRDPHEQLGGVYERTLSVDGEDTTLVVMDTWEAEKLDESWCQESCLQAGSAYVIVYSIADRSSFESASELRIQLRRTHQANHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVTELFEGVVRQLR 243          
BLAST of GTP-binding protein vs. Ensembl Mouse
Match: Rrad (Ras-related associated with diabetes [Source:MGI Symbol;Acc:MGI:1930943])

HSP 1 Score: 80.1073 bits (196), Expect = 3.109e-16
Identity = 53/165 (32.12%), Postives = 82/165 (49.70%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLID----SENCENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPL-VILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G  GVGK++L +        +    E ++        + +D +E+ L + D       C        + DAY+++Y+I D  SFE   +L   L        + +ILV NKSDLVRSR VS D+G+  A +++ KF E S +L+H V  L   +V ++R
Sbjct:   91 YKVLLLGAPGVGKSALARIF----GGIEDGPEAEAAGHTYDRSITVDGEEASLLVYDIWEQDGGCWLPGHCMAMGDAYVIVYSITDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIR 251          
BLAST of GTP-binding protein vs. Ensembl Mouse
Match: Gem (GTP binding protein (gene overexpressed in skeletal muscle) [Source:MGI Symbol;Acc:MGI:99844])

HSP 1 Score: 78.5666 bits (192), Expect = 9.403e-16
Identity = 56/167 (33.53%), Postives = 85/167 (50.90%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLI-DNQESILRLID-----SENCENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPL-VILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G+ GVGK++L    +      S   + +   E    R L+ D + + + L+D      EN        +V DAYL++Y+I D +SFE   +L   L        + +ILV NKSDLVR R VS  +G+  A +++ KF E S ++ H V EL   +V ++R
Sbjct:   75 YRVVLIGEQGVGKSTLAN--IFAGVHDSMDSDCEVLGEDTYERTLVVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVR 239          
BLAST of GTP-binding protein vs. Ensembl Mouse
Match: Gem (GTP binding protein (gene overexpressed in skeletal muscle) [Source:MGI Symbol;Acc:MGI:99844])

HSP 1 Score: 78.5666 bits (192), Expect = 9.403e-16
Identity = 56/167 (33.53%), Postives = 85/167 (50.90%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLI-DNQESILRLID-----SENCENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPL-VILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G+ GVGK++L    +      S   + +   E    R L+ D + + + L+D      EN        +V DAYL++Y+I D +SFE   +L   L        + +ILV NKSDLVR R VS  +G+  A +++ KF E S ++ H V EL   +V ++R
Sbjct:   75 YRVVLIGEQGVGKSTLAN--IFAGVHDSMDSDCEVLGEDTYERTLVVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVR 239          
BLAST of GTP-binding protein vs. Ensembl Mouse
Match: Rem2 (rad and gem related GTP binding protein 2 [Source:MGI Symbol;Acc:MGI:2155260])

