Coiled-coil domain containing 88Aa

Overview
NameCoiled-coil domain containing 88Aa
Smed IDSMED30004840
Length (bp)2586
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coiled-coil domain containing 88Aa (SMED30004840) t-SNE clustered cells

Violin plots show distribution of expression levels for Coiled-coil domain containing 88Aa (SMED30004840) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coiled-coil domain containing 88Aa (SMED30004840) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coiled-coil domain containing 88Aa (SMED30004840) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004840

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30004840SMESG000012304.1 dd_Smed_v4_3591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30004840SMESG000012304.1 dd_Smed_v4_3591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004840SMESG000012304.1 dd_Smed_v4_3591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30004840SMESG000012304.1 dd_Smed_v4_3591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004840SMESG000012304.1 dd_Smed_v4_3591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004840SMESG000012304.1 dd_Smed_v4_3591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30004840SMESG000012304.1 dd_Smed_v4_3591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30004840SMESG000012304.1 dd_Smed_v4_3591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30004840SMESG000012304.1 dd_Smed_v4_3591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004840SMESG000012304.1 dd_Smed_v4_3591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004840SMESG000012304.1 dd_Smed_v4_3591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004840SMESG000012304.1 Contig48917uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004840SMESG000012304.1 Contig48917newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 4 cellSMED30004840SMESG000012304.1 dd_Smed_v4_3591_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004840SMESG000012304.1 dd_Smed_v4_3591_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Human
Match: CCDC88A (coiled-coil domain containing 88A [Source:HGNC Symbol;Acc:HGNC:25523])

HSP 1 Score: 105.145 bits (261), Expect = 1.838e-22
Identity = 188/732 (25.68%), Postives = 343/732 (46.86%), Query Frame = 2
Query:  146 LLSEPLVKWLKTFKYEFKAAEFLNLSQ---LIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNS---------MTADNSSLDLDENILQMHHHVTQLTFERRLYFEKYYDC--------FEKHSCDNVEEESGTLNXXXXXXXXXXXXTHGGQWELASPR---KRMRGASDRNEEDVLVVRYR--------PRLKTEKS---LDPVVPVMTPETLEKLKEADEKIKENEDMQQEVIRLKQQLAELDFHXXXXXXXXXXXSQLVADKQKLRDQLQVSRRKEEDVIE---RLIDSQMKLDDTIAEREMDRQKINELM-KNPSSNRSNKNQDEES-----EAEQID--------PKSGKNKRI---------------QELEKEIESLRT----------RLMEAQKQDNQKDEKWKMLD---------------LQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLL----RKKGGKLSGDQF------KELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQV 2038
             ++ PLV W+KTF     A    NL +   L+   FL+ VM  ++ + +      N K+    + R+H+L  ++++I  +YQ  L+ +IM+  PN++ I +    E    ++K LLLL+LGCA QC  K++FI RI + LD + +  +  +  ++T+N             D S  D++  +  M  H+ +L  ER  + E   +         F  H+  + +   G+        +  + V      ELA  +   +R+R   +   E +L  +           RL+ E      D     M  + L+ L+E   ++   + ++ EV R K++L +++F+K +++EL  +N  L+  K  L DQL+ +R + + + E     +  + KL D   ER+MDR+KI ELM +N +   + K   +ES     E EQI         P+      +               Q L K +E LRT          ++++ +K++ +  +K ++L+               L K+ +  + QL +++ET   L+   E +E Q+K ++ E        +  R  +  Q+S  E R+KD+ K+  +L    ++   KLS  +F      KEL++ +     E  +EL NE+  L+  N++L++    LK   +K+  +E EN  L  E R+L++ + S +  + Q++ L K+N QL  EN +LRR +++L+   M++
Sbjct:   13 FMTSPLVTWVKTFGP-LAAGNGTNLDEYVALVDGVFLNQVM--LQINPKLESQRVNKKVNNDASLRMHNLSILVRQIKFYYQETLQQLIMMSLPNVLIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEEFIERI-QGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTDMSQEDIEPLLKNMALHLKRLIDERDEHSETIIELSEERDGLHFLPHASSSAQSPCGSPGMKRTESRQHLSV------ELADAKAKIRRLRQELEEKTEQLLDCKQELEQMEIELKRLQQENMNLLSDARSARMYRDELDALREKAVRV---DKLESEVSRYKERLHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQKQSMDESLHLGWELEQISRTSELSEAPQKSLGHEVNELTSSRLLKLEMENQSLTKTVEELRTTVDSVEGNASKILKMEKENQRLSKKVEILENEIVQEKQSLQNCQNLSKDLMKEKAQLEKTIET---LR---ENSERQIKILEQENEHLNQTVSSLRQRS--QIS-AEARVKDIEKENKILHESIKETSSKLSKIEFEKRQIKKELEHYKEK--GERAEELENELHHLEKENELLQKKITNLKITCEKIEALEQENSELERENRKLKKTLDSFKNLTFQLESLEKENSQLDEENLELRRNVESLKCASMKM 720          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Human
Match: CCDC88A (coiled-coil domain containing 88A [Source:HGNC Symbol;Acc:HGNC:25523])

HSP 1 Score: 105.531 bits (262), Expect = 2.284e-22
Identity = 188/732 (25.68%), Postives = 343/732 (46.86%), Query Frame = 2
Query:  146 LLSEPLVKWLKTFKYEFKAAEFLNLSQ---LIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNS---------MTADNSSLDLDENILQMHHHVTQLTFERRLYFEKYYDC--------FEKHSCDNVEEESGTLNXXXXXXXXXXXXTHGGQWELASPR---KRMRGASDRNEEDVLVVRYR--------PRLKTEKS---LDPVVPVMTPETLEKLKEADEKIKENEDMQQEVIRLKQQLAELDFHXXXXXXXXXXXSQLVADKQKLRDQLQVSRRKEEDVIE---RLIDSQMKLDDTIAEREMDRQKINELM-KNPSSNRSNKNQDEES-----EAEQID--------PKSGKNKRI---------------QELEKEIESLRT----------RLMEAQKQDNQKDEKWKML---------------DLQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLL----RKKGGKLSGDQF------KELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQV 2038
             ++ PLV W+KTF     A    NL +   L+   FL+ VM  ++ + +      N K+    + R+H+L  ++++I  +YQ  L+ +IM+  PN++ I +    E    ++K LLLL+LGCA QC  K++FI RI + LD + +  +  +  ++T+N             D S  D++  +  M  H+ +L  ER  + E   +         F  H+  + +   G+        +  + V      ELA  +   +R+R   +   E +L  +           RL+ E      D     M  + L+ L+E   ++   + ++ EV R K++L +++F+K +++EL  +N  L+  K  L DQL+ +R + + + E     +  + KL D   ER+MDR+KI ELM +N +   + K   +ES     E EQI         P+      +               Q L K +E LRT          ++++ +K++ +  +K ++L               +L K+ +  + QL +++ET   L+   E +E Q+K ++ E        +  R  +  Q+S  E R+KD+ K+  +L    ++   KLS  +F      KEL++ +     E  +EL NE+  L+  N++L++    LK   +K+  +E EN  L  E R+L++ + S +  + Q++ L K+N QL  EN +LRR +++L+   M++
Sbjct:   13 FMTSPLVTWVKTFG-PLAAGNGTNLDEYVALVDGVFLNQVM--LQINPKLESQRVNKKVNNDASLRMHNLSILVRQIKFYYQETLQQLIMMSLPNVLIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEEFIERI-QGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTDMSQEDIEPLLKNMALHLKRLIDERDEHSETIIELSEERDGLHFLPHASSSAQSPCGSPGMKRTESRQHLSV------ELADAKAKIRRLRQELEEKTEQLLDCKQELEQMEIELKRLQQENMNLLSDARSARMYRDELDALREKAVRV---DKLESEVSRYKERLHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQKQSMDESLHLGWELEQISRTSELSEAPQKSLGHEVNELTSSRLLKLEMENQSLTKTVEELRTTVDSVEGNASKILKMEKENQRLSKKVEILENEIVQEKQSLQNCQNLSKDLMKEKAQLEKTIET---LR---ENSERQIKILEQENEHLNQTVSSLRQRS--QIS-AEARVKDIEKENKILHESIKETSSKLSKIEFEKRQIKKELEHYKEK--GERAEELENELHHLEKENELLQKKITNLKITCEKIEALEQENSELERENRKLKKTLDSFKNLTFQLESLEKENSQLDEENLELRRNVESLKCASMKM 720          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Human
Match: CCDC88A (coiled-coil domain containing 88A [Source:HGNC Symbol;Acc:HGNC:25523])

HSP 1 Score: 105.531 bits (262), Expect = 2.467e-22
Identity = 188/732 (25.68%), Postives = 343/732 (46.86%), Query Frame = 2
Query:  146 LLSEPLVKWLKTFKYEFKAAEFLNLSQ---LIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNS---------MTADNSSLDLDENILQMHHHVTQLTFERRLYFEKYYDC--------FEKHSCDNVEEESGTLNXXXXXXXXXXXXTHGGQWELASPR---KRMRGASDRNEEDVLVVRYR--------PRLKTEKS---LDPVVPVMTPETLEKLKEADEKIKENEDMQQEVIRLKQQLAELDFHXXXXXXXXXXXSQLVADKQKLRDQLQVSRRKEEDVIE---RLIDSQMKLDDTIAEREMDRQKINELM-KNPSSNRSNKNQDEES-----EAEQID--------PKSGKNKRI---------------QELEKEIESLRT----------RLMEAQKQDNQKDEKWKML---------------DLQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLL----RKKGGKLSGDQF------KELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQV 2038
             ++ PLV W+KTF     A    NL +   L+   FL+ VM  ++ + +      N K+    + R+H+L  ++++I  +YQ  L+ +IM+  PN++ I +    E    ++K LLLL+LGCA QC  K++FI RI + LD + +  +  +  ++T+N             D S  D++  +  M  H+ +L  ER  + E   +         F  H+  + +   G+        +  + V      ELA  +   +R+R   +   E +L  +           RL+ E      D     M  + L+ L+E   ++   + ++ EV R K++L +++F+K +++EL  +N  L+  K  L DQL+ +R + + + E     +  + KL D   ER+MDR+KI ELM +N +   + K   +ES     E EQI         P+      +               Q L K +E LRT          ++++ +K++ +  +K ++L               +L K+ +  + QL +++ET   L+   E +E Q+K ++ E        +  R  +  Q+S  E R+KD+ K+  +L    ++   KLS  +F      KEL++ +     E  +EL NE+  L+  N++L++    LK   +K+  +E EN  L  E R+L++ + S +  + Q++ L K+N QL  EN +LRR +++L+   M++
Sbjct:   13 FMTSPLVTWVKTFG-PLAAGNGTNLDEYVALVDGVFLNQVM--LQINPKLESQRVNKKVNNDASLRMHNLSILVRQIKFYYQETLQQLIMMSLPNVLIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEEFIERI-QGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTDMSQEDIEPLLKNMALHLKRLIDERDEHSETIIELSEERDGLHFLPHASSSAQSPCGSPGMKRTESRQHLSV------ELADAKAKIRRLRQELEEKTEQLLDCKQELEQMEIELKRLQQENMNLLSDARSARMYRDELDALREKAVRV---DKLESEVSRYKERLHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQKQSMDESLHLGWELEQISRTSELSEAPQKSLGHEVNELTSSRLLKLEMENQSLTKTVEELRTTVDSVEGNASKILKMEKENQRLSKKVEILENEIVQEKQSLQNCQNLSKDLMKEKAQLEKTIET---LR---ENSERQIKILEQENEHLNQTVSSLRQRS--QIS-AEARVKDIEKENKILHESIKETSSKLSKIEFEKRQIKKELEHYKEK--GERAEELENELHHLEKENELLQKKITNLKITCEKIEALEQENSELERENRKLKKTLDSFKNLTFQLESLEKENSQLDEENLELRRNVESLKCASMKM 720          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Human
Match: CCDC88A (coiled-coil domain containing 88A [Source:HGNC Symbol;Acc:HGNC:25523])

