TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30004809
Length (bp)1580
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30004809) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30004809) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30004809) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30004809) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004809

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30004809SMESG000038724.1 SmedASXL_019636SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30004809SMESG000038724.1 dd_Smed_v4_7950_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004809SMESG000038724.1 dd_Smed_v4_7950_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30004809SMESG000038724.1 dd_Smed_v6_7950_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004809SMESG000038724.1 dd_Smed_v6_7950_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 77.0258 bits (188), Expect = 2.128e-14
Identity = 45/114 (39.47%), Postives = 66/114 (57.89%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPT-STNIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            GYKM   +  NG   GKGTH+SL+F + +G++D +L W F+Q VTL L++Q +   H+    K +  PNS +F +PT   NI  G   F+  + L  N   I +D IFI+  V+
Sbjct:  368 GYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVD 478          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 76.6406 bits (187), Expect = 3.376e-14
Identity = 45/114 (39.47%), Postives = 66/114 (57.89%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPT-STNIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            GYKM   +  NG   GKGTH+SL+F + +G++D +L W F+Q VTL L++Q +   H+    K +  PNS +F +PT   NI  G   F+  + L  N   I +D IFI+  V+
Sbjct:  426 GYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVD 536          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 76.6406 bits (187), Expect = 3.376e-14
Identity = 45/114 (39.47%), Postives = 66/114 (57.89%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPT-STNIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            GYKM   +  NG   GKGTH+SL+F + +G++D +L W F+Q VTL L++Q +   H+    K +  PNS +F +PT   NI  G   F+  + L  N   I +D IFI+  V+
Sbjct:  426 GYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVD 536          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 76.6406 bits (187), Expect = 3.645e-14
Identity = 45/114 (39.47%), Postives = 66/114 (57.89%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPT-STNIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            GYKM   +  NG   GKGTH+SL+F + +G++D +L W F+Q VTL L++Q +   H+    K +  PNS +F +PT   NI  G   F+  + L  N   I +D IFI+  V+
Sbjct:  451 GYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVD 561          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 76.6406 bits (187), Expect = 3.645e-14
Identity = 45/114 (39.47%), Postives = 66/114 (57.89%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPT-STNIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            GYKM   +  NG   GKGTH+SL+F + +G++D +L W F+Q VTL L++Q +   H+    K +  PNS +F +PT   NI  G   F+  + L  N   I +D IFI+  V+
Sbjct:  451 GYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVD 561          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 62.3882 bits (150), Expect = 4.304e-13
Identity = 38/123 (30.89%), Postives = 62/123 (50.41%), Query Frame = 2
Query: 1208 ISHKNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTR---FAHVKYTAKVETF-PNSKAFIQPT-STNIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            +SH+ GYKM+   C  G  +  G  ISLY  L KG+FD  L+W F +++ +SL++Q  R     ++ Y         N K   +P    N  FG   F +L+ L    + + +D I+++  V+
Sbjct:  293 MSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCSLAIL---QNYVKDDKIYVQIDVD 412          

HSP 2 Score: 31.187 bits (69), Expect = 4.304e-13
Identity = 21/87 (24.14%), Postives = 44/87 (50.57%), Query Frame = 3
Query:  975 KESDQIKIIEEIKTNQAFNLENISNKIDGKMETVKKALLEFKINQMKI----------NGEELLWKIEKFSEKIADVKNGFNTEIYN 1205
            KES Q  + +E   +  +  + I++ + G  E +++ +  F   Q +I           G +L+WKI+K  ++  + K+G +T I++
Sbjct:  204 KESIQQHLSDEPVRHLMYLCDEITD-LKGTYELMERDMGSFNDRQTRILSAAETCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFS 289          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 65.4698 bits (158), Expect = 2.303e-11
