SMED30004813

Overview
NameSMED30004813
Smed IDSMED30004813
Uniprot Best hitDeath domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DTHD1 PE=2 SV=3 (E=6.51945e-07)
Length (bp)1624
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30004813 (SMED30004813) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30004813 (SMED30004813) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30004813 (SMED30004813) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30004813 (SMED30004813) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004813

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30004813SMESG000048822.1 SmedASXL_015937SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30004813SMESG000048822.1 dd_Smed_v6_15379_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30004813SMESG000048822.1 dd_Smed_v6_15379_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30004813SMESG000048822.1 dd_Smed_v6_15379_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30004813SMESG000048822.1 dd_Smed_v4_15379_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30004813SMESG000048822.1 dd_Smed_v4_15379_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30004813SMESG000048822.1 dd_Smed_v4_15379_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30004813 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000321:136869..141554 -7996
Homology
BLAST of SMED30004813 vs. Ensembl Human
Match: DTHD1 (death domain containing 1 [Source:HGNC Symbol;Acc:HGNC:37261])

HSP 1 Score: 56.225 bits (134), Expect = 1.150e-7
Identity = 55/192 (28.65%), Postives = 86/192 (44.79%), Query Frame = 1
Query: 1006 DILSNIIRIE----------PVGLEVSFNAKLPWKISIPYSIIRSPNREVVI-FCKDESQQRYFELETQDILYEESREEGIKFAEASLPSPNC-LCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKPITLQLP 1545
            +++SN+I IE          P+G+ + F A+            R   R++++  C    Q  Y    +      E  + G K   AS+      +  VVS  K E F + KK + ++S +D RISL  PP     P+ +Q  +QP++  L+  +K +  T     VQS SP+I I         KP+TL LP
Sbjct:   51 ELVSNVITIECSDKEKRVPFPIGIAIPFTARY-----------RGNYRDIMVKVCDINLQSSYLNPNSL-----EGMKGGYKGTCASVKVYKLGIFSVVSCLKKESFTVTKKGLALKSSMDSRISLNYPPGVFTSPVLVQLKIQPVDPALVAHLKAQQDT--FYSVQSTSPLIHIQHPSTYPFQKPVTLFLP 224          
BLAST of SMED30004813 vs. Ensembl Human
Match: DTHD1 (death domain containing 1 [Source:HGNC Symbol;Acc:HGNC:37261])

HSP 1 Score: 56.225 bits (134), Expect = 1.358e-7
Identity = 57/188 (30.32%), Postives = 88/188 (46.81%), Query Frame = 1
Query:  991 LGYYYDILSNIIRIEPVGLEVSFNAKLPWKISIPYSI-IRSPNREVVI-FCKDESQQRYFELETQDILYEESREEGIKFAEASLPSPNC-LCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKPITLQLP 1545
            +G   +++SN+I IE    E       P  I+IP++   R   R++++  C    Q  Y    +      E  + G K   AS+      +  VVS  K E F + KK + ++S +D RISL  PP     P+ +Q  +QP++  L+  +K +  T     VQS SP+I I         KP+TL LP
Sbjct:  211 VGDNEELVSNVITIECSDKEK--RVPFPIGIAIPFTARYRGNYRDIMVKVCDINLQSSYLNPNSL-----EGMKGGYKGTCASVKVYKLGIFSVVSCLKKESFTVTKKGLALKSSMDSRISLNYPPGVFTSPVLVQLKIQPVDPALVAHLKAQQDT--FYSVQSTSPLIHIQHPSTYPFQKPVTLFLP 389          
BLAST of SMED30004813 vs. Ensembl Human
Match: DTHD1 (death domain containing 1 [Source:HGNC Symbol;Acc:HGNC:37261])

HSP 1 Score: 55.8398 bits (133), Expect = 1.614e-7
Identity = 57/188 (30.32%), Postives = 88/188 (46.81%), Query Frame = 1
Query:  991 LGYYYDILSNIIRIEPVGLEVSFNAKLPWKISIPYSI-IRSPNREVVI-FCKDESQQRYFELETQDILYEESREEGIKFAEASLPSPNC-LCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKPITLQLP 1545
            +G   +++SN+I IE    E       P  I+IP++   R   R++++  C    Q  Y    +      E  + G K   AS+      +  VVS  K E F + KK + ++S +D RISL  PP     P+ +Q  +QP++  L+  +K +  T     VQS SP+I I         KP+TL LP
Sbjct:  251 VGDNEELVSNVITIECSDKEK--RVPFPIGIAIPFTARYRGNYRDIMVKVCDINLQSSYLNPNSL-----EGMKGGYKGTCASVKVYKLGIFSVVSCLKKESFTVTKKGLALKSSMDSRISLNYPPGVFTSPVLVQLKIQPVDPALVAHLKAQQDT--FYSVQSTSPLIHIQHPSTYPFQKPVTLFLP 429          
BLAST of SMED30004813 vs. Ensembl Human
Match: DTHD1 (death domain containing 1 [Source:HGNC Symbol;Acc:HGNC:37261])