HSP 1 Score: 73.9442 bits (180), Expect = 4.914e-14
Identity = 52/169 (30.77%), Postives = 87/169 (51.48%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLID---SENCENFIEPK--EVSDAYLVIYAIDDNSSF----ETCRKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            + V L G+ GVGK++L             A E+++  +    R+++D +E  L + D     +   +++    +  DA+L+++++ D  SF    ET  +L A     ++    VILV NKSDL RSR VS ++G+ LAG  + K  E S +L+H   EL    V ++R
Sbjct:  116 FKVMLVGESGVGKSTLAGTFG--GLQGDHAHEMENSEDTYERRIMVDKEEVTLIVYDIWEQGDAGGWLQDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLP---VILVGNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIR 279          
BLAST of GTP-binding protein vs. UniProt/SwissProt
Match: sp|O35929|REM1_MOUSE (GTP-binding protein REM 1 OS=Mus musculus OX=10090 GN=Rem1 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 5.843e-17
Identity = 57/170 (33.53%), Postives = 89/170 (52.35%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMI--RVL-IDNQESILRLIDSENCENFIEPK------EVSDAYLVIYAIDDNSSFETCRKLIANLVLTN-VNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G  GVGKTSL         L ++  +   H +   +  R L +D +++ L ++D+   E   E        +   AY+++Y+I D SSFE+  +L   L  T+  N   +ILV NK+DL R R VS ++G+  A +++ KF E S +L H V EL   +V ++R
Sbjct:   81 YRVVLLGDPGVGKTSLAS-------LFAEKQDRDPHEQLGGVYERTLSVDGEDTTLVVMDTWEAEKLDESWCQESCLQAGSAYVIVYSIADRSSFESASELRIQLRRTHQANHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVTELFEGVVRQLR 243          
BLAST of GTP-binding protein vs. UniProt/SwissProt
Match: sp|P55043|RAD_RAT (GTP-binding protein RAD OS=Rattus norvegicus OX=10116 GN=Rrad PE=2 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 8.071e-16
Identity = 53/164 (32.32%), Postives = 80/164 (48.78%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLID----SENCENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V   G  GVGK++L +        V    E ++        + +D +E+ L + D       C        + DAY+++Y+I D  SFE   +L   L         +ILV NKSDLVRSR VS D+G+  A +++ KF E S +L+H V  L   +V ++R
Sbjct:   91 YKVHAAGAPGVGKSALARIF----GGVEDGPEAEAAGHTYDRSITVDGEEASLMVYDIWEQDGGCWLPGHCMAMGDAYVIVYSITDKGSFEKASELRVQLRARRQTDVPIILVGNKSDLVRSREVSVDEGRACAEVFDCKFIETSAALHHNVQALFEGVVRQIR 250          
BLAST of GTP-binding protein vs. UniProt/SwissProt
Match: sp|P55042|RAD_HUMAN (GTP-binding protein RAD OS=Homo sapiens OX=9606 GN=RRAD PE=1 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 1.806e-15
Identity = 52/165 (31.52%), Postives = 86/165 (52.12%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLID--SENCENFIEPK--EVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPL-VILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G  GVGK++L +        V    E ++        +++D +E+ L + D   ++   ++      + DAY+++Y++ D  SFE   +L   L        + +ILV NKSDLVRSR VS D+G+  A +++ KF E S +L+H V  L   +V ++R
Sbjct:   92 YKVLLLGAPGVGKSALARIF----GGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIR 252          
BLAST of GTP-binding protein vs. UniProt/SwissProt
Match: sp|O88667|RAD_MOUSE (GTP-binding protein RAD OS=Mus musculus OX=10090 GN=Rrad PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.028e-15
Identity = 53/165 (32.12%), Postives = 82/165 (49.70%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLID----SENCENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPL-VILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G  GVGK++L +        +    E ++        + +D +E+ L + D       C        + DAY+++Y+I D  SFE   +L   L        + +ILV NKSDLVRSR VS D+G+  A +++ KF E S +L+H V  L   +V ++R
Sbjct:   92 YKVLLLGAPGVGKSALARIF----GGIEDGPEAEAAGHTYDRSITVDGEEASLLVYDIWEEDGGCWLPGHCMAMGDAYVIVYSITDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIR 252          
BLAST of GTP-binding protein vs. UniProt/SwissProt
Match: sp|P55040|GEM_HUMAN (GTP-binding protein GEM OS=Homo sapiens OX=9606 GN=GEM PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.645e-15
Identity = 53/166 (31.93%), Postives = 85/166 (51.20%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLID-----SENCENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPL-VILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G+ GVGK++L          +    E+   +  +   +++D + + + L+D      EN        +V DAYL++Y+I D +SFE   +L   L        + +ILV NKSDLVR R VS  +G+  A +++ KF E S ++ H V EL   +V ++R
Sbjct:   76 YRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERT-LMVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVR 240          
BLAST of GTP-binding protein vs. TrEMBL
Match: A0A1I8IKG0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.067e-35
Identity = 81/223 (36.32%), Postives = 129/223 (57.85%), Query Frame = 1
Query:  604 LPNDGEIIRYTVTLFGQDGVGKTSLCQQLLLPE--YLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEV----SDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEKHKVNFISKGFQNTPYRSSLKIKVSNNAVSRFIQKHFNKSS 1254
            LP+      Y V + G   VGKT++C+Q +  E   L S  D+    ++ + + VL+D++E  +  +D+E  ++   PK V     DAY++++A+D   SF   ++++  LV        +I+VANKSDLVRSR V+ D  K LAG+YN KF EIST+LNH VDELLV ++ +++   ++ EK +   ISK       R+S++++     +  FI+KHF   S
Sbjct:   65 LPSCSPCQSYRVQVMGAPRVGKTTMCEQFMSSENKVLDSTDDDQLDESQEKFVTVLLDSEEYHMTFLDTERADD---PKSVIVMDVDAYMIVFAVDSRRSFNFAKQILNELVSEARKSAALIIVANKSDLVRSREVTRDDAKNLAGVYNAKFIEISTALNHNVDELLVSILGQIKTQQRKMEKERSKLISKEKDGRGLRASMRLRSPRTMIGNFIKKHFTSKS 284          
BLAST of GTP-binding protein vs. TrEMBL
Match: A0A267F7W1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034202g1 PE=4 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 2.281e-34
Identity = 81/223 (36.32%), Postives = 129/223 (57.85%), Query Frame = 1
Query:  604 LPNDGEIIRYTVTLFGQDGVGKTSLCQQLLLPE--YLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEV----SDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEKHKVNFISKGFQNTPYRSSLKIKVSNNAVSRFIQKHFNKSS 1254
            LP+      Y V + G   VGKT++C+Q +  E   L S  D+    ++ + + VL+D++E  +  +D+E  ++   PK V     DAY++++A+D   SF   ++++  LV        +I+VANKSDLVRSR V+ D  K LAG+YN KF EIST+LNH VDELLV ++ +++   ++ EK +   ISK       R+S++++     +  FI+KHF   S
Sbjct:  312 LPSCSPCQSYRVQVMGAPRVGKTTMCEQFMSSENKVLDSTDDDQLDESQEKFVTVLLDSEEYHMTFLDTERADD---PKSVIVMDVDAYMIVFAVDSRRSFNFAKQILNELVSEARKSAALIIVANKSDLVRSREVTRDDAKNLAGVYNAKFIEISTALNHNVDELLVSILGQIKTQQRKMEKERSKLISKEKDGRGLRASMRLRSPRTMIGNFIKKHFTSKS 531          
BLAST of GTP-binding protein vs. TrEMBL
Match: A0A267GKK7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032032g1 PE=4 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 2.315e-34
Identity = 81/223 (36.32%), Postives = 129/223 (57.85%), Query Frame = 1
Query:  604 LPNDGEIIRYTVTLFGQDGVGKTSLCQQLLLPE--YLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEV----SDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEKHKVNFISKGFQNTPYRSSLKIKVSNNAVSRFIQKHFNKSS 1254
            LP+      Y V + G   VGKT++C+Q +  E   L S  D+    ++ + + VL+D++E  +  +D+E  ++   PK V     DAY++++A+D   SF   ++++  LV        +I+VANKSDLVRSR V+ D  K LAG+YN KF EIST+LNH VDELLV ++ +++   ++ EK +   ISK       R+S++++     +  FI+KHF   S
Sbjct:  315 LPSCSPCQSYRVQVMGAPRVGKTTMCEQFMSSENKVLDSTDDDQLDESQEKFVTVLLDSEEYHMTFLDTERADD---PKSVIVMDVDAYMIVFAVDSRRSFNFAKQILNELVSEARKSAALIIVANKSDLVRSREVTRDDAKNLAGVYNAKFIEISTALNHNVDELLVSILGQIKTQQRKMEKERSKLISKEKDGRGLRASMRLRSPRTMIGNFIKKHFTSKS 534          
BLAST of GTP-binding protein vs. TrEMBL
Match: A0A158QUF3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS6174 PE=4 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 4.054e-31
Identity = 83/223 (37.22%), Postives = 121/223 (54.26%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSE-NCENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEKHKVNF---------ISKGFQNTPYRSSLKIKVS--------NNAVSRFIQKHFN 1245
            YTV + G + VGKT++C Q L  E L    D     N  + + V +D Q++ L LIDS  N E      + +DAYLV+YAIDD  SF+  + +I+ ++        ++LV NKSDLVR+R VS D+GK LA +Y+  F E+S +LNH V+ELLV LV  ++ A++  E+ +               G  +    SSLK K+           A+ RF +KHF+
Sbjct:  270 YTVQVLGAEQVGKTTMCTQFLTSESLYDGFDSADEGNVLETVTVDVDGQQTSLLLIDSNGNEETEFSVIDSADAYLVVYAIDDRESFKKAQTIISEILGRCKIASAIVLVGNKSDLVRARSVSLDEGKHLASVYSCGFYEVSIALNHQVNELLVGLVWAIKAANQHVEEERERLSRIASIKTDAGDGSSSHERTSSLKNKIPFPRHHSGMGKAIKRFFKKHFS 492          
BLAST of GTP-binding protein vs. TrEMBL
Match: G7YB35 (GTP-binding protein RAD OS=Clonorchis sinensis OX=79923 GN=Rrad PE=4 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.832e-30
Identity = 88/219 (40.18%), Postives = 120/219 (54.79%), Query Frame = 1
Query:  634 TVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPK------EVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASK-------RTEKHKVNFISKGFQNTPYRSSL-KIKVSNNAVSRFIQKHFNK 1248
            TV + G   VGKTSLC Q    E L    D  +   + + + V ++N +  L L D+   E+  +        E +DAY+V+YAIDD SSF   R +++ L+        ++L ANKSDLVR+R VS ++GK LA +YN  F EISTSLNH VDELLV +V  ++   +       R EK  +N        T +RSSL  IK   N V +F QKHF+K
Sbjct:  346 TVQVLGMGRVGKTSLCLQFQTSESLDVNLDRTEDE-QTRALTVEVNNMKFNLELFDTNLMEDDFQANAASLIVESADAYVVVYAIDDRSSFLMARSIVSYLLGQCKRSSAILLAANKSDLVRTRAVSVEEGKNLAAVYNCPFYEISTSLNHRVDELLVGIVIAIQERRREVDKERDRLEKMAMNTKHGSLGATAHRSSLGAIKSQTNNVVKFFQKHFSK 563          
BLAST of GTP-binding protein vs. Ensembl Cavefish
Match: rem1 (GTP-binding protein REM 1 [Source:NCBI gene;Acc:103041805])

HSP 1 Score: 85.8853 bits (211), Expect = 2.069e-18
Identity = 64/189 (33.86%), Postives = 101/189 (53.44%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVL-IDNQESILRLIDS------ENCENFIEP--KEVSDAYLVIYAIDDNSSFETCRKLIANL--VLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTE--MRNASKRTEKHKVNFISK 1158
            Y V L G  GVGK+SL          + + D      E    R L +D +E+ L ++D+      E  E +++    +V +AY+++Y+I D SSFE+  +L   L  +    N P +ILV NKSDLVR R V+ ++G+  A +++ KF E S SL+H V EL   +V +  +R  SK T + + +F  +
Sbjct:   78 YRVVLLGDHGVGKSSLASIFAG----IQEKDAHHHIGEDTYERTLTVDGEETTLVVMDTWETEKQEEDEKWVQDYCMQVGNAYVIVYSITDRSSFESASELRIQLRRIRQAENIP-IILVGNKSDLVRCREVAVEEGRACAVVFDCKFIETSASLHHNVHELFEGIVRQIRLRRDSKETNERRRSFYKR 261          
BLAST of GTP-binding protein vs. Ensembl Cavefish
Match: gem (GTP-binding protein GEM [Source:NCBI gene;Acc:103045397])