HSP 1 Score: 105.145 bits (261), Expect = 2.865e-22
Identity = 188/732 (25.68%), Postives = 343/732 (46.86%), Query Frame = 2
Query:  146 LLSEPLVKWLKTFKYEFKAAEFLNLSQ---LIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNS---------MTADNSSLDLDENILQMHHHVTQLTFERRLYFEKYYDC--------FEKHSCDNVEEESGTLNXXXXXXXXXXXXTHGGQWELASPR---KRMRGASDRNEEDVLVVRYR--------PRLKTEKS---LDPVVPVMTPETLEKLKEADEKIKENEDMQQEVIRLKQQLAELDFHXXXXXXXXXXXSQLVADKQKLRDQLQVSRRKEEDVIE---RLIDSQMKLDDTIAEREMDRQKINELM-KNPSSNRSNKNQDEES-----EAEQID--------PKSGKNKRI---------------QELEKEIESLRT----------RLMEAQKQDNQKDEKWKML---------------DLQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLL----RKKGGKLSGDQF------KELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQV 2038
             ++ PLV W+KTF     A    NL +   L+   FL+ VM  ++ + +      N K+    + R+H+L  ++++I  +YQ  L+ +IM+  PN++ I +    E    ++K LLLL+LGCA QC  K++FI RI + LD + +  +  +  ++T+N             D S  D++  +  M  H+ +L  ER  + E   +         F  H+  + +   G+        +  + V      ELA  +   +R+R   +   E +L  +           RL+ E      D     M  + L+ L+E   ++   + ++ EV R K++L +++F+K +++EL  +N  L+  K  L DQL+ +R + + + E     +  + KL D   ER+MDR+KI ELM +N +   + K   +ES     E EQI         P+      +               Q L K +E LRT          ++++ +K++ +  +K ++L               +L K+ +  + QL +++ET   L+   E +E Q+K ++ E        +  R  +  Q+S  E R+KD+ K+  +L    ++   KLS  +F      KEL++ +     E  +EL NE+  L+  N++L++    LK   +K+  +E EN  L  E R+L++ + S +  + Q++ L K+N QL  EN +LRR +++L+   M++
Sbjct:   13 FMTSPLVTWVKTFG-PLAAGNGTNLDEYVALVDGVFLNQVM--LQINPKLESQRVNKKVNNDASLRMHNLSILVRQIKFYYQETLQQLIMMSLPNVLIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEEFIERI-QGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTDMSQEDIEPLLKNMALHLKRLIDERDEHSETIIELSEERDGLHFLPHASSSAQSPCGSPGMKRTESRQHLSV------ELADAKAKIRRLRQELEEKTEQLLDCKQELEQMEIELKRLQQENMNLLSDARSARMYRDELDALREKAVRV---DKLESEVSRYKERLHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQKQSMDESLHLGWELEQISRTSELSEAPQKSLGHEVNELTSSRLLKLEMENQSLTKTVEELRTTVDSVEGNASKILKMEKENQRLSKKVEILENEIVQEKQSLQNCQNLSKDLMKEKAQLEKTIET---LR---ENSERQIKILEQENEHLNQTVSSLRQRS--QIS-AEARVKDIEKENKILHESIKETSSKLSKIEFEKRQIKKELEHYKEK--GERAEELENELHHLEKENELLQKKITNLKITCEKIEALEQENSELERENRKLKKTLDSFKNLTFQLESLEKENSQLDEENLELRRNVESLKCASMKM 720          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Human
Match: CCDC88A (coiled-coil domain containing 88A [Source:HGNC Symbol;Acc:HGNC:25523])

HSP 1 Score: 105.145 bits (261), Expect = 3.016e-22
Identity = 188/732 (25.68%), Postives = 343/732 (46.86%), Query Frame = 2
Query:  146 LLSEPLVKWLKTFKYEFKAAEFLNLSQ---LIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNS---------MTADNSSLDLDENILQMHHHVTQLTFERRLYFEKYYDC--------FEKHSCDNVEEESGTLNXXXXXXXXXXXXTHGGQWELASPR---KRMRGASDRNEEDVLVVRYR--------PRLKTEKS---LDPVVPVMTPETLEKLKEADEKIKENEDMQQEVIRLKQQLAELDFHXXXXXXXXXXXSQLVADKQKLRDQLQVSRRKEEDVIE---RLIDSQMKLDDTIAEREMDRQKINELM-KNPSSNRSNKNQDEES-----EAEQID--------PKSGKNKRI---------------QELEKEIESLRT----------RLMEAQKQDNQKDEKWKML---------------DLQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLL----RKKGGKLSGDQF------KELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQV 2038
             ++ PLV W+KTF     A    NL +   L+   FL+ VM  ++ + +      N K+    + R+H+L  ++++I  +YQ  L+ +IM+  PN++ I +    E    ++K LLLL+LGCA QC  K++FI RI + LD + +  +  +  ++T+N             D S  D++  +  M  H+ +L  ER  + E   +         F  H+  + +   G+        +  + V      ELA  +   +R+R   +   E +L  +           RL+ E      D     M  + L+ L+E   ++   + ++ EV R K++L +++F+K +++EL  +N  L+  K  L DQL+ +R + + + E     +  + KL D   ER+MDR+KI ELM +N +   + K   +ES     E EQI         P+      +               Q L K +E LRT          ++++ +K++ +  +K ++L               +L K+ +  + QL +++ET   L+   E +E Q+K ++ E        +  R  +  Q+S  E R+KD+ K+  +L    ++   KLS  +F      KEL++ +     E  +EL NE+  L+  N++L++    LK   +K+  +E EN  L  E R+L++ + S +  + Q++ L K+N QL  EN +LRR +++L+   M++
Sbjct:   13 FMTSPLVTWVKTFG-PLAAGNGTNLDEYVALVDGVFLNQVM--LQINPKLESQRVNKKVNNDASLRMHNLSILVRQIKFYYQETLQQLIMMSLPNVLIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEEFIERI-QGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTDMSQEDIEPLLKNMALHLKRLIDERDEHSETIIELSEERDGLHFLPHASSSAQSPCGSPGMKRTESRQHLSV------ELADAKAKIRRLRQELEEKTEQLLDCKQELEQMEIELKRLQQENMNLLSDARSARMYRDELDALREKAVRV---DKLESEVSRYKERLHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQKQSMDESLHLGWELEQISRTSELSEAPQKSLGHEVNELTSSRLLKLEMENQSLTKTVEELRTTVDSVEGNASKILKMEKENQRLSKKVEILENEIVQEKQSLQNCQNLSKDLMKEKAQLEKTIET---LR---ENSERQIKILEQENEHLNQTVSSLRQRS--QIS-AEARVKDIEKENKILHESIKETSSKLSKIEFEKRQIKKELEHYKEK--GERAEELENELHHLEKENELLQKKITNLKITCEKIEALEQENSELERENRKLKKTLDSFKNLTFQLESLEKENSQLDEENLELRRNVESLKCASMKM 720          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Zebrafish
Match: ccdc88aa (coiled-coil domain containing 88Aa [Source:ZFIN;Acc:ZDB-GENE-100701-2])

HSP 1 Score: 56.9954 bits (136), Expect = 1.228e-7
Identity = 46/142 (32.39%), Postives = 73/142 (51.41%), Query Frame = 2
Query:  146 LLSEPLVKWLKTF-KYEFKAAEFLN-LSQLIGSDFLDNVMYLIRFSKRKTPPETNV----KLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITEL 553
             +S  LV W+KT  +   K    L+  ++LI   FL+ VM  I        PE  V    K+   I  R  +L  ++  I  +YQ  L  +IM+P PN++ + +    E+   +++ LLLL+LGCA QC  K+++I +I  L
Sbjct:   12 FMSSSLVTWVKTLGQLGDKEGNVLSEYTELIDGIFLNKVMNQIN-------PEGTVQGLNKVNNDIGQRAQNLSVLMYHIKSYYQETLHQMIMIPPPNVLLLGKNPVCEEGLEEIRKLLLLLLGCAVQCERKEEYIEKIQNL 146          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Xenopus
Match: CCDC88A (coiled-coil domain containing 88A [Source:NCBI gene;Acc:100380128])

HSP 1 Score: 95.5153 bits (236), Expect = 2.743e-19
Identity = 191/746 (25.60%), Postives = 340/746 (45.58%), Query Frame = 2
Query:  143 DLLSEPLVKWLKTFKYEFKAAEFL--NLSQLIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIAD----RLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNSMT---------ADNSSLDLDENILQMHHHVTQLTFERRLYFEKYYDCFEKHSCDNVEEESGTLNXXXXXXXXXXXXTHGGQW---ELASPRKRMRGASDRNEEDVLVVRYRPRL--KTEKSLDPVVPVMTPET-LEKLKE------AD---------------EKIKENEDMQQEVIRLKQQLAELDFHXXXXXXXXXXXSQLVADKQKLRDQLQVSRRKEEDVIE---RLIDSQMKLDDTIAEREMDRQKINELM-KNPSSNRSNKNQDEES-----EAEQIDPKS-----------------------------------------------GKNKRIQELEKEIESLRTRL--MEA----QKQDNQKDEKWKMLDLQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLL----RKKGGKLSGDQF------KELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQV 2038
            + +S PLV W+KTF    +    L      LI   FL+ VM+ I       P   N ++   I +    R+ +L  ++K++  +YQ +L+ ++M+  PN++TI +    E    ++K LLLL+LGCA QC  K++FI +I ++LD + +  +  +  ++T+N             + SS DL+  +     H+ +L  ER  Y E   +  E+   D++      ++       P +  T   Q    ELA  + ++R             R R  L  KTE+ LD    V   E  L+++++      AD               EK    + ++ E+ R K+++ +++F+K +++EL  +N  L+  K  L DQL+ +R + + + E     +  + K  D   ER+++R++I ELM +N S   + K   +ES     E EQ+   S                                               GKN +I +LEKE + L  ++  +EA    ++Q+NQ  +     DL KEK +    L +++ET +      E +E Q+K ++ E         IT      Q+S  E R+KD+ K+  +L    ++   KL+  +F      KEL++ +   M E  +EL  E+ +++   ++L++    L    +K  ++E EN  L  E R+L++ + S +    Q++ L K+N QL  EN  LRR +++L+ T ++V
Sbjct:   12 NFMSSPLVIWIKTFGTLLRGTGTLLDEYVALIDGVFLNEVMFQI------NPKADNQRIYRKINNDASLRIQNLSVLVKQMKSYYQESLQQLVMMSLPNVLTIGKNPYSEQGTEEMKKLLLLLLGCAVQCERKEEFIEKI-QVLDFDTKAAVAAHIQEVTHNQENVFDLQLLEPTEMSSEDLEALLKNTSFHLKRLIDERDEYTETIIELTEER--DSLHFAPLAISAQSPSGSPGMRRTESRQHLSVELADAKAKIR-------------RLRQELEEKTEQYLDSKQEVGHMEAELKRVQQENMNLLADARSARVYRDELDALREKAIRVDKLESELSRYKERMHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGARARSDKLHELEKENLQLKAKFHDMETERDLERKRIEELMEENMSLEMAQKQSMDESLHLGWELEQLSKTSDLPEIPQKSLGHEVNELTSSRLLKLEMENQTLLSTVEELRNTMGSTDGKNTKILKLEKENQRLCKKMEKLEAEINHERQNNQSSQHLSS-DLMKEKSE----LEKTIETLQ------ENSERQIKGLEQENEHLNQT--ITSLRQRSQIS-AEARVKDIEKENKILHESIKETSSKLNKMEFEKKQMKKELEHFKE--MGERSEELEKELHRVEKETELLQKKITSLNIVCEKTEVLEQENAGLELENRKLKKTLDSLKNLKYQMESLEKENNQLEEENLSLRRSVESLKSTNIKV 719          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Xenopus
Match: CCDC88A (coiled-coil domain containing 88A [Source:NCBI gene;Acc:100380128])