HSP 1 Score: 55.8398 bits (133), Expect = 1.913e-7
Identity = 57/188 (30.32%), Postives = 88/188 (46.81%), Query Frame = 1
Query:  991 LGYYYDILSNIIRIEPVGLEVSFNAKLPWKISIPYSI-IRSPNREVVI-FCKDESQQRYFELETQDILYEESREEGIKFAEASLPSPNC-LCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKPITLQLP 1545
            +G   +++SN+I IE    E       P  I+IP++   R   R++++  C    Q  Y    +      E  + G K   AS+      +  VVS  K E F + KK + ++S +D RISL  PP     P+ +Q  +QP++  L+  +K +  T     VQS SP+I I         KP+TL LP
Sbjct:  336 VGDNEELVSNVITIECSDKEK--RVPFPIGIAIPFTARYRGNYRDIMVKVCDINLQSSYLNPNSL-----EGMKGGYKGTCASVKVYKLGIFSVVSCLKKESFTVTKKGLALKSSMDSRISLNYPPGVFTSPVLVQLKIQPVDPALVAHLKAQQDT--FYSVQSTSPLIHIQHPSTYPFQKPVTLFLP 514          
BLAST of SMED30004813 vs. Ensembl Zebrafish
Match: dthd1 (death domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-140106-180])

HSP 1 Score: 51.2174 bits (121), Expect = 2.829e-6
Identity = 55/234 (23.50%), Postives = 106/234 (45.30%), Query Frame = 1
Query:  871 RGGYFHETELVYMIQAFKDTLDQCYDVSVTLDKLEDISDGLGYYY-----DILSNIIRIEPVGLEVSFNAKLPWKISIPYSI-IRSPNREVVIFCKDESQQ-RYFELETQDILYEESREEGIKFAEASLPSPNCLCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKPITLQLPIP 1551
            RGG     +L YM+ +         DV   +    ++ DGL         ++LS ++RI+            P  +++P+    R   RE+++   D  Q+  Y    + +  +E  R     FA   + +      V+S+ + E F ++K  ++++  VD RI L   P S + P+  Q +VQP+++ +++   LK K        + +P++ ++     KL +P+T+ LP P
Sbjct:  140 RGGSSKSPKLCYMMAS--------ADVVSVMSC--EVVDGLSSLMVSGSEELLSAVLRIQTYS---HVKCPFPLTVAVPFQANYRGNYREIIVKVVDPGQRVSYVTPLSTEGFFEGQRGS---FAVVRVYTLGVF-AVLSRLRTESFTVSKAGLSLKLSVDSRICLDYLPGSFITPVVAQVMVQPVDAFILSS--LKSKNDSYREALTSTPLLYLSHPSSLKLRRPLTISLPCP 354          
BLAST of SMED30004813 vs. Ensembl Xenopus
Match: skiv2l (Ski2 like RNA helicase [Source:Xenbase;Acc:XB-GENE-486233])

HSP 1 Score: 62.003 bits (149), Expect = 1.421e-9
Identity = 56/184 (30.43%), Postives = 91/184 (49.46%), Query Frame = 1
Query: 1006 DILSNIIRIEPVGLEVSFNAKLPWKISIPYSI-IRSPNREVVI-FCKDESQQRYFELETQDILYEESREEGIKFAEASLPSPNCLCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKPITLQLPIP 1551
            +++SNI+ I  + L+       P  ISIP+S   R   ++V++  C +     Y    + D  +   +     FAE  +       VV   +K E F I KK ++I+  +D RISL  PP      + +QF VQPI++ +I+   LK+K  V + V S SP++ +     +   KP+T+ LP P
Sbjct:   68 ELVSNILGI--LSLDSDLTIPFPLSISIPFSSRYRGNYKDVMVKACDENLHPSYLTPHSLDGYHGNYKGT---FAEVKIYKLGIFSVVSCLKK-ENFTILKKGLSIKLGIDPRISLNYPPGCFRSSVIVQFKVQPIDTSIIS--LLKVKHDVYHSVVSTSPMVHVKQPSVQLFRKPVTVFLPCP 243          
BLAST of SMED30004813 vs. Ensembl Xenopus
Match: nt5c1b (5'-nucleotidase, cytosolic IB [Source:Xenbase;Acc:XB-GENE-1009625])

HSP 1 Score: 59.3066 bits (142), Expect = 9.546e-9
Identity = 59/183 (32.24%), Postives = 92/183 (50.27%), Query Frame = 1
Query: 1006 DILSNIIRIEPVGLEVSFNAKLPWKISIPYSI-IRSPNREVVIFCKDESQQRYFELETQDILYEESREEGIKFAEASLPSPNCLCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKPITLQLPIP 1551
            +++SNI+ I  + L+       P  ISIP+S   R   ++V++   DE+   Y    T   L   +   G  FAE  +       VV   +K E F I KK ++I+  +D RISL  PP      + +QF VQPI++ +I+   LK+K  V + V S SP++ +     +   KP+T+ LP P
Sbjct:   65 ELVSNILGI--LSLDSDLTIPFPLSISIPFSSRYRGNYKDVMVKACDEN--LYPSYLTPHSLDGGNYILG-TFAEVKIYKLGIFSVVSCLKK-ENFTILKKGLSIKLGIDPRISLNYPPGGFRSSVIVQFKVQPIDTSIIS--LLKVKHDVYHSVVSTSPMVHVKQPSVQLFRKPVTVFLPCP 239          
BLAST of SMED30004813 vs. UniProt
Match: sp|Q6ZMT9|DTHD1_HUMAN (Death domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DTHD1 PE=2 SV=3)