HSP 1 Score: 84.7297 bits (208), Expect = 3.903e-18
Identity = 56/184 (30.43%), Postives = 93/184 (50.54%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVL---TNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEKHKVNFISKGFQNT 1173
            +TV L G DGVGKT+L   +        Q D  +   E     +++D + + + L+D  + +N     +  DA++++Y+I D +SF+   +L   L      N  P  +ILV NK DLVR R VS ++G+  A +++ KF E S ++ H V  L   +V ++R   +R     +N     FQ +
Sbjct:   67 FTVVLLGDDGVGKTAL-ASIFAGAADSMQCDCEQYGGETVEQHMVVDGESATVTLLDMWDSQNGDSCPQSGDAFIIVYSITDRASFQKASELRVQLRQEREPNQTP--IILVGNKCDLVRRREVSVNEGRTCAMVFDCKFIETSAAMQHNVWPLFEGIVRQLR--LRRDSAEAINRWRAQFQQS 245          
BLAST of GTP-binding protein vs. Ensembl Cavefish
Match: rrad (RRAD, Ras related glycolysis inhibitor and calcium channel regulator [Source:NCBI gene;Acc:103041283])

HSP 1 Score: 81.6481 bits (200), Expect = 8.038e-17
Identity = 60/172 (34.88%), Postives = 94/172 (54.65%), Query Frame = 1
Query:  613 DGEIIRYTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKE----VSDAYLVIYAIDDNSSFETCRKLIANL--VLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            +G+I  Y V L G+ GVGK+SL +     E      D   +++ +    + +D +E+ + L D    +N    K+    + DAY+++Y++ D SSFE   +L   L     + N P +ILV NKSDLVRSR VS ++G   A +++ KF E S SL+H V  L   +V ++R
Sbjct:   87 EGQI--YKVVLLGEHGVGKSSLARIFGGVEDNHDCEDAGNTYDRS----ITVDEEEANILLYDVWEQDNSQWLKDQCMKMGDAYIIVYSVTDKSSFEKASELRIQLRRARQSENIP-IILVGNKSDLVRSREVSVEEGSACAVVFDCKFIETSASLHHNVRTLFEGIVRQIR 251          
BLAST of GTP-binding protein vs. Ensembl Cavefish
Match: rrad (RRAD, Ras related glycolysis inhibitor and calcium channel regulator [Source:NCBI gene;Acc:103041283])

HSP 1 Score: 80.4925 bits (197), Expect = 2.102e-16
Identity = 60/172 (34.88%), Postives = 94/172 (54.65%), Query Frame = 1
Query:  613 DGEIIRYTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKE----VSDAYLVIYAIDDNSSFETCRKLIANL--VLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            +G+I  Y V L G+ GVGK+SL +     E      D   +++ +    + +D +E+ + L D    +N    K+    + DAY+++Y++ D SSFE   +L   L     + N P +ILV NKSDLVRSR VS ++G   A +++ KF E S SL+H V  L   +V ++R
Sbjct:  112 EGQI--YKVVLLGEHGVGKSSLARIFGGVEDNHDCEDAGNTYDRS----ITVDEEEANILLYDVWEQDNSQWLKDQCMKMGDAYIIVYSVTDKSSFEKASELRIQLRRARQSENIP-IILVGNKSDLVRSREVSVEEGSACAVVFDCKFIETSASLHHNVRTLFEGIVRQIR 276          
BLAST of GTP-binding protein vs. Ensembl Cavefish
Match: rit1 (Ras like without CAAX 1 [Source:NCBI gene;Acc:103032482])

HSP 1 Score: 77.7962 bits (190), Expect = 3.379e-16
Identity = 49/170 (28.82%), Postives = 86/170 (50.59%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLL---LPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKE----VSDAYLVIYAIDDNSSFETCR--KLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRN 1113
            Y + + G+ GVGK+++  Q +    PE      D   +  +A   ++ ID++ + L ++D+     F   ++      + +++ Y+I D  SF+  R  K +   V   V+ P V+LV NKSDL   R VS ++GK LA  +   F E S +  + +DE+   LV ++R 
Sbjct:   14 YKLVMLGEGGVGKSAIIMQFISHRFPE------DHDPTIEDAYKTQIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIISYSITDRRSFQEARHFKELIYRVRRTVDTP-VVLVGNKSDLAHLRQVSMEEGKELAREFQCPFFETSAAFRYYIDEVFAALVRQIRQ 176          
BLAST of GTP-binding protein vs. Ensembl Sea Lamprey
Match: RIT2 (Ras like without CAAX 2 [Source:HGNC Symbol;Acc:HGNC:10017])

HSP 1 Score: 73.1738 bits (178), Expect = 3.259e-15
Identity = 49/170 (28.82%), Postives = 87/170 (51.18%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLL---LPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKE----VSDAYLVIYAIDDNSSFETC---RKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y + + G  GVGK+++  Q +    PE      D   +  +A   +V ID++ + L ++D+     F   ++      + +++ Y+I D  SF+     ++LI  +  T   P  V+LV NK+DL   R VS ++G+ LA  ++ +F E S +L   VDE+   +V E+R
Sbjct:   21 YKIVMLGPGGVGKSAMTMQFISHRFPE------DHDPTIEDAYKTQVRIDDETAHLDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFQEAAQFKQLIYQVRHTYEVP--VVLVGNKTDLGEIRQVSQEEGRSLAREFSCQFFETSAALRQYVDEVFYAVVREIR 182          
BLAST of GTP-binding protein vs. Ensembl Sea Lamprey
Match: rheb (Ras homolog, mTORC1 binding [Source:ZFIN;Acc:ZDB-GENE-040426-1690])

HSP 1 Score: 62.003 bits (149), Expect = 1.111e-11
Identity = 48/176 (27.27%), Postives = 88/176 (50.00%), Query Frame = 1
Query:  637 VTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENF-IEPKEVS---DAYLVIYAIDDNSSFETCRKLIANL--VLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEKHKVN 1146
            + + G   VGK+SL  Q +  +++ S    I++     +    ++ QE  L+L+D+   + + + P+  S     Y+++Y++    SFE  R +   L  ++  V+ PLV LV NK DL   RV+S ++GK LA  +N  F E +   +  V E+   ++ E+  A     + K +
Sbjct:    9 IAVLGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKNLT---VNGQEFNLKLVDTAGQDEYSMFPQTYSMDIHGYVLVYSVTSIKSFEVVRVIHEKLLDMVGKVHVPLV-LVGNKKDLHMERVISCEEGKTLATSWNAAFMESTAKEHQTVVEVFKWMIQEIERADGSAHQEKAS 180          
BLAST of GTP-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005561.1 (pep scaffold:Pmarinus_7.0:GL481089:12431:17765:1 gene:ENSPMAG00000005048.1 transcript:ENSPMAT00000005561.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 1.999e-11
Identity = 41/132 (31.06%), Postives = 70/132 (53.03%), Query Frame = 1
Query:  682 QQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKE----VSDAYLVIYAIDDNSSFETCRKLIANLVL---TNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEIST 1056
            Q++ +P+Y  +  D    H E       ID Q +IL ++D+   E F   +E      D +L++Y++ D +SFE   +    L+L      + P+V LVANK DL+  R +ST++G+ +A  Y++ + E S 
Sbjct:   34 QKIFVPDYDPTIEDSYIKHAE-------IDGQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVERF-HQLILRVKDRESFPMV-LVANKVDLLHLRKISTEQGQEMASKYDIPYIETSA 156          
BLAST of GTP-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000518.1 (pep scaffold:Pmarinus_7.0:GL479781:11597:21619:-1 gene:ENSPMAG00000000465.1 transcript:ENSPMAT00000000518.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 8.485e-10
Identity = 39/134 (29.10%), Postives = 69/134 (51.49%), Query Frame = 1
Query:  676 LCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKE----VSDAYLVIYAIDDNSSFETC---RKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEIST 1056
              Q++ + +Y  +  D    H E       ID Q +IL ++D+   E F   +E      D +L++Y++ D +SFE      +LI  +   +  P  +ILVANK DL+  R +S+++G+ +A  Y++ + E S 
Sbjct:   33 FFQKIFVVDYDPTIEDSYIKHTE-------IDGQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVERFHQLILRVKDRDSFP--MILVANKVDLMHLRKISSEQGQEMAAKYSIPYIETSA 157          
BLAST of GTP-binding protein vs. Ensembl Sea Lamprey
Match: mras (muscle RAS oncogene homolog [Source:ZFIN;Acc:ZDB-GENE-050208-495])