HSP 1 Score: 95.1301 bits (235), Expect = 3.195e-19
Identity = 191/746 (25.60%), Postives = 340/746 (45.58%), Query Frame = 2
Query:  143 DLLSEPLVKWLKTFKYEFKAAEFL--NLSQLIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIAD----RLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNSMT---------ADNSSLDLDENILQMHHHVTQLTFERRLYFEKYYDCFEKHSCDNVEEESGTLNXXXXXXXXXXXXTHGGQW---ELASPRKRMRGASDRNEEDVLVVRYRPRL--KTEKSLDPVVPVMTPET-LEKLKE------AD---------------EKIKENEDMQQEVIRLKQQLAELDFHXXXXXXXXXXXSQLVADKQKLRDQLQVSRRKEEDVIE---RLIDSQMKLDDTIAEREMDRQKINELM-KNPSSNRSNKNQDEES-----EAEQIDPKS-----------------------------------------------GKNKRIQELEKEIESLRTRL--MEA----QKQDNQKDEKWKMLDLQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLL----RKKGGKLSGDQF------KELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQV 2038
            + +S PLV W+KTF    +    L      LI   FL+ VM+ I       P   N ++   I +    R+ +L  ++K++  +YQ +L+ ++M+  PN++TI +    E    ++K LLLL+LGCA QC  K++FI +I ++LD + +  +  +  ++T+N             + SS DL+  +     H+ +L  ER  Y E   +  E+   D++      ++       P +  T   Q    ELA  + ++R             R R  L  KTE+ LD    V   E  L+++++      AD               EK    + ++ E+ R K+++ +++F+K +++EL  +N  L+  K  L DQL+ +R + + + E     +  + K  D   ER+++R++I ELM +N S   + K   +ES     E EQ+   S                                               GKN +I +LEKE + L  ++  +EA    ++Q+NQ  +     DL KEK +    L +++ET +      E +E Q+K ++ E         IT      Q+S  E R+KD+ K+  +L    ++   KL+  +F      KEL++ +   M E  +EL  E+ +++   ++L++    L    +K  ++E EN  L  E R+L++ + S +    Q++ L K+N QL  EN  LRR +++L+ T ++V
Sbjct:   12 NFMSSPLVIWIKTFGTLLRGTGTLLDEYVALIDGVFLNEVMFQI------NPKADNQRIYRKINNDASLRIQNLSVLVKQMKSYYQESLQQLVMMSLPNVLTIGKNPYSEQGTEEMKKLLLLLLGCAVQCERKEEFIEKI-QVLDFDTKAAVAAHIQEVTHNQENVFDLQLLEPTEMSSEDLEALLKNTSFHLKRLIDERDEYTETIIELTEER--DSLHFAPLAISAQSPSGSPGMRRTESRQHLSVELADAKAKIR-------------RLRQELEEKTEQYLDSKQEVGHMEAELKRVQQENMNLLADARSARVYRDELDALREKAIRVDKLESELSRYKERMHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGARARSDKLHELEKENLQLKAKFHDMETERDLERKRIEELMEENMSLEMAQKQSMDESLHLGWELEQLSKTSDLPEIPQKSLGHEVNELTSSRLLKLEMENQTLLSTVEELRNTMGSTDGKNTKILKLEKENQRLCKKMEKLEAEINHERQNNQSSQHLSS-DLMKEKSE----LEKTIETLQ------ENSERQIKGLEQENEHLNQT--ITSLRQRSQIS-AEARVKDIEKENKILHESIKETSSKLNKMEFEKKQMKKELEHFKE--MGERSEELEKELHRVEKETELLQKKITSLNIVCEKTEVLEQENAGLELENRKLKKTLDSLKNLKYQMESLEKENNQLEEENLSLRRSVESLKSTNIKV 719          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Xenopus
Match: CCDC88A (coiled-coil domain containing 88A [Source:NCBI gene;Acc:100380128])

HSP 1 Score: 95.1301 bits (235), Expect = 3.667e-19
Identity = 191/746 (25.60%), Postives = 340/746 (45.58%), Query Frame = 2
Query:  143 DLLSEPLVKWLKTFKYEFKAAEFL--NLSQLIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIAD----RLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNSMT---------ADNSSLDLDENILQMHHHVTQLTFERRLYFEKYYDCFEKHSCDNVEEESGTLNXXXXXXXXXXXXTHGGQW---ELASPRKRMRGASDRNEEDVLVVRYRPRL--KTEKSLDPVVPVMTPET-LEKLKE------AD---------------EKIKENEDMQQEVIRLKQQLAELDFHXXXXXXXXXXXSQLVADKQKLRDQLQVSRRKEEDVIE---RLIDSQMKLDDTIAEREMDRQKINELM-KNPSSNRSNKNQDEES-----EAEQIDPKS-----------------------------------------------GKNKRIQELEKEIESLRTRL--MEA----QKQDNQKDEKWKMLDLQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLL----RKKGGKLSGDQF------KELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQV 2038
            + +S PLV W+KTF    +    L      LI   FL+ VM+ I       P   N ++   I +    R+ +L  ++K++  +YQ +L+ ++M+  PN++TI +    E    ++K LLLL+LGCA QC  K++FI +I ++LD + +  +  +  ++T+N             + SS DL+  +     H+ +L  ER  Y E   +  E+   D++      ++       P +  T   Q    ELA  + ++R             R R  L  KTE+ LD    V   E  L+++++      AD               EK    + ++ E+ R K+++ +++F+K +++EL  +N  L+  K  L DQL+ +R + + + E     +  + K  D   ER+++R++I ELM +N S   + K   +ES     E EQ+   S                                               GKN +I +LEKE + L  ++  +EA    ++Q+NQ  +     DL KEK +    L +++ET +      E +E Q+K ++ E         IT      Q+S  E R+KD+ K+  +L    ++   KL+  +F      KEL++ +   M E  +EL  E+ +++   ++L++    L    +K  ++E EN  L  E R+L++ + S +    Q++ L K+N QL  EN  LRR +++L+ T ++V
Sbjct:   12 NFMSSPLVIWIKTFGTLLRGTGTLLDEYVALIDGVFLNEVMFQI------NPKADNQRIYRKINNDASLRIQNLSVLVKQMKSYYQESLQQLVMMSLPNVLTIGKNPYSEQGTEEMKKLLLLLLGCAVQCERKEEFIEKI-QVLDFDTKAAVAAHIQEVTHNQENVFDLQLLEPTEMSSEDLEALLKNTSFHLKRLIDERDEYTETIIELTEER--DSLHFAPLAISAQSPSGSPGMRRTESRQHLSVELADAKAKIR-------------RLRQELEEKTEQYLDSKQEVGHMEAELKRVQQENMNLLADARSARVYRDELDALREKAIRVDKLESELSRYKERMHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGARARSDKLHELEKENLQLKAKFHDMETERDLERKRIEELMEENMSLEMAQKQSMDESLHLGWELEQLSKTSDLPEIPQKSLGHEVNELTSSRLLKLEMENQTLLSTVEELRNTMGSTDGKNTKILKLEKENQRLCKKMEKLEAEINHERQNNQSSQHLSS-DLMKEKSE----LEKTIETLQ------ENSERQIKGLEQENEHLNQT--ITSLRQRSQIS-AEARVKDIEKENKILHESIKETSSKLNKMEFEKKQMKKELEHFKE--MGERSEELEKELHRVEKETELLQKKITSLNIVCEKTEVLEQENAGLELENRKLKKTLDSLKNLKYQMESLEKENNQLEEENLSLRRSVESLKSTNIKV 719          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Xenopus
Match: CCDC88A (coiled-coil domain containing 88A [Source:NCBI gene;Acc:100380128])

HSP 1 Score: 94.7449 bits (234), Expect = 4.006e-19
Identity = 191/746 (25.60%), Postives = 340/746 (45.58%), Query Frame = 2
Query:  143 DLLSEPLVKWLKTFKYEFKAAEFL--NLSQLIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIAD----RLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNSMT---------ADNSSLDLDENILQMHHHVTQLTFERRLYFEKYYDCFEKHSCDNVEEESGTLNXXXXXXXXXXXXTHGGQW---ELASPRKRMRGASDRNEEDVLVVRYRPRL--KTEKSLDPVVPVMTPET-LEKLKE------AD---------------EKIKENEDMQQEVIRLKQQLAELDFHXXXXXXXXXXXSQLVADKQKLRDQLQVSRRKEEDVIE---RLIDSQMKLDDTIAEREMDRQKINELM-KNPSSNRSNKNQDEES-----EAEQIDPKS-----------------------------------------------GKNKRIQELEKEIESLRTRL--MEA----QKQDNQKDEKWKMLDLQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLL----RKKGGKLSGDQF------KELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQV 2038
            + +S PLV W+KTF    +    L      LI   FL+ VM+ I       P   N ++   I +    R+ +L  ++K++  +YQ +L+ ++M+  PN++TI +    E    ++K LLLL+LGCA QC  K++FI +I ++LD + +  +  +  ++T+N             + SS DL+  +     H+ +L  ER  Y E   +  E+   D++      ++       P +  T   Q    ELA  + ++R             R R  L  KTE+ LD    V   E  L+++++      AD               EK    + ++ E+ R K+++ +++F+K +++EL  +N  L+  K  L DQL+ +R + + + E     +  + K  D   ER+++R++I ELM +N S   + K   +ES     E EQ+   S                                               GKN +I +LEKE + L  ++  +EA    ++Q+NQ  +     DL KEK +    L +++ET +      E +E Q+K ++ E         IT      Q+S  E R+KD+ K+  +L    ++   KL+  +F      KEL++ +   M E  +EL  E+ +++   ++L++    L    +K  ++E EN  L  E R+L++ + S +    Q++ L K+N QL  EN  LRR +++L+ T ++V
Sbjct:   12 NFMSSPLVIWIKTFGTLLRGTGTLLDEYVALIDGVFLNEVMFQI------NPKADNQRIYRKINNDASLRIQNLSVLVKQMKSYYQESLQQLVMMSLPNVLTIGKNPYSEQGTEEMKKLLLLLLGCAVQCERKEEFIEKI-QVLDFDTKAAVAAHIQEVTHNQENVFDLQLLEPTEMSSEDLEALLKNTSFHLKRLIDERDEYTETIIELTEER--DSLHFAPLAISAQSPSGSPGMRRTESRQHLSVELADAKAKIR-------------RLRQELEEKTEQYLDSKQEVGHMEAELKRVQQENMNLLADARSARVYRDELDALREKAIRVDKLESELSRYKERMHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGARARSDKLHELEKENLQLKAKFHDMETERDLERKRIEELMEENMSLEMAQKQSMDESLHLGWELEQLSKTSDLPEIPQKSLGHEVNELTSSRLLKLEMENQTLLSTVEELRNTMGSTDGKNTKILKLEKENQRLCKKMEKLEAEINHERQNNQSSQHLSS-DLMKEKSE----LEKTIETLQ------ENSERQIKGLEQENEHLNQT--ITSLRQRSQIS-AEARVKDIEKENKILHESIKETSSKLNKMEFEKKQMKKELEHFKE--MGERSEELEKELHRVEKETELLQKKITSLNIVCEKTEVLEQENAGLELENRKLKKTLDSLKNLKYQMESLEKENNQLEEENLSLRRSVESLKSTNIKV 719          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Xenopus
Match: CCDC88A (coiled-coil domain containing 88A [Source:NCBI gene;Acc:100380128])