HSP 1 Score: 56.225 bits (134), Expect = 6.519e-7
Identity = 57/188 (30.32%), Postives = 88/188 (46.81%), Query Frame = 1
Query:  991 LGYYYDILSNIIRIEPVGLEVSFNAKLPWKISIPYSI-IRSPNREVVI-FCKDESQQRYFELETQDILYEESREEGIKFAEASLPSPNC-LCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKPITLQLP 1545
            +G   +++SN+I IE    E       P  I+IP++   R   R++++  C    Q  Y    +      E  + G K   AS+      +  VVS  K E F + KK + ++S +D RISL  PP     P+ +Q  +QP++  L+  +K +  T     VQS SP+I I         KP+TL LP
Sbjct:  211 VGDNEELVSNVITIECSDKEK--RVPFPIGIAIPFTARYRGNYRDIMVKVCDINLQSSYLNPNSL-----EGMKGGYKGTCASVKVYKLGIFSVVSCLKKESFTVTKKGLALKSSMDSRISLNYPPGVFTSPVLVQLKIQPVDPALVAHLKAQQDT--FYSVQSTSPLIHIQHPSTYPFQKPVTLFLP 389          
BLAST of SMED30004813 vs. TrEMBL
Match: gnl|BL_ORD_ID|15740614 (tr|R7UT39|R7UT39_CAPTE Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_221873 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.587e-14
Identity = 71/252 (28.17%), Postives = 131/252 (51.98%), Query Frame = 1
Query:  835 NPENWSRFRYSLRGGYFHETELVYMIQAFKDTLDQCYDVSV-TLDKLEDISDGLGYYYDILSNIIRIEPVGLEVSFNAKLPWKISIPYSIIRS-PNREVVIFCKDESQQRYFELETQDILYEESREEGIKFAEASLPSPNCLCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPII--EINSELERKLLKPITLQLPIPFPTGYVPNK 1578
            NP NW  F YS+  G      +  +++  ++   +  D++V  LD+L  I   L    +++ NII++     +++FN + P  I+IP+   R+  +RE V+    E    + EL T+++  ++ +E   KF E  LP+PN    VV++ + E F I K+   + S VD R+  +   S+      +   VQ I+S  ++++K++    V + + + SPI+  EI+++   K  KP T+ LP+P P  + P +
Sbjct:  299 NPNNWPSFVYSVEAGPIG-IPIGCVVRVMEEGCSR-GDINVEQLDQLTGIVQ-LDGVEELVGNIIQLTQTDPKMTFNLEEPLAIAIPHCAPRNVASREPVVKSLQEDGT-WTELPTREVTIDDMKE--YKFVEVRLPNPNATLTVVTRTRRETFTIQKRGGKVNSSVDSRVCFSFKQSTFRTSSDITLEVQTIDSATVHDLKVR-HADVCDNLLTTSPILCCEISNQ---KTYKPFTMSLPVP-PNPHKPRR 539          
BLAST of SMED30004813 vs. TrEMBL
Match: gnl|BL_ORD_ID|23842114 (tr|V3ZPR4|V3ZPR4_LOTGI Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_232757 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 9.051e-14
Identity = 71/262 (27.10%), Postives = 136/262 (51.91%), Query Frame = 1
Query:  835 NPENWSRFRYSLRGGYFHETELVYMIQAFKDTLDQCYDVSVTLDKLEDISDGLGYYYD--ILSNIIRIEPVGLEVSFNAKLPWKISIPYSIIRSP-NREVVIFCKDESQQRYFELETQDILYEESREEGIKFAEASLPSPNCLCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKPITLQLPIPFPTGYVPNKNRIFSAAPSTT 1611
            NP NW R+ YS+    F+   +  +I++ K +LD+     + +++++ I+ G   + +  ++SNII ++ +  + +   + P  I +P+   RS   RE V+ C D++   + EL+T D+++++ ++  ++F EA +       VVV + K E+F   KK     S VD R +LT  P +    + +   +QP++S  ++E++ +    +   + + + II +  +   +L KPIT+ LP P      PN  RI    PST 
Sbjct:  715 NPNNWPRYIYSIESEDFNPG-IGCIIRSIKGSLDR---DDIEVNRIDQITGGYQIHENEELISNIIVVKQM-TDKNLEFEEPLSIVMPHCAPRSTTGREPVMKCYDDTAANWVELQTNDVMFDDIKD--LRFVEARVTKLGKF-VVVYRLKKEQFTFTKKGGKQSSTVDSRFTLTTKPGAFRYNLGVSTEIQPVDSNTVSELRQR-DNEICGALLASTSIITMTWKQNTRLSKPITITLPCP------PNPARI--KRPSTA 959          
BLAST of SMED30004813 vs. TrEMBL
Match: gnl|BL_ORD_ID|23487852 (tr|A0A210QUR4|A0A210QUR4_MIZYE Death domain-containing protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT06862 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 4.092e-12
Identity = 78/270 (28.89%), Postives = 133/270 (49.26%), Query Frame = 1
Query:  820 ENDFSNPENWSRFRYSLRGGYFHETELVYMIQAFKDTLDQCYDVSVTLDKLEDISDGLGYYYDILSNIIRIEPVGLEVSFNAKLPWKISIPYSIIRS-PNREVVIFCKDESQQRYFELETQDILYEESREEGIKFAEASLPSPNCLCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNG-VQSVSPIIEINSELERKLLKPITLQLPIPFPTGYVPNKNRIFSAAPSTTEKND 1623
            E +  NP+NW R  YS  GG F +  +  +++A  + L +     V +D++  +   L    +++SNII+I P   E  F  + P  ++IP+ + R+   REVV+  +  +  ++ EL T+D ++E+ +E  ++F EA         VV+  +K +     +K   + + VD R+S T PP            VQ I+   I    LK K PV  G + + SPI++ + +  RK  K +T+ LPIP      P + +  S A ++  K D
Sbjct:  920 EAERRNPKNWRRLVYSADGGDF-DPGVGCILRAIDNCLGRDDVNVVRVDQMSGVL-TLVDNEELISNIIKITPTDAERRFTFEEPVALAIPHCLPRAVAGREVVVKTR-SANGKWVELPTKDAVFEDMKE--MRFGEAQTRRFGVFAVVLRLKK-DTLTFVRKGNKVHTAVDARVSFTSPPGMFKTNTNFTVEVQQIDQTAI--ASLKHKHPVECGNLMACSPIMKFSIQ-NRKFNKTLTMTLPIP----QNPTRPKRPSTAVASAPKED 1176          
BLAST of SMED30004813 vs. TrEMBL
Match: gnl|BL_ORD_ID|20310036 (tr|A0A1S3HDZ3|A0A1S3HDZ3_LINUN death domain-containing protein 1 OS=Lingula unguis OX=7574 GN=LOC106153746 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 6.679e-10
Identity = 70/266 (26.32%), Postives = 126/266 (47.37%), Query Frame = 1
Query:  835 NPENWSRFRYSLRGGYFH-ETELVYMIQAFKDTLDQCYDVSVTLDKLEDISDGL--GYYYDILSNIIRIEPVGLEVSFNAKLPWKISIPYSIIRSPNREVVIFCKDESQQRYFELETQDILYEESREEGIKFAEASLPSPNCLCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLK---TPVLNGVQSVSPIIEINSELERKLLKPITLQLPIPFPTGYVPNKNRIFSAAPSTTE 1614
            +P NW  F Y         +  ++ ++++   T+D   + S+   KL  +   L      +++SNI+ I P   +V F  + P  ++IP+   +  +RE+ +   +  + ++ EL +Q+I+ ++ RE   KF +  L +      VV++ K++R   NKK   + S VD R+ L   P ++         VQP++S  I+E+K++L     P+L    + SPI+        K  KPI + +P P P    P   R  +A P   E
Sbjct:  305 DPNNWPLFTYRYNEEQIDFDLGIMAVVRSMPWTMDPDDEESLQCKKLNQLDSTLTIAENEELVSNIVEIVPSSEKVVFKFEEPLAVAIPHCAQKVSSRELAVKYLETGKDKWRELPSQEIILQDLRE--AKFVQCRLKTFGQF-AVVTRLKLDRLVPNKKDGKMSSTVDQRLVLHCRPGTVPSTATFGLQVQPVDSFAISELKVRLSEDCGPLL----TCSPIVRFQCSTS-KFKKPIQVTIPCP-PN---PKAKRPQTARPKEKE 558          
BLAST of SMED30004813 vs. TrEMBL
Match: gnl|BL_ORD_ID|23897683 (tr|K1S6Z0|K1S6Z0_CRAGI Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10027320 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.244e-8
Identity = 76/272 (27.94%), Postives = 128/272 (47.06%), Query Frame = 1
Query:  820 ENDFSNPENWSRFRYSLRGGYFHETELVYMIQAFKDTLDQCYDVSV-TLDKLEDISDGLGYYYDILSNIIRIEPVGLEVSFNAKLPWKISIPYSIIRS-PNREVVIFCKDESQQRYFELETQDILYEESREEGIKFAEASLPSPNCLCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKPITLQLPIPFPTGYVPNKN---RIFSAAPSTTEKN 1620
            E +  NP+NW R+ YS+            +I+A + ++ +  DV+V  +D+L  +   L    +++SNI+ I P   E  F  + P  ++IP+ + R+ P RE VI  + +   ++ EL T DI+ E+ RE  +KF E  +       +V+  +K +     ++   + S VD RIS T  P  +   +     VQ ++   + E+  +  T     + S SPI+       RK  KP+T  LP+P      PN     R  S AP +  K+
Sbjct:  830 EAERKNPKNWPRYIYSVDSSTIEAGVPGCVIRAIEGSMKR-DDVTVKAVDQLSGVL-TLVENEELVSNIVSITPSDPERKFQFEEPVSVAIPHCLQRNIPGREPVIK-QLQPTGKWAELPTNDIVIEDMRE--MKFVEIRVKRFGVFAIVLRIKK-DTLTFLRRGNKVNSSVDARISFTCKPGMVKNNVCFTSEVQALDVNTVTELNKRYPTEC-GSLLSSSPIVRFQI-PNRKFAKPLTFTLPLP------PNSTKLKRPQSVAPGSLNKD 1087          
BLAST of SMED30004813 vs. Ensembl Cavefish
Match: dthd1 (death domain containing 1 [Source:NCBI gene;Acc:103040305])