HSP 1 Score: 54.6842 bits (130), Expect = 5.516e-9
Identity = 40/133 (30.08%), Postives = 69/133 (51.88%), Query Frame = 1
Query:  682 QQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRL-IDSENCENFIEPKE----VSDAYLVIYAIDDNSSFETCRK---LIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEIST 1056
            Q++ + +Y  +  D    H E       ID Q +IL + +D+   E F   +E      D +L++Y++ D +SFE   K   LI  +   +  P  ++LVANK DL+  R +S+++G+ +A  YN+ + E S 
Sbjct:   35 QKIFVADYDPTIEDSYLKHTE-------IDGQWAILDVCLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDRTSFEHIDKFHQLILRVKDKDSFP--MVLVANKVDLLHLRKISSEQGRDMAAKYNIPYIETSA 158          
BLAST of GTP-binding protein vs. Ensembl Yeast
Match: RSR1 (GTP-binding protein of the Ras superfamily; required for bud site selection, morphological changes in response to mating pheromone, and efficient cell fusion; localized to the plasma membrane; significantly similar to mammalian Rap GTPases [Source:SGD;Acc:S000003384])

HSP 1 Score: 58.9214 bits (141), Expect = 2.779e-10
Identity = 43/165 (26.06%), Postives = 84/165 (50.91%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEV----SDAYLVIYAIDDNSSFETCRKLIANLV-LTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYN-LKFKEISTSLNHCVDELLVLLVTEM 1107
            Y + + G  GVGK+ L  Q +   YL +    I+   ++    + IDN+   L ++D+     F   +E+       +L++Y++ D  S E   +L   ++ + + +   ++L+ NK+DL+  RV+S ++G  ++  +  + F E S  L   VDE+ V LV ++
Sbjct:    4 YKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIE---DSYRKTIEIDNKVFDLEILDTAGIAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVLRIKDSDRVPMVLIGNKADLINERVISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQI 165          
BLAST of GTP-binding protein vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 56.6102 bits (135), Expect = 8.315e-10
Identity = 48/187 (25.67%), Postives = 82/187 (43.85%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEVSDAY-------LVIYAIDDNSSFETCRKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEKHKVNFISKGFQN 1170
            + + L G  GVGK++L  +    E+ +     I      + I V  +N++   ++ D+   E +   + ++ AY       L++Y I  +SS+E C   +  L     +   V L+ NKSDL   R V TD+ K  A    + F E S   +  VD+    L+  +    +   KH+V+    G  N
Sbjct:   14 FKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEV--ENKKIKAQIWDTAGQERY---RAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIF---QMVSKHQVDLSGSGTNN 192          
BLAST of GTP-binding protein vs. Ensembl Yeast
Match: YPT6 (Rab family GTPase; required for endosome-to-Golgii, intra-Golgi retrograde, and retrograde Golgi-to-ER transport; temporarily at the Golgi, dissociating into the cytosol on arrival of the late Golgi GTPase Ypt32p; Golgi-localized form is GTP bound, while cytosolic form is GDP-bound; required for delivery of Atg9p to the phagophore assembly site during autophagy under heat stress, with Ypt6p for starvation induced autophagy and for the CVT pathway; homolog of mammalian Rab6 [Source:SGD;Acc:S000004252])

HSP 1 Score: 53.9138 bits (128), Expect = 7.195e-9
Identity = 45/167 (26.95%), Postives = 79/167 (47.31%), Query Frame = 1
Query:  622 IIRYTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMI------RVLIDNQESILRLIDSENCENF--IEPKEVSDA--YLVIYAIDDNSSFETCRKLIANLVLTNVNPPLVI-LVANKSDLVRSRVVSTDKGKRLAGIYNLK-FKEISTSLNHCVDELL 1086
            + +Y +   G+ GVGKTSL  + +         D    H +A +        + +D++   L+L D+   E F  + P  + D+   +++Y I    SFE   K I ++     +  +++ +V NKSDL   R +ST++G++ A +   K F E ST   + V  L 
Sbjct:    8 LTKYKIVFLGEQGVGKTSLITRFMY--------DTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGNKSDLSDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALF 166          
BLAST of GTP-binding protein vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 51.2174 bits (121), Expect = 6.646e-8
Identity = 44/180 (24.44%), Postives = 80/180 (44.44%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEVSDAY-------LVIYAIDDNSSFETCRKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEKHKVNF 1149
            + + L G  GVGK++L  +    E+ +     I      + +   ID +    ++ D+   E +   + ++ AY       L++Y I  +SS+E C   ++ L     +   V L+ NKSDL   R V T++ K  A    L F E S   +  VD+    L+  +    ++  KH+++ 
Sbjct:   14 FKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLE--IDGKRIKAQIWDTAGQERY---RAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIY---QKVSKHQMDL 185          
BLAST of GTP-binding protein vs. Ensembl Yeast
Match: RAS1 (GTPase involved in G-protein signaling in adenylate cyclase activation; plays a role in cell proliferation; localized to the plasma membrane; homolog of mammalian RAS proto-oncogenes; relative distribution to the nucleus increases upon DNA replication stress; RAS1 has a paralog, RAS2, that arose from the whole genome duplication [Source:SGD;Acc:S000005627])

HSP 1 Score: 47.3654 bits (111), Expect = 2.007e-6
Identity = 41/146 (28.08%), Postives = 73/146 (50.00%), Query Frame = 1
Query:  757 RVLIDNQESILRLIDSENCENFIEPKE----VSDAYLVIYAIDDNSSFE---TCRKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEKHKVNFISKGFQNT 1173
            +V+ID++ SIL ++D+   E +   +E      + +L++Y++   +SF+   +  + I  +  ++  P  V++V NK DL   R VS + G RLA   N  F E S      VDE    L+  +R+     +  K N +++   NT
Sbjct:   50 QVVIDDKVSILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRNSFDELLSYYQQIQRVKDSDYIP--VVVVGNKLDLENERQVSYEDGLRLAKQLNAPFLETSAKQAINVDEAFYSLIRLVRD-----DGGKYNSMNRQLDNT 188          
BLAST of GTP-binding protein vs. Ensembl Nematostella
Match: EDO36396 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIQ7])

HSP 1 Score: 73.1738 bits (178), Expect = 3.624e-15
Identity = 51/167 (30.54%), Postives = 86/167 (51.50%), Query Frame = 1
Query:  646 FGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEV----SDAYLVIYAIDDNSSFETCRKL---IANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKR 1125
             G  GVGK++L  QL+  ++L      I+   + Q   V++DN+ ++L ++D+   + F   +E      + +++IY+I D SSF    +    I  +  T+  P  ++LV NK DL   R V+T +G+ LA  ++  F E S    H VD+    LV E+R   K+
Sbjct:    6 LGGGGVGKSALIVQLISHQFLDYHDPTIEDAYQHQ---VVLDNEPALLDILDTAGQQEFTAMREQYMRNGEGFIIIYSITDRSSFNLAAQYKDQIERVRRTDDIP--IVLVGNKDDLEGKREVTTQEGQELAHRFDCPFFETSACQRHFVDDAFHGLVREIRKKEKQ 167          
BLAST of GTP-binding protein vs. Ensembl Nematostella
Match: EDO47990 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKI3])