HSP 1 Score: 94.7449 bits (234), Expect = 4.122e-19
Identity = 191/746 (25.60%), Postives = 340/746 (45.58%), Query Frame = 2
Query:  143 DLLSEPLVKWLKTFKYEFKAAEFL--NLSQLIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIAD----RLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNSMT---------ADNSSLDLDENILQMHHHVTQLTFERRLYFEKYYDCFEKHSCDNVEEESGTLNXXXXXXXXXXXXTHGGQW---ELASPRKRMRGASDRNEEDVLVVRYRPRL--KTEKSLDPVVPVMTPET-LEKLKE------AD---------------EKIKENEDMQQEVIRLKQQLAELDFHXXXXXXXXXXXSQLVADKQKLRDQLQVSRRKEEDVIE---RLIDSQMKLDDTIAEREMDRQKINELM-KNPSSNRSNKNQDEES-----EAEQIDPKS-----------------------------------------------GKNKRIQELEKEIESLRTRL--MEA----QKQDNQKDEKWKMLDLQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLL----RKKGGKLSGDQF------KELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQV 2038
            + +S PLV W+KTF    +    L      LI   FL+ VM+ I       P   N ++   I +    R+ +L  ++K++  +YQ +L+ ++M+  PN++TI +    E    ++K LLLL+LGCA QC  K++FI +I ++LD + +  +  +  ++T+N             + SS DL+  +     H+ +L  ER  Y E   +  E+   D++      ++       P +  T   Q    ELA  + ++R             R R  L  KTE+ LD    V   E  L+++++      AD               EK    + ++ E+ R K+++ +++F+K +++EL  +N  L+  K  L DQL+ +R + + + E     +  + K  D   ER+++R++I ELM +N S   + K   +ES     E EQ+   S                                               GKN +I +LEKE + L  ++  +EA    ++Q+NQ  +     DL KEK +    L +++ET +      E +E Q+K ++ E         IT      Q+S  E R+KD+ K+  +L    ++   KL+  +F      KEL++ +   M E  +EL  E+ +++   ++L++    L    +K  ++E EN  L  E R+L++ + S +    Q++ L K+N QL  EN  LRR +++L+ T ++V
Sbjct:   12 NFMSSPLVIWIKTFGTLLRGTGTLLDEYVALIDGVFLNEVMFQI------NPKADNQRIYRKINNDASLRIQNLSVLVKQMKSYYQESLQQLVMMSLPNVLTIGKNPYSEQGTEEMKKLLLLLLGCAVQCERKEEFIEKI-QVLDFDTKAAVAAHIQEVTHNQENVFDLQLLEPTEMSSEDLEALLKNTSFHLKRLIDERDEYTETIIELTEER--DSLHFAPLAISAQSPSGSPGMRRTESRQHLSVELADAKAKIR-------------RLRQELEEKTEQYLDSKQEVGHMEAELKRVQQENMNLLADARSARVYRDELDALREKAIRVDKLESELSRYKERMHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGARARSDKLHELEKENLQLKAKFHDMETERDLERKRIEELMEENMSLEMAQKQSMDESLHLGWELEQLSKTSDLPEIPQKSLGHEVNELTSSRLLKLEMENQTLLSTVEELRNTMGSTDGKNTKILKLEKENQRLCKKMEKLEAEINHERQNNQSSQHLSS-DLMKEKSE----LEKTIETLQ------ENSERQIKGLEQENEHLNQT--ITSLRQRSQIS-AEARVKDIEKENKILHESIKETSSKLNKMEFEKKQMKKELEHFKE--MGERSEELEKELHRVEKETELLQKKITSLNIVCEKTEVLEQENAGLELENRKLKKTLDSLKNLKYQMESLEKENNQLEEENLSLRRSVESLKSTNIKV 719          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Mouse
Match: Ccdc88a (coiled coil domain containing 88A [Source:MGI Symbol;Acc:MGI:1925177])

HSP 1 Score: 103.219 bits (256), Expect = 7.669e-22
Identity = 186/730 (25.48%), Postives = 343/730 (46.99%), Query Frame = 2
Query:  146 LLSEPLVKWLKTFKYEFKAAEFLNLSQ---LIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNS---------MTADNSSLDLDENILQMHHHVTQLTFERRLYFEKYYDC--------FEKHSCDNVEEESGTLNXXXXXXXXXXXXTHGGQWELASPR---KRMRGASDRNEEDVLVVRYR--------PRLKTEKS---LDPVVPVMTPETLEKLKEADEKIKENEDMQQEVIRLKQQLAELDFHXXXXXXXXXXXSQLVADKQKLRDQLQVSRRKEEDVIE---RLIDSQMKLDDTIAEREMDRQKINELM-KNPSSNRSNKNQDEES-----EAEQID--------PKSGKNKRI---------------QELEKEIESLR----------TRLMEAQKQDNQKDEKWKML---------------DLQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLL----RKKGGKLSGDQF-KELDNQEHDLM---NESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQV 2038
             ++ PLV W+KTF     A    NL +   L+   FL+ VM  ++ + +      N K+    + R+H+L  ++K+I  +YQ  L+ +IM+P P+++ I +    E    ++K LLLL+LGCA QC  K++FI +I + LD + +  +  +  ++T+N             D S  D++  +  M  H+ +L  ER  + E   +         F  H+  + +   G+        +  + V      ELA  +   +R+R   +   E +L  +           RL+ E      D     M  + L+ L+E   ++   + ++ E+ R K++L +++F+K +++EL  +N  L+  K  L DQL+ +R + + + E     +  + KL D   ER+MDR+KI ELM +N +   + K   +ES     E EQI         P+      +               Q L K +E LR          +++++ +K++ + ++K ++L               +L K+ +  + QL +++ET   L+   E +E Q+K ++ E        +  R  +  Q+S  E R+KD+ K+  +L    ++  GKLS  +F K    +E +L     E  +EL NE+  L   N++L++    LK   +K+  +E EN  L  E R+ ++ + S +  + Q++ L K+N QL  EN +LRR +++L+   M++
Sbjct:   13 FMTSPLVTWVKTFG-PLAAGNGTNLDEYVALVDGVFLNQVM--LQINPKSESQRVNKKVNNDASLRIHNLSILVKQIKFYYQETLQQLIMMPLPDILIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEEFIEKI-QGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTDMSQEDIEPLLKNMVSHLRRLIDERDEHSETIVELSEERDGVHFLPHASSSAQSPCGSPGMKRTESRQHLSV------ELADAKAKIRRLRQELEEKTEQLLDCKQELEQIEVELKRLQQENMNLLSDARSARMYRDELDALREKAVRV---DKLESELSRYKERLHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQKQSMDESLHLGWELEQISRTSELAEAPQKSLGHEVNELTSSKLLKLEMENQSLTKTVEELRSTADSAAGSTSKILKVEKENQRLNKKVEILENEIIQEKQSLQNCQNLSKDLMKEKAQLEKTIET---LR---ENSERQIKILEQENEHLNQTVSSLRQRS--QIS-AEARVKDIEKENKILHESIKETCGKLSKIEFEKRQMKKELELYKEKGERAEELENELNHLGKENELLQKKITNLKITCEKLETLEQENSELERENRKFKKTLDSFKNLTFQLESLEKENSQLDEENLELRRSVESLKCASMRM 720          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Mouse
Match: Ccdc88c (coiled-coil domain containing 88C [Source:MGI Symbol;Acc:MGI:1915589])

HSP 1 Score: 62.003 bits (149), Expect = 3.627e-9
Identity = 50/158 (31.65%), Postives = 85/158 (53.80%), Query Frame = 2
Query:  146 LLSEPLVKWLKTFKYEFKAAEFLNLS---QLIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNN 610
             L  PLV W+KTF   F +    NL+    L+   FL+ +M  ++   R +    N  +   +  R+ +L  +++ I  +YQ  L+ +I++  PN++ I +         ++K +LLL+LGCA QC  K++FI RI + LDIE Q  I  +  ++T+N
Sbjct:   12 FLQSPLVTWVKTFG-SFGSGHQDNLTLYMDLVDGIFLNQIM--LQIDPRPSNQRINKHVNNDVNLRIQNLSILVRNIKTYYQEVLQQLIVMNLPNVLMIGKDPLSGKSMEEIKKVLLLVLGCAVQCERKEEFIERIKQ-LDIETQAGIVAHIQEVTHN 165          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Mouse
Match: Ccdc88c (coiled-coil domain containing 88C [Source:MGI Symbol;Acc:MGI:1915589])

HSP 1 Score: 62.003 bits (149), Expect = 3.718e-9
Identity = 50/158 (31.65%), Postives = 85/158 (53.80%), Query Frame = 2
Query:  146 LLSEPLVKWLKTFKYEFKAAEFLNLS---QLIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNN 610
             L  PLV W+KTF   F +    NL+    L+   FL+ +M  ++   R +    N  +   +  R+ +L  +++ I  +YQ  L+ +I++  PN++ I +         ++K +LLL+LGCA QC  K++FI RI + LDIE Q  I  +  ++T+N
Sbjct:   12 FLQSPLVTWVKTFG-SFGSGHQDNLTLYMDLVDGIFLNQIM--LQIDPRPSNQRINKHVNNDVNLRIQNLSILVRNIKTYYQEVLQQLIVMNLPNVLMIGKDPLSGKSMEEIKKVLLLVLGCAVQCERKEEFIERIKQ-LDIETQAGIVAHIQEVTHN 165          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Mouse
Match: Ccdc88c (coiled-coil domain containing 88C [Source:MGI Symbol;Acc:MGI:1915589])

HSP 1 Score: 56.9954 bits (136), Expect = 6.964e-9
Identity = 49/154 (31.82%), Postives = 82/154 (53.25%), Query Frame = 2
Query:  149 LSEPLVKWLKTFKYEFKAAEFLNLS---QLIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQL 601
            L  PLV W+KTF   F +    NL+    L+   FL+ +M  ++   R +    N  +   +  R+ +L  +++ I  +YQ  L+ +I++  PN++ I +         ++K +LLL+LGCA QC  K++FI RI + LDIE Q  I  +  +L
Sbjct:   13 LQSPLVTWVKTFG-SFGSGHQDNLTLYMDLVDGIFLNQIM--LQIDPRPSNQRINKHVNNDVNLRIQNLSILVRNIKTYYQEVLQQLIVMNLPNVLMIGKDPLSGKSMEEIKKVLLLVLGCAVQCERKEEFIERIKQ-LDIETQAGIVAHIQEL 162          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Mouse
Match: Ccdc88a (coiled coil domain containing 88A [Source:MGI Symbol;Acc:MGI:1925177])