HSP 1 Score: 51.2174 bits (121), Expect = 2.479e-6
Identity = 56/199 (28.14%), Postives = 95/199 (47.74%), Query Frame = 1
Query:  979 ISDGLGYYY-----DILSNIIRIEPVGLEVSFNAKL-PWKISIPY-SIIRSPNREVVIFCKDESQQ-RYFELETQDILYEESREEGIKFAEASLPSPNCLCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKPITLQLPIP 1551
            + DGL         +++S+++RIE   +  S  + L P  I++P+ +  R   REV +   D+ Q+  Y      +  YE  R     FA   + +      VVS+ + E F I K+ I+++  VD RI L   P S   P+  Q +VQP+++ L+N   LK        + + SP++ +N        +P+T+ LP P
Sbjct:  246 VVDGLSSLMVSGSEELVSSVLRIE---IPSSTKSPLFPLSIAMPFRASYRGNYREVTVKVVDQEQRVSYVSPIATESSYEGHRGS---FAVVRVYTLGVF-AVVSRLQRETFTIPKRGISVKLTVDPRICLDYSPGSFTTPVVAQAMVQPVDAILLNS--LKSWNDSYRSILTTSPLLYLNHPSTLSFRRPVTITLPCP 435          
BLAST of SMED30004813 vs. Ensembl Cavefish
Match: dthd1 (death domain containing 1 [Source:NCBI gene;Acc:103040305])