HSP 1 Score: 63.5438 bits (153), Expect = 9.814e-12
Identity = 48/170 (28.24%), Postives = 84/170 (49.41%), Query Frame = 1
Query:  637 VTLFGQDGVGKTSLCQQL----LLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEVSDAY-------LVIYAIDDNSSFETCRKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRN 1113
            V L G  GVGKT L  +      L    +S    I   N+     V +D  +  L++ D+   E F   + ++ AY       L++Y + +++SFE  R  +A +        +++L+ANK+DL + RVVS D+G++LA  +N+ F E S      VD   + +  ++++
Sbjct:   25 VMLLGDSGVGKTCLLVRFKDGAFLSGSFISTVG-IDYKNKV----VEVDGSKVKLQIWDTAGQERF---RSITHAYYRDSHALLLLYDVTNHASFENIRAWLAEIYEYARQDVIIMLLANKADLTKQRVVSRDQGEKLAKDHNVAFMETSAKTGLNVDLAFMAIARDIKH 186          
BLAST of GTP-binding protein vs. Ensembl Nematostella
Match: EDO43637 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY50])

HSP 1 Score: 62.003 bits (149), Expect = 2.374e-11
Identity = 50/172 (29.07%), Postives = 85/172 (49.42%), Query Frame = 1
Query:  637 VTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENF-IEPKEVS---DAYLVIYAIDDNSSFETCRKLIANLV-LTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEM-RNASKRTEK 1134
            + + G   VGK+SL  Q +  ++ V   D    +   + I+     QE  L L+D+   + + I P+  S     Y+++YA+    SFE  + +   L+ +T  N   ++LV NK+DL   RVVST+ G+  A  +   F E S   N  V E+   ++ E+ ++ +  TEK
Sbjct:    9 IAVMGFRSVGKSSLTIQFVEGQF-VDSYDPTIENTFTKNIKY--KGQEFFLELVDTAGQDEYSIFPQSYSMGIHGYILVYAVTSAKSFEVVKVIHEKLLDMTGQNYVPMVLVGNKTDLHMERVVSTESGQSTANSWKAAFFEASAKENSSVHEIFQAMLYEIDKHQNGSTEK 177          
BLAST of GTP-binding protein vs. Ensembl Nematostella
Match: EDO39047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB93])

HSP 1 Score: 59.3066 bits (142), Expect = 1.988e-10
Identity = 45/176 (25.57%), Postives = 85/176 (48.30%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEV----SDAYLVIYAIDDNSSFETCRKLIANLV-LTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIY-NLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEKHK 1140
            Y + + G  GVGK++L  Q +   ++      I+     Q   V +D Q+ +L ++D+   E F   +++       ++++Y+I   S+F   + L   ++ + + +   ++LV NK DL   RVV  D+G+ LA  + N  F E S      V+E+   LV ++   +  T+  K
Sbjct:    4 YKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQ---VEVDGQQCMLEILDTAGTEQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEDERVVGKDQGQNLAKQFANCTFLETSAKAKINVNEIFYDLVRQINRKTPETKSRK 176          
BLAST of GTP-binding protein vs. Ensembl Nematostella
Match: EDO32337 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVC6])

HSP 1 Score: 57.7658 bits (138), Expect = 5.095e-10
Identity = 44/149 (29.53%), Postives = 75/149 (50.34%), Query Frame = 1
Query:  634 TVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDS--ENCENFIE-PKEVSDAYLVIYAIDDNSSFETCRKLIANLVLT-NVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNH 1068
            +V + G+DGVGK++   + L   + + + D     N    +   ID Q   L ++D+  +N E  +E   E ++ Y ++Y+  D  SF    ++   L  T N++P  + +VA K DLV  R V   +G+ LA  Y   F +IS S ++
Sbjct:   14 SVAVLGKDGVGKSAFTVRALTRRF-IGEYDPFLELNYKHSME--IDGQYLALDVLDTAGKNSEEKLERASENTEIYFLLYSTTDKRSFTEAEEIAEYLFETKNIDPSTLTIVATKKDLVHMREVDEYEGRFLAQNYGCAFAQISISEHY 159          
BLAST of GTP-binding protein vs. Ensembl Medaka
Match: rrad (RRAD, Ras related glycolysis inhibitor and calcium channel regulator [Source:NCBI gene;Acc:101173131])

HSP 1 Score: 88.5817 bits (218), Expect = 3.333e-19
Identity = 60/166 (36.14%), Postives = 92/166 (55.42%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKE----VSDAYLVIYAIDDNSSFETCRKLIANL--VLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G+ GVGK+SL +     E +    DE  +  +  ++   +D +E+ + L D    +N    K+    + DAY+++Y++ D SSFE   +L   L     + N P +ILV NKSDLVRSR VS D+G   A +++ KF E S SL+H V +L   +V ++R
Sbjct:   92 YKVVLLGEHGVGKSSLARVFGGVEDVGHDYDEAGNTYDRSLV---VDEEEASILLYDIWEQDNSQWLKDQCMRMGDAYIIVYSVTDKSSFEKASELRIQLRRARQSENIP-IILVGNKSDLVRSREVSVDEGSACAVVFDCKFIETSASLHHNVQDLFEGIVRQIR 253          
BLAST of GTP-binding protein vs. Ensembl Medaka
Match: gem (GTP binding protein overexpressed in skeletal muscle [Source:NCBI gene;Acc:101169387])

HSP 1 Score: 70.4774 bits (171), Expect = 4.265e-13
Identity = 53/174 (30.46%), Postives = 83/174 (47.70%), Query Frame = 1
Query:  631 YTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHN------EAQMIRVLIDNQESILRLID-----SENCENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPP---LVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMR 1110
            Y V L G  GVGKT+              AD + S +      E     + +D + +I+ L+D     ++N     +  + +DAYL++Y+I D +SF    +L   + L    P     +ILV NK DLVR R V T +G   A +++ KF E S ++ H V E    +V ++R
Sbjct:   83 YRVVLLGASGVGKTAF------ASIFAGAADSMDSDDCELCGEELCEKEIEVDGEPAIITLVDMWDEQTDNEWTQEQYMQTADAYLLLYSITDRASFLRASEL--RITLRRFCPARHTPIILVGNKCDLVRRREVLTSEGCACAAVFDCKFIETSAAMQHNVWESFYGIVRQLR 248          
BLAST of GTP-binding protein vs. Ensembl Medaka
Match: rem2 (GTP-binding protein REM 2 [Source:NCBI gene;Acc:101164679])

HSP 1 Score: 67.3958 bits (163), Expect = 4.431e-12
Identity = 51/167 (30.54%), Postives = 88/167 (52.69%), Query Frame = 1
Query:  637 VTLFGQDGVGKTSLCQQLLLPEYLVSQAD-------EIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPL-VILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRN 1113
            + L GQ+GVGK+SL   L        Q+D       E ++  E     V +D+++S  ++I  +N +  +   +  D  ++++++ D  SF    +L   L+L    P   +ILV NKSDLVRSR +S+++ +  A +++  + E+S SL+H  +ELL   V   R 
Sbjct:   82 IVLLGQNGVGKSSLALSL------AGQSDRSLSIDSETQACGEGYESTVTVDDEDS--KVIIYDNWKQDLATMQC-DVCILVFSVTDRRSFHRTAQL--RLLLRESQPQTPIILVGNKSDLVRSREISSEEAQSSAMMFDCVYLELSASLDHGTNELLEAAVRTARG 237          
BLAST of GTP-binding protein vs. Ensembl Medaka
Match: rem2 (GTP-binding protein REM 2 [Source:NCBI gene;Acc:101164679])

HSP 1 Score: 67.0106 bits (162), Expect = 5.881e-12
Identity = 51/167 (30.54%), Postives = 88/167 (52.69%), Query Frame = 1
Query:  637 VTLFGQDGVGKTSLCQQLLLPEYLVSQAD-------EIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPL-VILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRN 1113
            + L GQ+GVGK+SL   L        Q+D       E ++  E     V +D+++S  ++I  +N +  +   +  D  ++++++ D  SF    +L   L+L    P   +ILV NKSDLVRSR +S+++ +  A +++  + E+S SL+H  +ELL   V   R 
Sbjct:   84 IVLLGQNGVGKSSLALSL------AGQSDRSLSIDSETQACGEGYESTVTVDDEDS--KVIIYDNWKQDLATMQC-DVCILVFSVTDRRSFHRTAQL--RLLLRESQPQTPIILVGNKSDLVRSREISSEEAQSSAMMFDCVYLELSASLDHGTNELLEAAVRTARG 239          
BLAST of GTP-binding protein vs. Ensembl Medaka
Match: ENSORLT00000002489.2 (GTP-binding protein REM 2 [Source:NCBI gene;Acc:101155178])