HSP 1 Score: 46.595 bits (109), Expect = 9.620e-6
Identity = 30/101 (29.70%), Postives = 55/101 (54.46%), Query Frame = 2
Query:  146 LLSEPLVKWLKTFKYEFKAAEFLNLSQ---LIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISE 439
             ++ PLV W+KTF     A    NL +   L+   FL+ VM  ++ + +      N K+    + R+H+L  ++K+I  +YQ  L+ +IM+P P+++ I +
Sbjct:   13 FMTSPLVTWVKTFG-PLAAGNGTNLDEYVALVDGVFLNQVM--LQINPKSESQRVNKKVNNDASLRIHNLSILVKQIKFYYQETLQQLIMMPLPDILIIGK 110          
BLAST of Coiled-coil domain containing 88Aa vs. UniProt/SwissProt
Match: sp|Q3V6T2|GRDN_HUMAN (Girdin OS=Homo sapiens OX=9606 GN=CCDC88A PE=1 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 1.448e-21
Identity = 188/732 (25.68%), Postives = 343/732 (46.86%), Query Frame = 2
Query:  146 LLSEPLVKWLKTFKYEFKAAEFLNLSQ---LIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNS---------MTADNSSLDLDENILQMHHHVTQLTFERRLYFEKYYDC--------FEKHSCDNVEEESGTLNXXXXXXXXXXXXTHGGQWELASPR---KRMRGASDRNEEDVLVVRYR--------PRLKTEKS---LDPVVPVMTPETLEKLKEADEKIKENEDMQQEVIRLKQQLAELDFHXXXXXXXXXXXSQLVADKQKLRDQLQVSRRKEEDVIE---RLIDSQMKLDDTIAEREMDRQKINELM-KNPSSNRSNKNQDEES-----EAEQID--------PKSGKNKRI---------------QELEKEIESLRT----------RLMEAQKQDNQKDEKWKML---------------DLQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLL----RKKGGKLSGDQF------KELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQV 2038
             ++ PLV W+KTF     A    NL +   L+   FL+ VM  ++ + +      N K+    + R+H+L  ++++I  +YQ  L+ +IM+  PN++ I +    E    ++K LLLL+LGCA QC  K++FI RI + LD + +  +  +  ++T+N             D S  D++  +  M  H+ +L  ER  + E   +         F  H+  + +   G+        +  + V      ELA  +   +R+R   +   E +L  +           RL+ E      D     M  + L+ L+E   ++   + ++ EV R K++L +++F+K +++EL  +N  L+  K  L DQL+ +R + + + E     +  + KL D   ER+MDR+KI ELM +N +   + K   +ES     E EQI         P+      +               Q L K +E LRT          ++++ +K++ +  +K ++L               +L K+ +  + QL +++ET   L+   E +E Q+K ++ E        +  R  +  Q+S  E R+KD+ K+  +L    ++   KLS  +F      KEL++ +     E  +EL NE+  L+  N++L++    LK   +K+  +E EN  L  E R+L++ + S +  + Q++ L K+N QL  EN +LRR +++L+   M++
Sbjct:   13 FMTSPLVTWVKTFG-PLAAGNGTNLDEYVALVDGVFLNQVM--LQINPKLESQRVNKKVNNDASLRMHNLSILVRQIKFYYQETLQQLIMMSLPNVLIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEEFIERI-QGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTDMSQEDIEPLLKNMALHLKRLIDERDEHSETIIELSEERDGLHFLPHASSSAQSPCGSPGMKRTESRQHLSV------ELADAKAKIRRLRQELEEKTEQLLDCKQELEQMEIELKRLQQENMNLLSDARSARMYRDELDALREKAVRV---DKLESEVSRYKERLHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQKQSMDESLHLGWELEQISRTSELSEAPQKSLGHEVNELTSSRLLKLEMENQSLTKTVEELRTTVDSVEGNASKILKMEKENQRLSKKVEILENEIVQEKQSLQNCQNLSKDLMKEKAQLEKTIET---LR---ENSERQIKILEQENEHLNQTVSSLRQRS--QIS-AEARVKDIEKENKILHESIKETSSKLSKIEFEKRQIKKELEHYKEK--GERAEELENELHHLEKENELLQKKITNLKITCEKIEALEQENSELERENRKLKKTLDSFKNLTFQLESLEKENSQLDEENLELRRNVESLKCASMKM 720          
BLAST of Coiled-coil domain containing 88Aa vs. UniProt/SwissProt
Match: sp|Q5SNZ0|GRDN_MOUSE (Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 5.253e-21
Identity = 188/727 (25.86%), Postives = 338/727 (46.49%), Query Frame = 2
Query:  146 LLSEPLVKWLKTFKYEFKAAEFLNLSQ---LIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNS---------MTADNSSLDLDENILQMHHHVTQLTFERRLYFEKYYDC--------FEKHSCDNVEEESGTLNXXXXXXXXXXXXTHGGQWELASPR---KRMRGASDRNEEDVLVVRYR--------PRLKTEKS---LDPVVPVMTPETLEKLKEADEKIKENEDMQQEVIRLKQQLAELDFHXXXXXXXXXXXSQLVADKQKLRDQLQVSRRKEEDVIE---RLIDSQMKLDDTIAEREMDRQKINELM-KNPSSNRSNKNQDEES-----EAEQID--------PKSGKNKRIQE--------LEKEIESLRTRLMEAQK-QDNQKDEKWKMLDLQKEKVDARRQLNESLET--NEAL--KRQLEKAENQLKNMQNELVEAQDIANITRTANDDQV--------------------SQF--EERIKDLTKQVNLL----RKKGGKLSGDQF------KELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQV 2038
             ++ PLV W+KTF     A    NL +   L+   FL+ VM  ++ + +      N K+    + R+H+L  ++K+I  +YQ  L+ +IM+P P+++ I +    E    ++K LLLL+LGCA QC  K++FI +I + LD + +  +  +  ++T+N             D S  D++  +  M  H+ +L  ER  + E   +         F  H+  + +   G+        +  + V      ELA  +   +R+R   +   E +L  +           RL+ E      D     M  + L+ L+E   ++   + ++ E+ R K++L +++F+K +++EL  +N  L+  K  L DQL+ +R + + + E     +  + KL D   ER+MDR+KI ELM +N +   + K   +ES     E EQI         P+      + E        LE E +SL   + E +   D+      K+L ++KE     ++LN+ +E   NE +  K+ L+  +N  K++  E  + +      R  ++ Q+                    SQ   E R+KD+ K+  +L    ++  GKLS  +F      KEL+  +     E  +EL NE+  L   N++L++    LK   +K+  +E EN  L  E R+ ++ + S +  + Q++ L K+N QL  EN +LRR +++L+   M++
Sbjct:   13 FMTSPLVTWVKTFG-PLAAGNGTNLDEYVALVDGVFLNQVM--LQINPKSESQRVNKKVNNDASLRIHNLSILVKQIKFYYQETLQQLIMMPLPDILIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEEFIEKI-QGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTDMSQEDIEPLLKNMVSHLRRLIDERDEHSETIVELSEERDGVHFLPHASSSAQSPCGSPGMKRTESRQHLSV------ELADAKAKIRRLRQELEEKTEQLLDCKQELEQIEVELKRLQQENMNLLSDARSARMYRDELDALREKAVRV---DKLESELSRYKERLHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQKQSMDESLHLGWELEQISRTSELAEAPQKSLGHEVNELTSSKLLKLEMENQSLTKTVEELRSTADSAAGSTSKILKVEKE----NQRLNKKVEILENEIIQEKQSLQNCQNLSKDLMKEKAQLEKTIETLRENSERQIKILEQENEHLNQTVSSLRQRSQISAEARVKDIEKENKILHESIKETCGKLSKIEFEKRQMKKELELYKEK--GERAEELENELNHLGKENELLQKKITNLKITCEKLETLEQENSELERENRKFKKTLDSFKNLTFQLESLEKENSQLDEENLELRRSVESLKCASMRM 720          
BLAST of Coiled-coil domain containing 88Aa vs. UniProt/SwissProt
Match: sp|P85120|DAPLE_XENLA (Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 1.951e-9
Identity = 51/160 (31.87%), Postives = 89/160 (55.62%), Query Frame = 2
Query:  146 LLSEPLVKWLKTF-----KYEFKAAEFLNLSQLIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNN 610
             L  PLV W+KTF     + E K A ++   +L+   FL+ +M  ++   R +    N  +   +  R+ +L  +++ I  +YQ  L+ +I++  PN++ IS+    +    +LK +LLL+LGCA QC  K+++I RI + LDIE Q  I  +  ++T+N
Sbjct:   12 FLESPLVTWVKTFGPCGNENESKLAMYM---ELVDGVFLNKIM--VQIDPRPSNQRVNKHVNNDVNRRVQNLTILVRHIKAYYQEVLQQLIVMNLPNVLLISKDPLTDKSMEELKKILLLMLGCAVQCERKEEYIERIKQ-LDIETQAGIVSHIQEVTHN 165          
BLAST of Coiled-coil domain containing 88Aa vs. UniProt/SwissProt
Match: sp|Q9P219|DAPLE_HUMAN (Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3)

HSP 1 Score: 62.7734 bits (151), Expect = 1.705e-8
Identity = 51/158 (32.28%), Postives = 84/158 (53.16%), Query Frame = 2
Query:  146 LLSEPLVKWLKTFKYEFKAAEFLNLSQ---LIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNN 610
             L  PLV W+KTF   F +    NL+    L+   FL+ +M  ++   R T    N  +   +  R+ +L  +++ I  +YQ  L+ +I++  PN++ I           ++K +LLL+LGCA QC  K++FI RI + LDIE Q  I  +  ++T+N
Sbjct:   12 FLQSPLVTWVKTFG-PFGSGSQDNLTMYMDLVDGIFLNQIM--LQIDPRPTNQRINKHVNNDVNLRIQNLTILVRNIKTYYQEVLQQLIVMNLPNVLMIGRDPLSGKSMEEIKKVLLLVLGCAVQCERKEEFIERIKQ-LDIETQAGIVAHIQEVTHN 165          