HSP 1 Score: 51.2174 bits (121), Expect = 2.704e-6
Identity = 56/199 (28.14%), Postives = 95/199 (47.74%), Query Frame = 1
Query:  979 ISDGLGYYY-----DILSNIIRIEPVGLEVSFNAKL-PWKISIPY-SIIRSPNREVVIFCKDESQQ-RYFELETQDILYEESREEGIKFAEASLPSPNCLCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKPITLQLPIP 1551
            + DGL         +++S+++RIE   +  S  + L P  I++P+ +  R   REV +   D+ Q+  Y      +  YE  R     FA   + +      VVS+ + E F I K+ I+++  VD RI L   P S   P+  Q +VQP+++ L+N   LK        + + SP++ +N        +P+T+ LP P
Sbjct:  333 VVDGLSSLMVSGSEELVSSVLRIE---IPSSTKSPLFPLSIAMPFRASYRGNYREVTVKVVDQEQRVSYVSPIATESSYEGHRGS---FAVVRVYTLGVF-AVVSRLQRETFTIPKRGISVKLTVDPRICLDYSPGSFTTPVVAQAMVQPVDAILLN--SLKSWNDSYRSILTTSPLLYLNHPSTLSFRRPVTITLPCP 522          
BLAST of SMED30004813 vs. Ensembl Cavefish
Match: dthd1 (death domain containing 1 [Source:NCBI gene;Acc:103040305])

HSP 1 Score: 50.8322 bits (120), Expect = 3.042e-6
Identity = 56/199 (28.14%), Postives = 95/199 (47.74%), Query Frame = 1
Query:  979 ISDGLGYYY-----DILSNIIRIEPVGLEVSFNAKL-PWKISIPY-SIIRSPNREVVIFCKDESQQ-RYFELETQDILYEESREEGIKFAEASLPSPNCLCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKPITLQLPIP 1551
            + DGL         +++S+++RIE   +  S  + L P  I++P+ +  R   REV +   D+ Q+  Y      +  YE  R     FA   + +      VVS+ + E F I K+ I+++  VD RI L   P S   P+  Q +VQP+++ L+N   LK        + + SP++ +N        +P+T+ LP P
Sbjct:  170 VVDGLSSLMVSGSEELVSSVLRIE---IPSSTKSPLFPLSIAMPFRASYRGNYREVTVKVVDQEQRVSYVSPIATESSYEGHRGS---FAVVRVYTLGVF-AVVSRLQRETFTIPKRGISVKLTVDPRICLDYSPGSFTTPVVAQAMVQPVDAILLNS--LKSWNDSYRSILTTSPLLYLNHPSTLSFRRPVTITLPCP 359          
BLAST of SMED30004813 vs. Planmine SMEST
Match: SMESG000048822.1 (SMESG000048822.1)