HSP 1 Score: 67.0106 bits (162), Expect = 6.305e-12
Identity = 54/175 (30.86%), Postives = 85/175 (48.57%), Query Frame = 1
Query:  637 VTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEKHKVNFISKG 1161
            + L GQ+GVGK+SL   L      + +   + S  E  +  V +D++ES + + D+   +      EV    ++++++ D  SF    +L   L  T  + P +ILV NKSDLVR+R V+  +    A ++N  + EIS SL+H   ELL   V   R  S          +S G
Sbjct:   91 IALLGQNGVGKSSLAIAL---AGDLDRTASVDSEGEGYVRTVTVDDEESTIIIYDNWRQDLSALQCEVC---VLVFSVTDRRSFHRTAQLRLLLRETQPHTP-IILVGNKSDLVRTREVTCQEAMSSAALFNGLYVEISASLDHRTLELLECAVRLARGQSPWPPGASAEDMSGG 258          
BLAST of GTP-binding protein vs. Planmine SMEST
Match: SMESG000057130.1 (SMESG000057130.1)

HSP 1 Score: 794.653 bits (2051), Expect = 0.000e+0
Identity = 392/395 (99.24%), Postives = 394/395 (99.75%), Query Frame = 1
Query:   91 MQDKTLDDFDRFCRIAQNPISETNKYRNYNLPGIDSTLYRSNSVRERVPKTLKEIKTEPLSSHPNSYNENTVIRARSFRRINKGDMSSKDPLVIEPEKDQLLSNVSSGEENKIVRLRSFRRTTKGIVCNKDTIEIESEKELSRSFDTRNLSNNNEHFHFKNDRKSELENQKLPNDGEIIRYTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEKHKVNFISKGFQNTPYRSSLKIKVSNNAVSRFIQKHFNKSSDNVSIND 1275
            MQDK LDDFDRFCRIAQNPISETNKYRNYNLPGI+STLYRSNSVRERVPKTLKEIKTEPLSSHPNSYNENTVIRARSFRRINKGDMSS+DPLVIEPEKDQLLSNVSSGEENKIVRLRSFRRTTKGIVCNKDTIEIESEKELSRSFDTRNLSNNNEHFHFKNDRKSELENQKLPNDGEIIRYTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEKHKVNFISKGFQNTPYRSSLKIKVSNNAVSRFIQKHFNKSSDNVSIND
Sbjct:    1 MQDKILDDFDRFCRIAQNPISETNKYRNYNLPGIESTLYRSNSVRERVPKTLKEIKTEPLSSHPNSYNENTVIRARSFRRINKGDMSSRDPLVIEPEKDQLLSNVSSGEENKIVRLRSFRRTTKGIVCNKDTIEIESEKELSRSFDTRNLSNNNEHFHFKNDRKSELENQKLPNDGEIIRYTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEKHKVNFISKGFQNTPYRSSLKIKVSNNAVSRFIQKHFNKSSDNVSIND 395          
BLAST of GTP-binding protein vs. Planmine SMEST
Match: SMESG000018613.1 (SMESG000018613.1)

HSP 1 Score: 139.428 bits (350), Expect = 2.902e-37
Identity = 97/290 (33.45%), Postives = 159/290 (54.83%), Query Frame = 1
Query:  370 IEPEKDQLLSNVS----SGEENKIVRLRSFRRTTKGIVCNKDTIEIESEKELSRSFDTRNLSNNNEHFHFKNDRKSELEN------------QKLPNDGEIIRYTVTLF--GQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEK---HKVNFISKGFQNTP 1176
            I  E + LLSN      S +E+ + R+RSF+RT KG++   DT++  S   L+    +++ +     + + N+ KS + +            Q +    + I+ T  +F  G++GVGKT+LC+Q L  E     ++        + + V +D+ E  L L D +N     E  E  DAY+++Y+I+D  SF+ C +++ NL L +++   + +VA KSDL R R VS +KGKRLA IY+ +F E+ST LNH +D LLV ++T++R   K+  K    K N+  K  ++TP
Sbjct:   48 IYGETNNLLSNEDNERISEKESMLYRIRSFKRTHKGVINQGDTVKNCSLLSLNLPTRSKSFTKGENPYRYNNNDKSPISSPEESHSIDLLVPQNINEQKKEIKTTFDVFVIGKNGVGKTALCEQFLTSETYGFYSNMDAPDKTIRQVTVDLDDNEWTLVLHDLDNISTTFE--ESPDAYIIVYSIEDKDSFDWCTQILQNL-LESLSTSAIFIVATKSDLERLRQVSCEKGKRLASIYDAEFIEVSTVLNHMIDNLLVQIITKIRRHKKKLRKAKDSKTNYSMKHKKSTP 334          
BLAST of GTP-binding protein vs. Planmine SMEST
Match: SMESG000032890.1 (SMESG000032890.1)

HSP 1 Score: 137.117 bits (344), Expect = 4.948e-36
Identity = 119/417 (28.54%), Postives = 206/417 (49.40%), Query Frame = 1
Query:  106 LDDFDRFCRIAQNPISETNKYRNYNLPGIDSTLYRSNSVRERVPKTLKEIKTEPLSSHPNSYNENTVIRARSFRRINKGDMSSKDPLVIEPEKDQLLSNVSSGEENKIVRLRSFRRTTKGIVCNKDTIEIESEKELSRSF--------DTRNLSNNNEHFHFKNDRKSE---LENQKLPN--------DGEI----------IRYTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDS----ENCENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNP-PLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEKHKVNFISKGFQNTPYRSSLKIKVSNNAVSRFIQKHFNKSS 1254
            +D+F+ +C++A++  S  N  RN+  P    + YR  S +  +P   +    E L       N    ++  SFR  +  +  S   L   PE   +      G +N + R+RS ++T KG++   D +   S + L + F         + N S  N    F+  +K E   L+   +PN        D +I            + + + G   VGK+S+C+Q L  EYL + +   K+ NE++ + + +DN+E  L  +D+    ++  N I+    +D Y+++YAID+  SFE   K+I N +   + P   + LVANKSDL R R +S++ GK LA  Y+ +F EIST+LNH VD+L+V ++ ++ +  ++ +K K   ++         +  K K   N+++ F +KHF+K S
Sbjct:    1 MDEFEYYCQLARS-TSNKNDNRNFLNPKPLESPYRIRS-QSLLPTDFESSSREELPCE----NRRDSLQPSSFRNRSIKENRSHSSLRQTPE---IFEIAGEGSQN-LYRVRSLKKTPKGVISKGDLVRNHSNQSLEKEFVYPCTEHHQSLNSSKVNSPKSFETKKKKEALRLKQTTMPNVSFERSRDDSQIHWHANLKSRSTSFNIQVVGAPLVGKSSMCEQFLTSEYLGNSSIPEKA-NESRTVTIDLDNREWNLTFLDTVRDEDDDPNNIQIYHNADGYMIVYAIDEYDSFEYA-KIILNYIRCEIPPDSALFLVANKSDLERGREISSEDGKHLAKQYDCEFLEISTALNHMVDDLIVKIIHKICHQKEKYKKDKREEVT---------AEKKPKSHTNSITNFFRKHFSKHS 396          
BLAST of GTP-binding protein vs. Planmine SMEST
Match: SMESG000060724.1 (SMESG000060724.1)