HSP 2 Score: 53.9138 bits (128), Expect = 8.475e-6
Identity = 70/245 (28.57%), Postives = 128/245 (52.24%), Query Frame = 2
Query: 1358 QELEKEIESLRTRLMEAQKQDNQKDEKWKMLDLQKEKVDARRQLNESLETNEALK-RQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLLRK----KGGKLSGDQFKEL----DNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFT---LMQVDPYNKQ 2056
             +L K+IE L+T+L E +KQ NQ  E      L +E +  + QL   +ET +A K RQ++  E +  ++   +   ++ + ++  A          R+KD+ K+   L +      GKLS  +F++     D ++     E  ++L  E+ +L+  N  L +    L+   +KV  +E E++ L  E R L++++ + +  S Q++ L + N QL  EN +LRR+++T+RFT   L Q++  N+Q
Sbjct:  504 HQLSKKIEKLQTQL-EREKQSNQDLET-----LSEELIREKEQLQSDMETLKADKARQIKDLEQEKDHLNRAMWSLRERSQVSSEA----------RMKDVEKENKALHQTVTEANGKLSQLEFEKRQLHRDLEQAKEKGERAEKLERELQRLQEENGRLARKVTSLETATEKVEALEHESQGLQLENRTLRKSLDTLQNVSLQLEGLERDNKQLDAENLELRRLVETMRFTSTKLAQMERENQQ 732          
BLAST of Coiled-coil domain containing 88Aa vs. UniProt/SwissProt
Match: sp|Q6VGS5|DAPLE_MOUSE (Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.601e-8
Identity = 50/158 (31.65%), Postives = 85/158 (53.80%), Query Frame = 2
Query:  146 LLSEPLVKWLKTFKYEFKAAEFLNLS---QLIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNN 610
             L  PLV W+KTF   F +    NL+    L+   FL+ +M  ++   R +    N  +   +  R+ +L  +++ I  +YQ  L+ +I++  PN++ I +         ++K +LLL+LGCA QC  K++FI RI + LDIE Q  I  +  ++T+N
Sbjct:   12 FLQSPLVTWVKTFG-SFGSGHQDNLTLYMDLVDGIFLNQIM--LQIDPRPSNQRINKHVNNDVNLRIQNLSILVRNIKTYYQEVLQQLIVMNLPNVLMIGKDPLSGKSMEEIKKVLLLVLGCAVQCERKEEFIERIKQ-LDIETQAGIVAHIQEVTHN 165          
BLAST of Coiled-coil domain containing 88Aa vs. TrEMBL
Match: A0A1I8HKZ9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 1.019e-58
Identity = 145/376 (38.56%), Postives = 232/376 (61.70%), Query Frame = 2
Query:  971 LEKLKEADEKIKENEDMQQEVIRLKQQLAELDFHXXXXXXXXXXXSQLVADKQKLRDQLQVSRRKEEDVIERLIDSQMKLDDTIAEREMDRQKINELMKNPSSNRSNKNQDEESEAEQIDPKSGKNKRIQELEKEIESLRT------RLMEAQKQDNQKDEKWKMLDLQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLLRKKGGKLSGDQFKELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQVDPYNKQKYTYISSI 2080
            +++LK    KI + E+M++EV  L+Q+  E DF+K +++EL  ENSQLV D+Q   + L  SRRKEEDVIERL++ QM+ D+    RE D ++  + ++  +S          +  EQ         RI+ELE E++ LR+               + K E+WK L+++KE V  RR+L ++ +  E   ++ ++AE QL+       + +     TR ++++ V   E RI +LT Q+ LL++KG + +    +E +  E ++M +SVQELT++V +LK +NKILRQ+CDKLK +V K+  IE ENERL  E R L++  A+     ++ + +RK+NLQL +ENKKLRR++++L+ TL+Q+DPYNK +Y YI+S+
Sbjct:  259 VQRLKATAAKISKFENMEKEVYTLRQRQTEFDFYKSRVQELRTENSQLVEDRQHFEELLYSSRRKEEDVIERLVECQMRCDELAGLREADAERSRQALEAAAS----------AGGEQAVA------RIRELEAEVDRLRSTGSTGAAASGGPSASDDKQERWKFLEVKKELVQTRRELAKARKQAETDAQRAKRAEAQLETATKAGADREHELVGTRQSHEEHVRDLERRIHELTNQIVLLKRKGSE-AMKGLREAELAEMEVMFQSVQELTSQVSRLKNNNKILRQSCDKLKSEVYKIFTIEQENERLLAENRELRKTKAADSTAQDEWELVRKKNLQLEVENKKLRRIVESLKMTLVQIDPYNKMRYHYITSL 617          
BLAST of Coiled-coil domain containing 88Aa vs. TrEMBL
Match: A0A1I8HXZ3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 1.434e-58
Identity = 145/376 (38.56%), Postives = 232/376 (61.70%), Query Frame = 2
Query:  971 LEKLKEADEKIKENEDMQQEVIRLKQQLAELDFHXXXXXXXXXXXSQLVADKQKLRDQLQVSRRKEEDVIERLIDSQMKLDDTIAEREMDRQKINELMKNPSSNRSNKNQDEESEAEQIDPKSGKNKRIQELEKEIESLRT------RLMEAQKQDNQKDEKWKMLDLQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLLRKKGGKLSGDQFKELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQVDPYNKQKYTYISSI 2080
            +++LK    KI + E+M++EV  L+Q+  E DF+K +++EL  ENSQLV D+Q   + L  SRRKEEDVIERL++ QM+ D+    RE D ++  + ++  +S          +  EQ         RI+ELE E++ LR+               + K E+WK L+++KE V  RR+L ++ +  E   ++ ++AE QL+       + +     TR ++++ V   E RI +LT Q+ LL++KG + +    +E +  E ++M +SVQELT++V +LK +NKILRQ+CDKLK +V K+  IE ENERL  E R L++  A+     ++ + +RK+NLQL +ENKKLRR++++L+ TL+Q+DPYNK +Y YI+S+
Sbjct:  264 VQRLKATAAKISKFENMEKEVYTLRQRQTEFDFYKSRVQELRTENSQLVEDRQHFEELLYSSRRKEEDVIERLVECQMRCDELAGLREADAERSRQALEAAAS----------AGGEQAVA------RIRELEAEVDRLRSTGSTGAAASGGPSASDDKQERWKFLEVKKELVQTRRELAKARKQAETDAQRAKRAEAQLETATKAGADREHELVGTRQSHEEHVRDLERRIHELTNQIVLLKRKGSE-AMKGLREAELAEMEVMFQSVQELTSQVSRLKNNNKILRQSCDKLKSEVYKIFTIEQENERLLAENRELRKTKAADSTAQDEWELVRKKNLQLEVENKKLRRIVESLKMTLVQIDPYNKMRYHYITSL 622          
BLAST of Coiled-coil domain containing 88Aa vs. TrEMBL
Match: A0A1I8HB33 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 2.396e-58
Identity = 145/376 (38.56%), Postives = 233/376 (61.97%), Query Frame = 2
Query:  971 LEKLKEADEKIKENEDMQQEVIRLKQQLAELDFHXXXXXXXXXXXSQLVADKQKLRDQLQVSRRKEEDVIERLIDSQMKLDDTIAEREMDRQKINELMKNPSSNRSNKNQDEESEAEQIDPKSGKNKRIQELEKEIESLRTRLMEAQKQD------NQKDEKWKMLDLQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLLRKKGGKLSGDQFKELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQVDPYNKQKYTYISSI 2080
            +++LK    KI + E+M++EV  L+Q+  E DF+K +++EL  ENSQLV D+Q   + L  SRRKEEDVIERL++ QM+ D+    RE D ++  + ++  +S          +  EQ         RI+ELE E++ LR+               + K E+WK L+++KE V  RR+L ++ +  E   ++ ++AE QL+       + +     TR ++++ V + E RI +LT Q+ LL++KG + +    +E +  E ++M +SVQELT++V +LK +NKILRQ+CDKLK +V K+  IE ENERL  E R L++  A+     ++ + +RK+NLQL +ENKKLRR++++L+ TL+Q+DPYNK +Y YI+S+
Sbjct:  264 VQRLKATAAKISKFENMEKEVYTLRQRQTEFDFYKSRVQELRTENSQLVEDRQHFEELLSSSRRKEEDVIERLVECQMRCDELAGLREADAERSRQALEAAAS----------AGGEQAVA------RIRELEAEVDRLRSTGSAGAAASGGPSASDDKQERWKFLEVKKELVQTRRELAKARKQAETDAQRAKRAEAQLETATKAGADREHELVGTRQSHEEHVRELERRIHELTNQIVLLKRKGSE-AMKGLREAELAEMEVMFQSVQELTSQVSRLKNNNKILRQSCDKLKSEVYKIFTIEQENERLLAENRELRKTKAADSTAQDEWELVRKKNLQLEVENKKLRRIVESLKMTLVQIDPYNKMRYHYITSL 622          
BLAST of Coiled-coil domain containing 88Aa vs. TrEMBL
Match: A0A267GT63 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026006g1 PE=4 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 6.917e-58
Identity = 147/378 (38.89%), Postives = 234/378 (61.90%), Query Frame = 2
Query:  965 ETLEKLKEADEKIKENEDMQQEVIRLKQQLAELDFHXXXXXXXXXXXSQLVADKQKLRDQLQVSRRKEEDVIERLIDSQMKLDDTIAEREMDRQKINELMKNPSSNRSNKNQDEESEAEQIDPKSGKNKRIQELEKEIESLRT------RLMEAQKQDNQKDEKWKMLDLQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLLRKKGGKLSGDQFKELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQVDPYNKQKYTYISSI 2080
            E +E+LK+   KI + E+M++EV  L+Q+  E DF+K +++EL  ENSQLV D+Q   + L  SRRKEEDVIERL++ QM+ D+    RE D ++  + ++  +S          +  EQ         RI+ELE E++ LR+               + K E+WK L+++KE V  RR+L ++ +  E   ++ ++AE QL+       + +     TR ++++ V   E RI +LT Q+ LL++KG + +    +E +  E ++M +SVQELT++V +LK +NKILRQ+CDKLK +V K+  IE ENERL  E R L++  A+     ++ + +RK+NLQL +ENKKLRR++++L+ TL+Q+DPYNK +Y YI+S+
Sbjct:  289 EEIERLKD---KISKFENMEKEVYTLRQRQTEFDFYKSRVQELRTENSQLVEDRQHFEELLYSSRRKEEDVIERLVECQMRCDELAGLREADAERSRQALEAAAS----------AGGEQAVA------RIRELEAEVDRLRSTGSTGAAASGGPSASDDKQERWKFLEVKKELVQTRRELAKARKQAETDAQRAKRAEAQLETATKAGADREHELVGTRQSHEEHVRDLERRIHELTNQIVLLKRKGSE-AMKGLREAELAEMEVMFQSVQELTSQVSRLKNNNKILRQSCDKLKSEVYKIFTIEQENERLLAENRELRKTKAADSTAQDEWELVRKKNLQLEVENKKLRRIVESLKMTLVQIDPYNKMRYHYITSL 646          
BLAST of Coiled-coil domain containing 88Aa vs. TrEMBL
Match: A0A267FUC0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026006g2 PE=4 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 7.860e-58
Identity = 147/378 (38.89%), Postives = 234/378 (61.90%), Query Frame = 2
Query:  965 ETLEKLKEADEKIKENEDMQQEVIRLKQQLAELDFHXXXXXXXXXXXSQLVADKQKLRDQLQVSRRKEEDVIERLIDSQMKLDDTIAEREMDRQKINELMKNPSSNRSNKNQDEESEAEQIDPKSGKNKRIQELEKEIESLRT------RLMEAQKQDNQKDEKWKMLDLQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLLRKKGGKLSGDQFKELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQVDPYNKQKYTYISSI 2080
            E +E+LK+   KI + E+M++EV  L+Q+  E DF+K +++EL  ENSQLV D+Q   + L  SRRKEEDVIERL++ QM+ D+    RE D ++  + ++  +S          +  EQ         RI+ELE E++ LR+               + K E+WK L+++KE V  RR+L ++ +  E   ++ ++AE QL+       + +     TR ++++ V   E RI +LT Q+ LL++KG + +    +E +  E ++M +SVQELT++V +LK +NKILRQ+CDKLK +V K+  IE ENERL  E R L++  A+     ++ + +RK+NLQL +ENKKLRR++++L+ TL+Q+DPYNK +Y YI+S+
Sbjct:  289 EEIERLKD---KISKFENMEKEVYTLRQRQTEFDFYKSRVQELRTENSQLVEDRQHFEELLYSSRRKEEDVIERLVECQMRCDELAGLREADAERSRQALEAAAS----------AGGEQAVA------RIRELEAEVDRLRSTGSTGAAASGGPSASDDKQERWKFLEVKKELVQTRRELAKARKQAETDAQRAKRAEAQLETATKAGADREHELVGTRQSHEEHVRDLERRIHELTNQIVLLKRKGSE-AMKGLREAELAEMEVMFQSVQELTSQVSRLKNNNKILRQSCDKLKSEVYKIFTIEQENERLLAENRELRKTKAADSTAQDEWELVRKKNLQLEVENKKLRRIVESLKMTLVQIDPYNKMRYHYITSL 646          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Cavefish
Match: ccdc88c (protein Daple [Source:NCBI gene;Acc:103041063])

HSP 1 Score: 69.707 bits (169), Expect = 1.431e-11
Identity = 54/166 (32.53%), Postives = 91/166 (54.82%), Query Frame = 2
Query:  140 SDLLSEPLVKWLKTFK-----YEFKAAEFLNLSQLIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIAD----RLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNN 610
            S+ +  PLV W+KTF       + K + F+   +L+   FL  +M  I       P  TN ++   + +    R+ +L  V++ I  +YQ NL+ +I++  PN++TI++         ++K LLLL+LGCA QC  K++ I +I +LLDIE Q  I  +  ++T+N
Sbjct:   10 SNFMESPLVVWVKTFGPLSSNLDDKLSMFM---ELVDGVFLHKIMTHI------DPNPTNHRVNKQVNNDVNLRIQNLSTVIRHIKNYYQENLQQLILMTLPNVLTIAKDPLSGKSMEEMKRLLLLLLGCAVQCERKEEIIEKI-KLLDIETQAAIVSHIQEVTHN 165          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Nematostella
Match: EDO31530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXP7])