Identity = 40/118 (33.90%), Postives = 62/118 (52.54%), Query Frame = 2
Query: 1211 SHKNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQ-PTSTNIG-FGFHQFMTLSELTSNSHLILNDNIFIRCKV 1558
            SH  GYKM+    P G       + S++ CL KG++D+IL+W FR  VT S+++   +    K T  V   P  + F++ P     G FGF  F+ L+++T       + +IFI+ KV
Sbjct:  190 SHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILSDDKKELLTK-TIYVNEMPEIQEFLERPEGLRNGTFGFQNFLPLAKVT---EFAADGDIFIQIKV 303          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 62.7734 bits (151), Expect = 4.011e-10
Identity = 35/115 (30.43%), Postives = 60/115 (52.17%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTST--NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            GYK+   +  NG   G+ TH+S+Y  +  G++D +L+W F  S+T +L  Q  +             P  + F +P++    +GFGF +F++  EL  +   I  D +F+R KV+
Sbjct:  357 GYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFIS-HELLHSRPFIKGDTVFLRVKVD 470          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 62.7734 bits (151), Expect = 4.086e-10
Identity = 35/115 (30.43%), Postives = 60/115 (52.17%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTST--NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            GYK+   +  NG   G+ TH+S+Y  +  G++D +L+W F  S+T +L  Q  +             P  + F +P++    +GFGF +F++  EL  +   I  D +F+R KV+
Sbjct:  366 GYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFIS-HELLHSRPFIKGDTVFLRVKVD 479          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.060e-16
Identity = 50/120 (41.67%), Postives = 71/120 (59.17%), Query Frame = 2
Query: 1217 KNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETF-PN--SKAFIQPTST-NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVNI 1564
            K GYKM L I  NG  TG+GTH+SL+F + +G  D +L+W F Q VTL L++Q  R  H+     ++ F P+  S +F +P S  NI  G   F  LS+L S +  I +D IFI+  V++
Sbjct:  159 KYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHI-----IDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDL 272          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.060e-16
Identity = 50/120 (41.67%), Postives = 71/120 (59.17%), Query Frame = 2
Query: 1217 KNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETF-PN--SKAFIQPTST-NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVNI 1564
            K GYKM L I  NG  TG+GTH+SL+F + +G  D +L+W F Q VTL L++Q  R  H+     ++ F P+  S +F +P S  NI  G   F  LS+L S +  I +D IFI+  V++
Sbjct:  159 KYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHI-----IDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDL 272          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf5 (Tnf receptor-associated factor 5 [Source:ZFIN;Acc:ZDB-GENE-071120-3])

HSP 1 Score: 78.9518 bits (193), Expect = 6.210e-16
Identity = 41/118 (34.75%), Postives = 74/118 (62.71%), Query Frame = 2
Query: 1217 KNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTS-TNIGFGFHQFMTLSELTS--NSHLILNDNIFIRCKVN 1561
            ++GYK+ +     G  +G+G+H+SLY  + +GDFD  L W FRQ++TL+L++Q     H+ +T   +   NS +F +PTS  N+  GF +F++  +L +  N+  + ++ +FI+ KV+
Sbjct:  139 RSGYKLSVRAYLGGDGSGRGSHMSLYITIMRGDFDSFLPWPFRQNITLTLLDQSGTRNHMSHTFIPDV--NSDSFHRPTSDANVATGFTRFISHCDLENPRNAVFVRDETLFIKVKVD 254          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 80.1073 bits (196), Expect = 1.761e-15
Identity = 46/119 (38.66%), Postives = 70/119 (58.82%), Query Frame = 2
Query: 1211 SHKNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTST-NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVNI 1564
            S K GYKM L +  NG  TG+G+H+SL+F + KG +D +L+W F Q VTL L++Q  R  H+    + +   +S +F +P S  NI  G   F  L++L   S  + +D IFI+  V++
Sbjct:  427 SSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNR-EHIIDAFRPDV--SSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVDL 542          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 80.1073 bits (196), Expect = 1.799e-15
Identity = 46/119 (38.66%), Postives = 70/119 (58.82%), Query Frame = 2
Query: 1211 SHKNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTST-NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVNI 1564
            S K GYKM L +  NG  TG+G+H+SL+F + KG +D +L+W F Q VTL L++Q  R  H+    + +   +S +F +P S  NI  G   F  L++L   S  + +D IFI+  V++