HSP 1 Score: 957.207 bits (2473), Expect = 0.000e+0
Identity = 488/490 (99.59%), Postives = 488/490 (99.59%), Query Frame = 1
Query:  160 MEAIFDELTRILDSSINDADRFNGQDLLEFHTKGLQSNQLISENFFDLSKILESSCMKIKIIMDKLLDWNLLLKEKVDKYENDEEMDELRKCLSDE--DLTDEEKETVQHRISGKRSEIQKDFYTLIEKNLTFQGSLKDALLKIDEHSKKTQNAMNLIEEIRQRYREAGRIHKKREIMRNMKVEKEIEESLQGKSITESMIEVTQPEKFIPVVENFPIKFDFENDFSNPENWSRFRYSLRGGYFHETELVYMIQAFKDTLDQCYDVSVTLDKLEDISDGLGYYYDILSNIIRIEPVGLEVSFNAKLPWKISIPYSIIRSPNREVVIFCKDESQQRYFELETQDILYEESREEGIKFAEASLPSPNCLCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKPITLQLPIPFPTGYVPNKNRIFSAAPSTTEKND 1623
            MEAIFDELTRILDSSINDADRFNGQDLLEFHTKGLQSNQLISENFFDLSKILESSCMKIKIIMDKLLDWNLLLKEKVDKYENDEEMDELRKCLSDE  DLTDEEKETVQHRISGKRSEIQKDFYTLIEKNLTFQGSLKDALLKIDEHSKKTQNAMNLIEEIRQRYREAGRIHKKREIMRNMKVEKEIEESLQGKSITESMIEVTQPEKFIPVVENFPIKFDFENDFSNPENWSRFRYSLRGGYFHETELVYMIQAFKDTLDQCYDVSVTLDKLEDISDGLGYYYDILSNIIRIEPVGLEVSFNAKLPWKISIPYSIIRSPNREVVIFCKDESQQRYFELETQDILYEESREEGIKFAEASLPSPNCLCVVVSKRKVERFEINKKAITIESKVDDRISLTIPPSSIMIPIPMQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKPITLQLPIPFPTGYVPNKNRIFSAAPSTTEKND
Sbjct:    1 MEAIFDELTRILDSSINDADRFNGQDLLEFHTKGLQSNQLISENFFDLSKILESSCMKIKIIMDKLLDWNLLLKEKVDKYENDEEMDELRKCLSDEVIDLTDEEKETVQHRISGKRSEIQKDFYTLIEKNLTFQGSLKDALLKIDEHSKKTQNAMNLIEEIRQRYREAGRIHKKREIMRNMKVEKEIEESLQGKSITESMIEVTQPEKFIPVVENFPIKFDFENDFSNPENWSRFRYSLRGGYFHETELVYMIQAFKDTLDQCYDVSVTLDKLEDISDGLGYYYDILSNIIRIEPVGLEVSFNAKLPWKISIPYSIIRSPNREVVIFCKDESQQRYFELETQDILYEESREEGIKFAEASLPSPNCLCVVVSKRKVERFEINKKAITIESKVDDRISLTIPPSSIMIPIPMQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKPITLQLPIPFPTGYVPNKNRIFSAAPSTTEKND 490          
BLAST of SMED30004813 vs. Planmine SMEST
Match: SMESG000008533.1 (SMESG000008533.1)

HSP 1 Score: 93.9745 bits (232), Expect = 6.625e-20
Identity = 70/243 (28.81%), Postives = 125/243 (51.44%), Query Frame = 1
Query:  835 NPENWSRFRYSLRGGYFHETELVYMIQAFKDTLDQCYDVSVTLDKLEDISDGLGYYYDILSNIIRIEPVGLEVSFNAKL----PWKISIPYSIIRSPNREVVIFCKDESQQRYFELETQDILYEESREEGIKFAEASLPSPNCLCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKPITLQLPIP 1551
            N E++ +FRY L    F E  +   I+A    +    D++V L     I+       +I+SNII I+     +S N  L    P+ + +P+++ R+  RE  IF   E + R+  ++TQD+  E++   G ++ E+       +  VVS  K+E  + NK+  +  +  D R++ TIP  ++ + + M+      +S L+ EIK K K    + + S SP+++I  E  R+ LKP+++ LP+P
Sbjct:  219 NIEHFIKFRYDLANSEFGEQGIGCFIKALPGFMVSESDIAVELINPIKINYSFDGTEEIVSNIIHIKTT---LSENEDLKFDQPFSVILPHTMSRTQARETKIFRYFEDELRWTAVDTQDVTIEDNDTSGARYVESVFDELPMILTVVSIPKIEDLQYNKRGCSWSAAADSRVNFTIPQGAVKVNLSMKITTVAFDSSLVQEIKTKSKGTNADNIFSFSPLLKIEGE-NRRFLKPVSISLPLP 457          
BLAST of SMED30004813 vs. Planmine SMEST
Match: SMESG000073578.1 (SMESG000073578.1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.434e-12
Identity = 59/244 (24.18%), Postives = 118/244 (48.36%), Query Frame = 1
Query:  817 FENDFSNPENWSRFRYSLRGGYFHETELVYMIQAFKDTLDQCYDVSVTLDKLEDISDGLGYYYDILSNIIRIEPVGLEVSFNAKLPWKISIPYSIIRSPNREVVIFCKDESQQRYFELETQDILYEESREEGIKFAEASLPSPNCLCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKPITLQLPI 1548
             +++ +NP+ W +  Y ++    ++  L  +I+A   ++ +  ++   L   E+    L    +  S I +I P+  E  F  + PW ++IPY  + +  +E +I  K+E   ++ E  T ++ ++  ++  + F E  +  PN +  VVS    +   I+K+   I    D  +S ++P  S+ I I     V  I++    EIK K    +L+ +   S IIEI ++ ++KL  P +L + +
Sbjct:  462 LDDEINNPKFWKKHYYYIKPPNLYDKTLACVIRAKPGSIVKKKNLKCELLNSEEEIPYLDKRENYASYIFKISPIDSEAQFQFETPWHLAIPYYPLLNKVKEPIIMIKNEELNKWMESPTSEVSFDNEKQNVLNFVETKIFKPNGIFAVVSSLCKDVIVISKEGNQITCISDRNVSFSVPQDSLKISITTCIQVVSIDNLFWKEIKEKHGKSLLDQINFTSSIIEIEAK-KKKLTIPASLTMKL 704          
BLAST of SMED30004813 vs. Planmine SMEST
Match: SMESG000073578.1 (SMESG000073578.1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.494e-12
Identity = 59/244 (24.18%), Postives = 118/244 (48.36%), Query Frame = 1
Query:  817 FENDFSNPENWSRFRYSLRGGYFHETELVYMIQAFKDTLDQCYDVSVTLDKLEDISDGLGYYYDILSNIIRIEPVGLEVSFNAKLPWKISIPYSIIRSPNREVVIFCKDESQQRYFELETQDILYEESREEGIKFAEASLPSPNCLCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKPITLQLPI 1548
             +++ +NP+ W +  Y ++    ++  L  +I+A   ++ +  ++   L   E+    L    +  S I +I P+  E  F  + PW ++IPY  + +  +E +I  K+E   ++ E  T ++ ++  ++  + F E  +  PN +  VVS    +   I+K+   I    D  +S ++P  S+ I I     V  I++    EIK K    +L+ +   S IIEI ++ ++KL  P +L + +
Sbjct:  514 LDDEINNPKFWKKHYYYIKPPNLYDKTLACVIRAKPGSIVKKKNLKCELLNSEEEIPYLDKRENYASYIFKISPIDSEAQFQFETPWHLAIPYYPLLNKVKEPIIMIKNEELNKWMESPTSEVSFDNEKQNVLNFVETKIFKPNGIFAVVSSLCKDVIVISKEGNQITCISDRNVSFSVPQDSLKISITTCIQVVSIDNLFWKEIKEKHGKSLLDQINFTSSIIEIEAK-KKKLTIPASLTMKL 756          
BLAST of SMED30004813 vs. Planmine SMEST
Match: SMESG000031073.1 (SMESG000031073.1)