HSP 1 Score: 56.9954 bits (136), Expect = 3.185e-8
Identity = 51/157 (32.48%), Postives = 85/157 (54.14%), Query Frame = 2
Query:  140 SDLLSEPLVKWLKTFKYEFKAAEFL-NLSQLIGSDFLDNVMYLIRFSKRK-TPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLT 604
             D L+ PLV W+ TFK      +F+ ++S+     FL+ VM  I  +    T    NV+    I  R+ +L  +++ +  +YQ  L+ +I+L AP++VTI+   + +    +L  +LLL+LGCA Q   K+ FI +I E LD E Q+ +     ++T
Sbjct:    5 GDFLANPLVTWVNTFK----NGKFIESVSEFADGVFLNEVMVEIDPTYFTLTRIHHNVEGDLNI--RIQNLDALVRHLKAYYQEKLQQLILLRAPDVVTIAHDPKSDVSLQELIKILLLMLGCAVQSEKKEDFIEKIKE-LDFEVQKNLVDCIKEIT 154          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Medaka
Match: CCDC88A (coiled-coil domain containing 88A [Source:NCBI gene;Acc:101156523])

HSP 1 Score: 70.4774 bits (171), Expect = 6.533e-12
Identity = 57/208 (27.40%), Postives = 107/208 (51.44%), Query Frame = 2
Query:  158 PLVKWLKTFKYEFKAAEFLNLSQ---LIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNSMTA------DNSSL---DLDENILQMHHHVTQLTFERRLYFEKYYDCFEKHSC 745
            PLV W++T   + KA+E   LS+   L+   +L+ +M  +  + +     TN K+      R+ +L  ++++I  +YQ +L+ ++M+P PN++ +      E   +++  LLLL+LGCA QC  K+++I RI + LD E +  I  +  ++T+N          +N ++   DLD     +  H+ +L  ER    E   +  ++  C
Sbjct:   17 PLVCWVRTVG-QLKASESNKLSEYIELVDGIYLNEIM--LEINPKAAVQRTNKKVNNDPTLRIQNLSILIRQIKSYYQESLQQLVMMPLPNVLVLGRNPLSEQGLDEMGKLLLLLLGCAVQCEKKEEYIERI-QTLDFETKAAIASHIQEVTHNQENVMDLQWLENGNVPPEDLDNLSRNLAFHLKRLVDERDTQLETIVELTQERDC 220          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Medaka
Match: CCDC88A (coiled-coil domain containing 88A [Source:NCBI gene;Acc:101156523])

HSP 1 Score: 70.4774 bits (171), Expect = 6.662e-12
Identity = 57/208 (27.40%), Postives = 107/208 (51.44%), Query Frame = 2
Query:  158 PLVKWLKTFKYEFKAAEFLNLSQ---LIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNSMTA------DNSSL---DLDENILQMHHHVTQLTFERRLYFEKYYDCFEKHSC 745
            PLV W++T   + KA+E   LS+   L+   +L+ +M  +  + +     TN K+      R+ +L  ++++I  +YQ +L+ ++M+P PN++ +      E   +++  LLLL+LGCA QC  K+++I RI + LD E +  I  +  ++T+N          +N ++   DLD     +  H+ +L  ER    E   +  ++  C
Sbjct:   17 PLVCWVRTVG-QLKASESNKLSEYIELVDGIYLNEIM--LEINPKAAVQRTNKKVNNDPTLRIQNLSILIRQIKSYYQESLQQLVMMPLPNVLVLGRNPLSEQGLDEMGKLLLLLLGCAVQCEKKEEYIERI-QTLDFETKAAIASHIQEVTHNQENVMDLQWLENGNVPPEDLDNLSRNLAFHLKRLVDERDTQLETIVELTQERDC 220          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Medaka
Match: CCDC88A (coiled-coil domain containing 88A [Source:NCBI gene;Acc:101156523])

HSP 1 Score: 70.0922 bits (170), Expect = 9.027e-12
Identity = 57/208 (27.40%), Postives = 107/208 (51.44%), Query Frame = 2
Query:  158 PLVKWLKTFKYEFKAAEFLNLSQ---LIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNSMTA------DNSSL---DLDENILQMHHHVTQLTFERRLYFEKYYDCFEKHSC 745
            PLV W++T   + KA+E   LS+   L+   +L+ +M  +  + +     TN K+      R+ +L  ++++I  +YQ +L+ ++M+P PN++ +      E   +++  LLLL+LGCA QC  K+++I RI + LD E +  I  +  ++T+N          +N ++   DLD     +  H+ +L  ER    E   +  ++  C
Sbjct:   17 PLVCWVRTVG-QLKASESNKLSEYIELVDGIYLNEIM--LEINPKAAVQRTNKKVNNDPTLRIQNLSILIRQIKSYYQESLQQLVMMPLPNVLVLGRNPLSEQGLDEMGKLLLLLLGCAVQCEKKEEYIERI-QTLDFETKAAIASHIQEVTHNQENVMDLQWLENGNVPPEDLDNLSRNLAFHLKRLVDERDTQLETIVELTQERDC 220          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Medaka
Match: ccdc88c (protein Daple-like [Source:NCBI gene;Acc:101164937])

HSP 1 Score: 64.6994 bits (156), Expect = 4.736e-10
Identity = 49/165 (29.70%), Postives = 88/165 (53.33%), Query Frame = 2
Query:  140 SDLLSEPLVKWLKTFKYEFKAAEFLNLSQLIGS--DFLDNVMYLIRFSKRKTPPETNVKLPCTIAD----RLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNSM 616
            S  +  PLV W+++      + + + L + +    + +D V +L +      P  TN +L   + +    RLH+L  + + I  +YQ  L+ +I++P PN++ I++         +L+ LLLL+LGCA QC  K + I +I +LLDI+ Q  I  +  ++T+N M
Sbjct:   10 SAFMDSPLVLWVRSLG-PLGSCDGMGLEEPVRMFMELVDGV-FLHKILTHIDPSPTNQRLTKNVNNDMSLRLHNLTVLTRHIKTYYQETLQQLIVMPLPNILCIAKDPLSAKSMEELRRLLLLLLGCAVQCERKQEMIDKI-KLLDIQTQAAIVSHIQEVTHNQM 171          
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Medaka
Match: ccdc88b (girdin [Source:NCBI gene;Acc:101172742])

HSP 1 Score: 55.8398 bits (133), Expect = 2.209e-7
Identity = 58/231 (25.11%), Postives = 102/231 (44.16%), Query Frame = 2
Query:  143 DLLSEPLVKWLKTFKYEFKA-----AEFLNLS-----------QLIGSDFLDNVMYLIRFSKRKTPPETNV-KLPCTIAD----RLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNSMTA---------DNSSLDLDENILQMHHHVTQLTFERRLYFEKYYD-CFEKHS 742
            + +  PL +W++ F+   ++      +++ +S           +L    FL+ VM       R   P   V +L  +  D    R+ +   + + +  FYQ +L+ +I+ P PN+  + +    E    +L+ LLLL+LGCA QC  K+ FI +I + LDIE Q  I     Q+T +             D+   DL      M   +  L  +R L+ E+  + C E+ +
Sbjct:   11 EFMGSPLARWVQLFENTLESEADICGQYMEVSSASRSARDLYVKLTNGVFLNEVM-------RTIDPNPKVERLYYSERDDNLLRVQNFSILNRHLRAFYQEDLQQLILTPLPNVAILGQDPFTEAAVEELRQLLLLLLGCAVQCERKETFIQQI-QSLDIETQAAIANCIQQVTQDPRMVLPLQWEELMDSEGADLQLVFSSMAKQIQSLLAQRDLHLERIAELCREREA 233          
BLAST of Coiled-coil domain containing 88Aa vs. Planmine SMEST
Match: SMESG000012304.1 (SMESG000012304.1)