HSP 1 Score: 135.191 bits (339), Expect = 4.871e-35
Identity = 123/385 (31.95%), Postives = 197/385 (51.17%), Query Frame = 1
Query:  160 NKYRNYNLPGIDSTLYRSNSVRERVPKTLKEIKTEPLSSHPNSYNENTVIRARSFRRINKGDMSSKD----PLVIEPEKDQLLSNVSSGEENKIVRLRSFRRTTKGIVCNKDTIEIESEKELSRSFD----TRNLSNNNEHFHFKNDRKSELENQKLPNDGEIIRYTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEVS-------DAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEKHKVNFISKGFQNTPYRSSLKIKVSNNAVSRFIQKHFN-KSSDNVS 1266
            N  RN +L  I  T +RS S+++R            L+ H  S     V   ++F  +NK D  +K+     LV    ++Q   ++S   E ++ R+RSF+RT+KGIV   DTI+  S   L + FD    ++   N +E FHF   R   L     P    + R  V + G + VGKT++  Q +  E++  + D + + +  + + V  D+QE  + L D+EN ++  +  EV+       + Y+V+YAID+ SSF   + ++ +LV       ++ LV NK DL R R VS + GK+LA I+   F E+ST++NH +DELL+  + ++RN  K  EK  + +     QNT  R S   + S   +  F ++ FN KS + VS
Sbjct:   76 NHLRNPDL--IIKTNFRSRSMKDRC-----------LTGHRRSTYVPLVESEQNF--LNKKDSLTKNKEYKTLVWSQNENQ--KDLSDDGEIQMYRMRSFKRTSKGIVSQADTIKARSINSLEK-FDPLEDSKWDKNESEEFHFPCYR---LGISCGPEQKIVNRLEVQIIGSNFVGKTTMASQFMTSEHICGRMDSV-NEDADKFVSVFFDDQEWNIWLHDTENKKD-ADSNEVTVELLSGMNGYMVVYAIDNMSSFIYTKHILTDLVEKASRDSVIALVGNKIDLERCREVSRESGKQLAKIHRCLFYEVSTAINHKIDELLIQTLMKIRNNLKAKEKRFLKY--SNLQNTNRRVS-SFRNSGKKIRSFFKRKFNVKSCEIVS 434          
BLAST of GTP-binding protein vs. Planmine SMEST
Match: SMESG000019070.1 (SMESG000019070.1)

HSP 1 Score: 102.064 bits (253), Expect = 1.396e-23
Identity = 110/418 (26.32%), Postives = 189/418 (45.22%), Query Frame = 1
Query:  109 DDFDRFCRIAQN----------------PISETNKYRNYN---LPGIDSTLY--RSNSVRERVPKTLKEIKT----EPLSSHPNSYNENTVIRARSFRRINKGDMSSKDPLVIEPEKDQLLSNVSSGEENKIVRLRSFRRTTKGIVCNKDTIEIESEKELSRSFDTRNLSNNNEHFHFKNDRKSELENQKLPNDGEIIRYTVTLFGQDGVGKTSLCQQLLLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENC------ENFIEPKEVSDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPLVILVANKSDLVRSRVVSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEKHKVNFISKGFQNTPYRSSLKIKVSNNAVSRFIQKHFN-KSSDNVS 1266
            DDF  FC+IAQ+                P S++  Y NY    LP   + +Y  RS S   +    L  IKT    E L++    ++     R  SF  +   D   +D    +    Q L +V          +RSF+ T KG++   D +       +SRS  T N+ + N H  +  ++  +  N   P         + + G +GVGKT+L  Q +  E +  +   +    E ++  + ID +E  + L D+ N       E  +E  +  +AY+V++AIDD +SFE  ++++ ++           LV NK+DL RSR V +   K L+ ++   F EIST+LNH VDELL  ++ ++  +  + E  +        ++   R   ++  +  A+ + ++K F  KS +++S
Sbjct:   21 DDFSMFCKIAQSPSRSSSSNVSPVLYVRPRSKSMLYENYQNLLLPDTSTHIYTKRSPSPSRKSLGNLPVIKTMLKVEDLNTSVTGHS-----RRPSFCPMK--DYGLEDDGNKDSSTCQFLDDV--------CHVRSFKVTEKGMINEGDLL-------ISRS--TGNIKSENIHVQYNGNQSDKYSNIDSP-------LKIQILGANGVGKTTLASQFMTSEQICCRMMSVNEETE-KLFSIRIDGKEWNILLHDTCNMNIDATNEVRVELLDKMNAYIVLFAIDDLASFEYSKQVLKDIFKKVDTTRAAYLVGNKADLERSREVKSKICKELSKVHRCHFYEISTALNHKVDELLCKIIMDILKSQSKVESPR--------KSIYKRRESQLVTTGRALGKLLRKTFGTKSCEHIS 398          
The following BLAST results are available for this feature:
BLAST of GTP-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RRAD3.760e-1631.52RRAD, Ras related glycolysis inhibitor and calcium... [more]
RRAD3.760e-1631.52RRAD, Ras related glycolysis inhibitor and calcium... [more]
GEM7.591e-1631.93GTP binding protein overexpressed in skeletal musc... [more]
GEM7.591e-1631.93GTP binding protein overexpressed in skeletal musc... [more]
RIT21.364e-1531.18Ras like without CAAX 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of GTP-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y52B11A.47.839e-1432.73pep chromosome:WBcel235:I:10979802:11004283:-1 gen... [more]
Y52B11A.47.839e-1432.73pep chromosome:WBcel235:I:10979607:11004283:-1 gen... [more]
rheb-12.629e-1331.33GTP-binding protein Rheb homolog 1 [Source:UniPro... [more]
F20D6.84.137e-1226.34pep chromosome:WBcel235:V:8164749:8168269:-1 gene:... [more]
rab-371.538e-1128.30RAB family [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASU... [more]
back to top
BLAST of GTP-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rgk19.480e-2731.29gene:FBgn0264753 transcript:FBtr0334282[more]
Rgk12.180e-2631.29gene:FBgn0264753 transcript:FBtr0334283[more]
Rgk16.939e-2430.41gene:FBgn0264753 transcript:FBtr0334284[more]
CG425412.020e-2230.90gene:FBgn0260658 transcript:FBtr0332389[more]
Rgk22.438e-2233.87gene:FBgn0085419 transcript:FBtr0112633[more]
back to top
BLAST of GTP-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rem17.223e-1936.26RAS (RAD and GEM)-like GTP-binding 1 [Source:ZFIN;... [more]
rem17.223e-1936.26RAS (RAD and GEM)-like GTP-binding 1 [Source:ZFIN;... [more]
rrad2.024e-1734.34Ras-related associated with diabetes [Source:ZFIN;... [more]
rrad2.024e-1734.34Ras-related associated with diabetes [Source:ZFIN;... [more]
rit16.357e-1729.41Ras-like without CAAX 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of GTP-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhf23.479e-1833.53pleckstrin homology and FYVE domain containing 2 [... [more]
mark47.943e-1833.33MAP/microtubule affinity-regulating kinase 4 [Sour... [more]
rem11.527e-1733.53RAS (RAD and GEM)-like GTP-binding 1 [Source:NCBI ... [more]
LRP105.135e-1732.93RAS (RAD and GEM)-like GTP binding 2 [Source:NCBI ... [more]
LRP103.591e-1534.12RAS (RAD and GEM)-like GTP binding 2 [Source:NCBI ... [more]
back to top
BLAST of GTP-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rem18.353e-1833.53rad and gem related GTP binding protein 1 [Source:... [more]
Rrad3.109e-1632.12Ras-related associated with diabetes [Source:MGI S... [more]
Gem9.403e-1633.53GTP binding protein (gene overexpressed in skeleta... [more]
Gem9.403e-1633.53GTP binding protein (gene overexpressed in skeleta... [more]
Rem24.914e-1430.77rad and gem related GTP binding protein 2 [Source:... [more]
back to top
BLAST of GTP-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O35929|REM1_MOUSE5.843e-1733.53GTP-binding protein REM 1 OS=Mus musculus OX=10090... [more]
sp|P55043|RAD_RAT8.071e-1632.32GTP-binding protein RAD OS=Rattus norvegicus OX=10... [more]
sp|P55042|RAD_HUMAN1.806e-1531.52GTP-binding protein RAD OS=Homo sapiens OX=9606 GN... [more]
sp|O88667|RAD_MOUSE3.028e-1532.12GTP-binding protein RAD OS=Mus musculus OX=10090 G... [more]
sp|P55040|GEM_HUMAN3.645e-1531.93GTP-binding protein GEM OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of GTP-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IKG01.067e-3536.32Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F7W12.281e-3436.32Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GKK72.315e-3436.32Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A158QUF34.054e-3137.22Uncharacterized protein OS=Mesocestoides corti OX=... [more]
G7YB351.832e-3040.18GTP-binding protein RAD OS=Clonorchis sinensis OX=... [more]
back to top
BLAST of GTP-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rem12.069e-1833.86GTP-binding protein REM 1 [Source:NCBI gene;Acc:10... [more]
gem3.903e-1830.43GTP-binding protein GEM [Source:NCBI gene;Acc:1030... [more]
rrad8.038e-1734.88RRAD, Ras related glycolysis inhibitor and calcium... [more]
rrad2.102e-1634.88RRAD, Ras related glycolysis inhibitor and calcium... [more]
rit13.379e-1628.82Ras like without CAAX 1 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of GTP-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RIT23.259e-1528.82Ras like without CAAX 2 [Source:HGNC Symbol;Acc:HG... [more]
rheb1.111e-1127.27Ras homolog, mTORC1 binding [Source:ZFIN;Acc:ZDB-G... [more]
ENSPMAT00000005561.11.999e-1131.06pep scaffold:Pmarinus_7.0:GL481089:12431:17765:1 g... [more]
ENSPMAT00000000518.18.485e-1029.10pep scaffold:Pmarinus_7.0:GL479781:11597:21619:-1 ... [more]
mras5.516e-930.08muscle RAS oncogene homolog [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of GTP-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RSR12.779e-1026.06GTP-binding protein of the Ras superfamily; requir... [more]
YPT328.315e-1025.67Rab family GTPase involved in the exocytic pathway... [more]
YPT67.195e-926.95Rab family GTPase; required for endosome-to-Golgii... [more]
YPT316.646e-824.44Rab family GTPase; involved in the exocytic pathwa... [more]
RAS12.007e-628.08GTPase involved in G-protein signaling in adenylat... [more]
back to top
BLAST of GTP-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO363963.624e-1530.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479909.814e-1228.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436372.374e-1129.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390471.988e-1025.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO323375.095e-1029.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GTP-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rrad3.333e-1936.14RRAD, Ras related glycolysis inhibitor and calcium... [more]
gem4.265e-1330.46GTP binding protein overexpressed in skeletal musc... [more]
rem24.431e-1230.54GTP-binding protein REM 2 [Source:NCBI gene;Acc:10... [more]
rem25.881e-1230.54GTP-binding protein REM 2 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000002489.26.305e-1230.86GTP-binding protein REM 2 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of GTP-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057130.10.000e+099.24SMESG000057130.1[more]
SMESG000018613.12.902e-3733.45SMESG000018613.1[more]
SMESG000032890.14.948e-3628.54SMESG000032890.1[more]
SMESG000060724.14.871e-3531.95SMESG000060724.1[more]
SMESG000019070.11.396e-2326.32SMESG000019070.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004841 ID=SMED30004841|Name=GTP-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1295bp
GTTAGAAATTTTACGAAATAAAAAAAAGTATTCTGTTTGACTTTGTTTGA
ATGTTTGGGATACGATTTTAGTTACTTCCTTATTTGATTGATGCAAGACA
AGACTTTGGATGACTTTGACCGATTCTGTAGAATTGCTCAGAATCCGATT
TCCGAGACGAACAAATACCGCAATTACAATCTCCCTGGAATTGACTCAAC
TCTCTATCGCTCGAATTCAGTGAGAGAACGAGTCCCAAAAACATTAAAAG
AAATTAAAACAGAACCACTCTCGTCTCATCCAAATTCATACAATGAAAAT
ACAGTAATTCGCGCAAGAAGTTTCCGGCGGATAAACAAAGGAGACATGTC
TTCTAAGGATCCATTAGTAATCGAACCGGAAAAAGATCAACTTTTGTCAA
ATGTCAGTTCAGGCGAAGAAAACAAAATTGTTCGATTACGAAGTTTTCGA
AGAACAACTAAAGGAATCGTCTGCAACAAAGACACAATTGAAATCGAATC
TGAGAAGGAATTAAGTCGCAGCTTTGACACGAGAAATCTCAGCAATAACA
ATGAGCATTTTCACTTCAAAAATGACAGAAAATCAGAATTAGAAAATCAA
AAATTACCAAACGACGGAGAAATTATTCGTTACACGGTTACTTTATTTGG
TCAAGATGGAGTGGGAAAGACATCTCTATGTCAACAACTTTTATTACCTG
AATATCTAGTTAGTCAAGCCGATGAGATCAAGTCACACAATGAAGCTCAA
ATGATCAGAGTGTTAATAGACAATCAGGAATCAATTCTGCGATTAATCGA
TAGTGAGAACTGTGAAAATTTCATAGAACCGAAAGAAGTTTCAGATGCCT
ATTTGGTCATCTATGCAATTGACGACAATTCATCATTCGAGACATGCCGG
AAATTGATTGCCAATCTTGTTTTAACCAACGTTAATCCGCCATTGGTGAT
TCTAGTGGCAAACAAATCAGATCTCGTCCGAAGTCGCGTCGTCTCGACAG
ACAAAGGCAAGAGACTTGCGGGAATTTATAACTTAAAATTCAAAGAAATT
TCGACGAGTTTGAATCATTGTGTTGATGAATTGTTGGTTCTACTTGTAAC
AGAAATGAGAAATGCTTCCAAAAGAACGGAAAAACATAAAGTCAATTTTA
TCTCCAAAGGATTTCAAAACACTCCTTACAGATCGAGTTTAAAAATTAAA
GTTTCAAATAATGCTGTGTCCCGATTTATTCAGAAACATTTCAACAAATC
TTCCGATAACGTTTCGATAAATGATTAAAACAAATTAAACTCAAT
back to top