HSP 1 Score: 58.9214 bits (141), Expect = 8.728e-9
Identity = 58/254 (22.83%), Postives = 118/254 (46.46%), Query Frame = 1
Query:  793 ENFPIKFDFENDFSNPENWSRFRYSLRGGYFHETELVYMIQAFKDTLDQCYDVSVTLDKLEDISDGLGYYYDILSNIIRIEPVGLEVSFNAKLPWKISIPYSIIRSPNREVVIFCKDESQQRYFELETQDILYEESREEGIKFAEASLPSPNCLCVVVSKRKVERFEINKKAITIESKVDDRISLTXXXXXXXXXXXXQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINSELERKLLKP--ITLQLPI 1548
            E+F I  D  N+F     W  + Y ++    +  ++  +++A    + +  +   +      I   +    D  S  I I+P      FN + PWK+ +P+ + ++  ++ VI    +    + E+ T +I+ ++ +E  ++F E  L   + + +V +K + +   INK    I S +D R+ +++P  +I I +     +  ++S    E+K K     L  V   S +I   S+ ++KL+KP  I+  LP+
Sbjct: 2763 EDFTIPLDDPNNF---RYWPTYIYWVKPENSYSKKMGCILKAKPGGIGRHTNFECSSIYSSRILPNIDLQEDAASIPIEIKPTDPSQEFNFENPWKLILPHILPKNSPKDPVILMLSDDDTGWIEMPTSEIILDDLKEHKLRFVETKLEKRSGIFIVQTKNRTDNGIINKHGARIASSMDSRVFVSVPAGAIRITLNTTLKINTVDSSFWKELKGKFDKSPLEQVICSSHLIAFTSK-KKKLIKPAIISCHLPL 3012          
The following BLAST results are available for this feature:
BLAST of SMED30004813 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
DTHD11.150e-728.65death domain containing 1 [Source:HGNC Symbol;Acc:... [more]
DTHD11.358e-730.32death domain containing 1 [Source:HGNC Symbol;Acc:... [more]
DTHD11.614e-730.32death domain containing 1 [Source:HGNC Symbol;Acc:... [more]
DTHD11.913e-730.32death domain containing 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of SMED30004813 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004813 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004813 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dthd12.829e-623.50death domain containing 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of SMED30004813 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
skiv2l1.421e-930.43Ski2 like RNA helicase [Source:Xenbase;Acc:XB-GENE... [more]
nt5c1b9.546e-932.245'-nucleotidase, cytosolic IB [Source:Xenbase;Acc:... [more]
back to top
BLAST of SMED30004813 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004813 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q6ZMT9|DTHD1_HUMAN6.519e-730.32Death domain-containing protein 1 OS=Homo sapiens ... [more]
back to top
BLAST of SMED30004813 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|157406141.587e-1428.17tr|R7UT39|R7UT39_CAPTE Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|238421149.051e-1427.10tr|V3ZPR4|V3ZPR4_LOTGI Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|234878524.092e-1228.89tr|A0A210QUR4|A0A210QUR4_MIZYE Death domain-contai... [more]
gnl|BL_ORD_ID|203100366.679e-1026.32tr|A0A1S3HDZ3|A0A1S3HDZ3_LINUN death domain-contai... [more]
gnl|BL_ORD_ID|238976832.244e-827.94tr|K1S6Z0|K1S6Z0_CRAGI Uncharacterized protein OS=... [more]
back to top
BLAST of SMED30004813 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dthd12.479e-628.14death domain containing 1 [Source:NCBI gene;Acc:10... [more]
dthd12.704e-628.14death domain containing 1 [Source:NCBI gene;Acc:10... [more]
dthd13.042e-628.14death domain containing 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of SMED30004813 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004813 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004813 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004813 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004813 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048822.10.000e+099.59SMESG000048822.1[more]
SMESG000008533.16.625e-2028.81SMESG000008533.1[more]
SMESG000073578.11.434e-1224.18SMESG000073578.1[more]
SMESG000073578.11.494e-1224.18SMESG000073578.1[more]
SMESG000031073.18.728e-922.83SMESG000031073.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004813 ID=SMED30004813|Name=SMED30004813|organism=Schmidtea mediterranea sexual|type=transcript|length=1624bp
CATAATTATAATTTTCATCAGCATTCTCAACACAACCTGAAAACCATAAC
AATAGCAAACGCACGCGGACAATCAAGCGGACACACAGATTCCATTAATT
ATTACATTCTTATAATTGTTTTCTGTTTTACTATTTTATTTCTTATTTTC
TCTCTAAAAATGGAAGCGATTTTTGATGAATTGACAAGAATTTTGGACTC
ATCAATAAATGATGCAGATCGTTTCAATGGCCAGGATCTCTTGGAGTTCC
ATACCAAAGGTCTCCAATCCAACCAACTGATCTCCGAGAATTTCTTCGAT
CTCTCTAAAATTCTCGAATCTAGCTGCATGAAAATCAAAATAATAATGGA
CAAGCTTTTGGATTGGAATTTACTGTTGAAAGAGAAGGTGGATAAATATG
AAAATGATGAAGAAATGGACGAATTAAGGAAATGTTTATCTGATGAAGAT
CTCACCGACGAAGAGAAGGAAACAGTCCAGCATCGGATTTCAGGAAAACG
ATCGGAAATACAAAAGGATTTCTATACTTTAATCGAGAAAAACTTAACCT
TTCAAGGATCACTGAAAGACGCGCTACTGAAAATTGACGAACATTCCAAG
AAGACGCAAAATGCAATGAATTTAATTGAAGAAATCAGACAGCGCTATCG
TGAAGCCGGGAGGATCCATAAAAAGAGAGAAATAATGAGAAATATGAAAG
TTGAGAAGGAAATCGAAGAAAGTCTCCAAGGAAAGTCAATAACTGAAAGT
ATGATCGAGGTCACACAACCAGAAAAATTTATTCCAGTTGTGGAAAACTT
TCCAATAAAATTTGACTTTGAAAACGATTTCTCAAATCCAGAGAACTGGA
GCCGATTCCGATATTCTTTGCGGGGTGGGTATTTCCATGAGACAGAATTG
GTTTACATGATTCAAGCATTCAAGGACACCTTGGACCAATGTTACGACGT
GTCGGTGACTCTAGACAAACTCGAAGATATTTCAGATGGTCTTGGATATT
ATTATGACATCCTCAGTAACATCATTCGGATTGAGCCTGTCGGATTGGAG
GTCTCATTCAATGCCAAGCTCCCATGGAAAATTTCAATACCTTATTCGAT
CATCAGGAGTCCTAATAGAGAAGTGGTAATATTTTGTAAAGATGAAAGCC
AACAGCGATACTTCGAGCTTGAGACACAAGATATTCTATACGAGGAAAGT
AGAGAGGAAGGGATAAAATTTGCTGAAGCCTCATTACCATCACCAAATTG
TTTATGCGTTGTTGTAAGCAAACGGAAGGTGGAAAGATTTGAAATTAATA
AAAAGGCGATTACAATTGAAAGCAAGGTCGACGACAGGATTTCTCTAACC
ATCCCACCATCATCAATCATGATCCCGATCCCTATGCAATTTGTCGTTCA
ACCGATAGAAAGCGGGTTGATAAATGAAATAAAACTCAAGTTAAAAACCC
CTGTATTAAATGGCGTCCAGTCAGTCAGTCCGATAATAGAAATAAATTCT
GAATTGGAACGGAAATTATTGAAGCCGATAACATTGCAATTGCCTATACC
CTTTCCAACAGGCTACGTACCGAATAAAAACAGGATATTTTCGGCAGCAC
CCTCTACAACAGAAAAGAATGACC
back to top