HSP 1 Score: 1244.18 bits (3218), Expect = 0.000e+0
Identity = 650/654 (99.39%), Postives = 653/654 (99.85%), Query Frame = 2
Query:  119 MKSVYEDSDLLSEPLVKWLKTFKYEFKAAEFLNLSQLIGSDFLDNVMYLIRFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDXXXXXXXXXGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNSMTADNSSLDLDENILQMHHHVTQLTFERRLYFEKYYDCFEKHSCDNVEEESGTLNXXXXXXXXXXXXTHGGQWELASPRKRMRGASDRNEEDVLVVRYRPRLKTEKSLDPVVPVMTPETLEKLKEADEKIKENEDMQQEVIRLKQQLAELDFHXXXXXXXXXXXSQLVADKQKLRDQLQVSRRKEEDVIERLIDSQMKLDDTIAEREMDRQKINELMKNPSSNRSNKNQDEESEAEQIDPKSGKNKRIQELEKEIESLRTRLMEAQKQDNQKDEKWKMLDLQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLLRKKGGKLSGDQFKELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQVDPYNKQKYTYISSI 2080
            MKSVYEDSDLLSEPLVKWLKTFKYEFKAAEFLNLSQLIGSDFLDNVMYLIRFSKRKTPPET+VKLPCTI+DRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDLKLLLLLILGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNSMTADNSSLDLDENILQMHHHVTQLTFERRLYFEKYYDCFEKHSCDNVEEESGTLNPVPIFIQPIVPVTHGGQWELASPRKRMRGASDRNEEDVLVVRYRPRLKTEK LDPVVPVMTPETLEKLKEADEKIKENEDMQQEVIRLKQQLAELDFHKKKLKELNNENSQLVADKQKLRDQLQVSRRKEEDVIERL+DSQMKLDDTIAEREMDRQKINELMKNPSSNRSNKNQDEESEAEQIDPKSGKNKRIQELEKEIESLRTRLMEAQKQDNQKDEKWKMLDLQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLLRKKGGKLSGDQFKELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQVDPYNKQKYTYISSI
Sbjct:    1 MKSVYEDSDLLSEPLVKWLKTFKYEFKAAEFLNLSQLIGSDFLDNVMYLIRFSKRKTPPETDVKLPCTISDRLHHLREVLKEILEFYQGNLKLVIMLPAPNLVTISEAIRFEDCENDLKLLLLLILGCAAQCSLKDKFISRITELLDIEDQQYIEKYFHQLTNNSMTADNSSLDLDENILQMHHHVTQLTFERRLYFEKYYDCFEKHSCDNVEEESGTLNPVPIFIQPIVPVTHGGQWELASPRKRMRGASDRNEEDVLVVRYRPRLKTEKPLDPVVPVMTPETLEKLKEADEKIKENEDMQQEVIRLKQQLAELDFHKKKLKELNNENSQLVADKQKLRDQLQVSRRKEEDVIERLVDSQMKLDDTIAEREMDRQKINELMKNPSSNRSNKNQDEESEAEQIDPKSGKNKRIQELEKEIESLRTRLMEAQKQDNQKDEKWKMLDLQKEKVDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTANDDQVSQFEERIKDLTKQVNLLRKKGGKLSGDQFKELDNQEHDLMNESVQELTNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMASTELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQVDPYNKQKYTYISSI 654          
The following BLAST results are available for this feature:
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCDC88A1.838e-2225.68coiled-coil domain containing 88A [Source:HGNC Sym... [more]
CCDC88A2.284e-2225.68coiled-coil domain containing 88A [Source:HGNC Sym... [more]
CCDC88A2.467e-2225.68coiled-coil domain containing 88A [Source:HGNC Sym... [more]
CCDC88A2.865e-2225.68coiled-coil domain containing 88A [Source:HGNC Sym... [more]
CCDC88A3.016e-2225.68coiled-coil domain containing 88A [Source:HGNC Sym... [more]
back to top
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc88aa1.228e-732.39coiled-coil domain containing 88Aa [Source:ZFIN;Ac... [more]
back to top
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCDC88A2.743e-1925.60coiled-coil domain containing 88A [Source:NCBI gen... [more]
CCDC88A3.195e-1925.60coiled-coil domain containing 88A [Source:NCBI gen... [more]
CCDC88A3.667e-1925.60coiled-coil domain containing 88A [Source:NCBI gen... [more]
CCDC88A4.006e-1925.60coiled-coil domain containing 88A [Source:NCBI gen... [more]
CCDC88A4.122e-1925.60coiled-coil domain containing 88A [Source:NCBI gen... [more]
back to top
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ccdc88a7.669e-2225.48coiled coil domain containing 88A [Source:MGI Symb... [more]
Ccdc88c3.627e-931.65coiled-coil domain containing 88C [Source:MGI Symb... [more]
Ccdc88c3.718e-931.65coiled-coil domain containing 88C [Source:MGI Symb... [more]
Ccdc88c6.964e-931.82coiled-coil domain containing 88C [Source:MGI Symb... [more]
Ccdc88a9.620e-629.70coiled coil domain containing 88A [Source:MGI Symb... [more]
back to top
BLAST of Coiled-coil domain containing 88Aa vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3V6T2|GRDN_HUMAN1.448e-2125.68Girdin OS=Homo sapiens OX=9606 GN=CCDC88A PE=1 SV=... [more]
sp|Q5SNZ0|GRDN_MOUSE5.253e-2125.86Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV... [more]
sp|P85120|DAPLE_XENLA1.951e-931.88Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c... [more]
sp|Q9P219|DAPLE_HUMAN1.705e-832.28Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C P... [more]
sp|Q6VGS5|DAPLE_MOUSE2.601e-831.65Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c ... [more]
back to top
BLAST of Coiled-coil domain containing 88Aa vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HKZ91.019e-5838.56Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HXZ31.434e-5838.56Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HB332.396e-5838.56Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GT636.917e-5838.89Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FUC07.860e-5838.89Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc88c1.431e-1132.53protein Daple [Source:NCBI gene;Acc:103041063][more]
back to top
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO315303.185e-832.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Coiled-coil domain containing 88Aa vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCDC88A6.533e-1227.40coiled-coil domain containing 88A [Source:NCBI gen... [more]
CCDC88A6.662e-1227.40coiled-coil domain containing 88A [Source:NCBI gen... [more]
CCDC88A9.027e-1227.40coiled-coil domain containing 88A [Source:NCBI gen... [more]
ccdc88c4.736e-1029.70protein Daple-like [Source:NCBI gene;Acc:101164937... [more]
ccdc88b2.209e-725.11girdin [Source:NCBI gene;Acc:101172742][more]
back to top
BLAST of Coiled-coil domain containing 88Aa vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000012304.10.000e+099.39SMESG000012304.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004840 ID=SMED30004840|Name=Coiled-coil domain containing 88Aa|organism=Schmidtea mediterranea sexual|type=transcript|length=2586bp
TTATTTACAACAATAAATTTTTATTTACTTCTTAAAATAAATTTGTAATG
ATAAATTTTCAATAAAGTTAAGATTAATTTTAAAAAAGGATTTTATAAAT
TGACAATATAATATTCTTATGAAATCAGTTTATGAAGATAGCGACTTGTT
AAGTGAACCGTTAGTAAAATGGTTGAAAACTTTTAAATATGAATTTAAAG
CTGCCGAATTTCTAAATCTTTCACAATTAATTGGATCAGATTTCTTGGAT
AATGTAATGTATTTAATAAGGTTTTCTAAGAGAAAAACGCCACCAGAAAC
AAATGTCAAGCTACCATGCACAATTGCAGACAGGTTGCATCATTTGAGAG
AAGTTCTGAAAGAAATATTGGAGTTCTATCAAGGGAATTTGAAACTGGTC
ATTATGCTTCCCGCTCCGAATTTAGTTACCATCAGTGAAGCTATACGATT
TGAGGACTGTGAAAATGACTTGAAATTACTGCTATTGTTGATCCTCGGCT
GTGCGGCACAATGCTCCCTTAAAGACAAGTTTATATCCAGGATAACCGAA
CTTCTCGACATTGAAGATCAACAATACATTGAAAAATATTTTCACCAGCT
TACCAATAATTCAATGACCGCGGACAACTCCTCATTGGATCTTGATGAAA
ATATCCTTCAAATGCATCACCATGTTACACAGTTGACTTTTGAACGGCGA
CTTTATTTCGAGAAATATTATGATTGCTTTGAGAAACATTCTTGCGATAA
TGTGGAAGAGGAGTCAGGAACGTTGAATCCTGTTCCAATTTTTATTCAGC
CAATTGTTCCAGTTACTCATGGGGGTCAATGGGAACTGGCTTCACCACGG
AAACGTATGCGTGGAGCATCAGATAGAAATGAAGAAGATGTATTGGTAGT
CCGATACCGACCGAGATTGAAAACGGAAAAGTCATTAGATCCGGTTGTGC
CTGTAATGACACCGGAAACTTTGGAGAAACTCAAAGAAGCCGATGAAAAG
ATAAAAGAAAATGAAGATATGCAACAGGAAGTGATAAGACTGAAGCAACA
GTTAGCTGAATTGGATTTTCACAAGAAAAAATTGAAGGAATTGAATAATG
AAAATTCTCAACTCGTAGCTGATAAACAAAAGCTCCGAGATCAATTGCAA
GTTAGTCGACGAAAGGAAGAAGATGTAATTGAAAGATTGATTGATAGTCA
AATGAAACTGGACGACACAATTGCTGAACGAGAAATGGATCGGCAGAAAA
TCAATGAGCTCATGAAAAATCCCTCATCAAATAGATCCAATAAAAATCAA
GATGAAGAGTCTGAAGCGGAACAAATTGATCCTAAATCTGGCAAAAATAA
ACGAATTCAGGAGTTGGAGAAAGAAATTGAATCTCTAAGAACTCGATTGA
TGGAGGCTCAAAAGCAAGATAATCAAAAGGATGAAAAATGGAAAATGCTC
GACTTACAAAAGGAAAAAGTCGATGCTCGGCGACAATTAAATGAGTCTTT
GGAAACGAATGAGGCATTGAAAAGGCAATTGGAAAAGGCAGAAAATCAGT
TGAAGAACATGCAAAATGAGCTAGTTGAAGCCCAAGATATTGCAAATATC
ACAAGAACAGCCAATGATGATCAAGTGAGCCAATTTGAAGAACGAATCAA
AGACCTTACGAAACAAGTGAATTTATTGCGCAAGAAAGGTGGCAAATTGT
CTGGAGATCAATTTAAAGAACTCGATAATCAAGAACATGATTTGATGAAT
GAATCAGTTCAAGAATTGACAAATGAAGTCATAAAGCTGAAAGCGCACAA
CAAAATATTGCGGCAAACATGCGACAAATTGAAACAGGATGTCGACAAAG
TCATTTTAATTGAAGGAGAAAATGAGAGATTATCCGATGAGAAACGGAGA
TTGCAGCAGGCTATGGCGAGCACCGAGTTGAATTCCGAGCAGATCGACGA
CTTGCGAAAGCAAAACCTCCAATTGGCCATTGAAAACAAAAAGCTGCGGC
GAATGATCGACACGTTGCGATTCACATTGATGCAAGTCGACCCGTACAAC
AAGCAGAAATACACTTACATTTCCTCTATCTGATTCAATCCGATCTCTCG
CATTCCATTGGAGGACCGCGATTCATTGATCCGATTTCACTATATTCTTA
TCTGTGCACTCTAGCACCACTATTTAGCTATCGATTTTACTCTTATTATT
CTCCTCTTTGCTCCGGCTTTCTTTTTTTCATGTATTTCTGGCAGTTTTAC
TAGCTCTCTTCGTTATAATATTGTATTGCTATCAATTGTTGGCATTGTTG
CTGTGAATGAACTTGATGAACTTGGTGTCTGTGAATGTGCTATGATCGAT
TATTTCAGTGATGGCTGTGAACAGATCGATGACGATTATTTATTCAATAA
TATATAATATGTATATTGATTGATTTATTAGTTATTTCTCACGGATCATA
TGAAATAGATTACTCATTATTTATCAGCAACTATTTTTTATCGATTTGCA
AAAAATTTGGTTTTTGAATTGTTTTACAATTGCTAGTAAATTTAAACAAC
TTTTAACTCAAATTTACTGTTTTTTTATTACTGGTC
back to top

protein sequence of SMED30004840-orf-1

>SMED30004840-orf-1 ID=SMED30004840-orf-1|Name=SMED30004840-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=655bp
MKSVYEDSDLLSEPLVKWLKTFKYEFKAAEFLNLSQLIGSDFLDNVMYLI
RFSKRKTPPETNVKLPCTIADRLHHLREVLKEILEFYQGNLKLVIMLPAP
NLVTISEAIRFEDCENDLKLLLLLILGCAAQCSLKDKFISRITELLDIED
QQYIEKYFHQLTNNSMTADNSSLDLDENILQMHHHVTQLTFERRLYFEKY
YDCFEKHSCDNVEEESGTLNPVPIFIQPIVPVTHGGQWELASPRKRMRGA
SDRNEEDVLVVRYRPRLKTEKSLDPVVPVMTPETLEKLKEADEKIKENED
MQQEVIRLKQQLAELDFHKKKLKELNNENSQLVADKQKLRDQLQVSRRKE
EDVIERLIDSQMKLDDTIAEREMDRQKINELMKNPSSNRSNKNQDEESEA
EQIDPKSGKNKRIQELEKEIESLRTRLMEAQKQDNQKDEKWKMLDLQKEK
VDARRQLNESLETNEALKRQLEKAENQLKNMQNELVEAQDIANITRTAND
DQVSQFEERIKDLTKQVNLLRKKGGKLSGDQFKELDNQEHDLMNESVQEL
TNEVIKLKAHNKILRQTCDKLKQDVDKVILIEGENERLSDEKRRLQQAMA
STELNSEQIDDLRKQNLQLAIENKKLRRMIDTLRFTLMQVDPYNKQKYTY
ISSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR008636Hook-like_fam
Vocabulary: biological process
TermDefinition
GO:0016477cell migration
GO:0032956regulation of actin cytoskeleton organization
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 406..440
NoneNo IPR availableCOILSCoilCoilcoord: 609..629
NoneNo IPR availableCOILSCoilCoilcoord: 443..491
NoneNo IPR availableCOILSCoilCoilcoord: 291..349
NoneNo IPR availableCOILSCoilCoilcoord: 547..567
NoneNo IPR availableCOILSCoilCoilcoord: 578..605
NoneNo IPR availableCOILSCoilCoilcoord: 503..523
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 378..412
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 390..412
NoneNo IPR availablePANTHERPTHR18947HOOK PROTEINScoord: 12..218
NoneNo IPR availablePANTHERPTHR18947:SF28GIRDIN, ISOFORM Acoord: 12..218
NoneNo IPR availableSUPERFAMILYSSF116907Hook domaincoord: 7..164
IPR008636Hook-like protein familyPFAMPF05622HOOKcoord: 72..175
e-value: 4.6E-9
score: 35.0
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 9..165
e-value: 2.2E-20
score: 74.9