protein sequence of SMED30004841-orf-1

>SMED30004841-orf-1 ID=SMED30004841-orf-1|Name=SMED30004841-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=396bp
MQDKTLDDFDRFCRIAQNPISETNKYRNYNLPGIDSTLYRSNSVRERVPK
TLKEIKTEPLSSHPNSYNENTVIRARSFRRINKGDMSSKDPLVIEPEKDQ
LLSNVSSGEENKIVRLRSFRRTTKGIVCNKDTIEIESEKELSRSFDTRNL
SNNNEHFHFKNDRKSELENQKLPNDGEIIRYTVTLFGQDGVGKTSLCQQL
LLPEYLVSQADEIKSHNEAQMIRVLIDNQESILRLIDSENCENFIEPKEV
SDAYLVIYAIDDNSSFETCRKLIANLVLTNVNPPLVILVANKSDLVRSRV
VSTDKGKRLAGIYNLKFKEISTSLNHCVDELLVLLVTEMRNASKRTEKHK
VNFISKGFQNTPYRSSLKIKVSNNAVSRFIQKHFNKSSDNVSIND*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001806Small_GTPase
IPR027417P-loop_NTPase
IPR020849Small_GTPase_Ras-type
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 181..202
score: 32.54
coord: 282..295
score: 41.3
coord: 224..246
score: 21.55
coord: 317..339
score: 22.48
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 178..342
e-value: 1.7E-9
score: 20.4
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 181..342
e-value: 7.3E-5
score: -49.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 178..346
e-value: 1.1E-29
score: 105.2
NoneNo IPR availablePANTHERPTHR45775:SF6RAD, GEM/KIR FAMILY MEMBER 2, ISOFORM Ccoord: 109..388
NoneNo IPR availablePANTHERPTHR45775FAMILY NOT NAMEDcoord: 109..388
IPR001806Small GTPasePFAMPF00071Rascoord: 184..340
e-value: 1.2E-18
score: 67.3
IPR020849Small GTPase superfamily, Ras-typePROSITEPS51421RAScoord: 170..394
score: 10.992
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 180..356