protein sequence of SMED30004813-orf-1

>SMED30004813-orf-1 ID=SMED30004813-orf-1|Name=SMED30004813-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=541bp
HNYNFHQHSQHNLKTITIANARGQSSGHTDSINYYILIIVFCFTILFLIF
SLKMEAIFDELTRILDSSINDADRFNGQDLLEFHTKGLQSNQLISENFFD
LSKILESSCMKIKIIMDKLLDWNLLLKEKVDKYENDEEMDELRKCLSDED
LTDEEKETVQHRISGKRSEIQKDFYTLIEKNLTFQGSLKDALLKIDEHSK
KTQNAMNLIEEIRQRYREAGRIHKKREIMRNMKVEKEIEESLQGKSITES
MIEVTQPEKFIPVVENFPIKFDFENDFSNPENWSRFRYSLRGGYFHETEL
VYMIQAFKDTLDQCYDVSVTLDKLEDISDGLGYYYDILSNIIRIEPVGLE
VSFNAKLPWKISIPYSIIRSPNREVVIFCKDESQQRYFELETQDILYEES
REEGIKFAEASLPSPNCLCVVVSKRKVERFEINKKAITIESKVDDRISLT
IPPSSIMIPIPMQFVVQPIESGLINEIKLKLKTPVLNGVQSVSPIIEINS
ELERKLLKPITLQLPIPFPTGYVPNKNRIFSAAPSTTEKND
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 195..215
NoneNo IPR availableGENE3DG3DSA:2.60.220.30coord: 422..534
e-value: 3.5E-11
score: 44.8
NoneNo IPR availableTMHMMTMhelixcoord: 32..51