Sbjct:  414 SSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNR-EHIIDAFRPDV--SSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVDL 529          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 75.485 bits (184), Expect = 6.337e-14
Identity = 45/119 (37.82%), Postives = 70/119 (58.82%), Query Frame = 2
Query: 1211 SHKNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTST-NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVNI 1564
            ++K GYKM L I  NG  TG+ TH+SL+F + KG+ D +L+W F Q VTL L++Q  R  HV    + +   +S +F +P S  NI  G   F  +S+L   +  + +D IF++  V++
Sbjct:  336 TNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNR-EHVIDAFRPDV--SSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIVDL 451          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 75.485 bits (184), Expect = 6.949e-14
Identity = 45/119 (37.82%), Postives = 70/119 (58.82%), Query Frame = 2
Query: 1211 SHKNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTST-NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVNI 1564
            ++K GYKM L I  NG  TG+ TH+SL+F + KG+ D +L+W F Q VTL L++Q  R  HV    + +   +S +F +P S  NI  G   F  +S+L   +  + +D IF++  V++
Sbjct:  363 TNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNR-EHVIDAFRPDV--SSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIVDL 478          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 75.0998 bits (183), Expect = 9.421e-14
Identity = 43/117 (36.75%), Postives = 69/117 (58.97%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTST-NIGFGFHQFMTLSELTS--NSHLILNDNIFIRCKVNI 1564
            GY++      NG  +GKG+ +SLYF + KG+FD IL W F+Q VTL L++Q  +  H+    + +  PNS +F +P S  NI  G  +F + ++L +  N   I +D +FI+  V++
Sbjct:  368 GYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRAD--PNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVDL 482          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 75.0998 bits (183), Expect = 9.902e-14
Identity = 44/114 (38.60%), Postives = 65/114 (57.02%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPT-STNIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            GYKM   +  NG   GKGTH+SL+F + +G++D +L W F+Q V+L L++Q     H+    K +  PNS +F +PT   NI  G   F+  + L  N   I +D IFI+  V+
Sbjct:  419 GYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVD 529          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 75.0998 bits (183), Expect = 1.117e-13
Identity = 44/114 (38.60%), Postives = 65/114 (57.02%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPT-STNIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            GYKM   +  NG   GKGTH+SL+F + +G++D +L W F+Q V+L L++Q     H+    K +  PNS +F +PT   NI  G   F+  + L  N   I +D IFI+  V+
Sbjct:  444 GYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVD 554          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 85.5001 bits (210), Expect = 3.119e-18
Identity = 46/116 (39.66%), Postives = 71/116 (61.21%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPT-STNIGFGFHQFMTLSELT-SNSHLILNDNIFIRCKVNI 1564
            GY++      NG  +GKGTH+SLYF + +G+FD +LQW FRQ VTL L++Q  +  H+  T K +  PNS +F +P    NI  G  +F++ S L  S +  I +D +F++  V++
Sbjct:  131 GYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKAD--PNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 244          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 85.5001 bits (210), Expect = 3.119e-18
Identity = 46/116 (39.66%), Postives = 71/116 (61.21%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPT-STNIGFGFHQFMTLSELT-SNSHLILNDNIFIRCKVNI 1564
            GY++      NG  +GKGTH+SLYF + +G+FD +LQW FRQ VTL L++Q  +  H+  T K +  PNS +F +P    NI  G  +F++ S L  S +  I +D +F++  V++
Sbjct:  131 GYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKAD--PNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 244          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 84.3445 bits (207), Expect = 9.981e-17
Identity = 46/116 (39.66%), Postives = 71/116 (61.21%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPT-STNIGFGFHQFMTLSELT-SNSHLILNDNIFIRCKVNI 1564
            GY++      NG  +GKGTH+SLYF + +G+FD +LQW FRQ VTL L++Q  +  H+  T K +  PNS +F +P    NI  G  +F++ S L  S +  I +D +F++  V++
Sbjct:  433 GYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKAD--PNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 546          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 84.3445 bits (207), Expect = 9.981e-17
Identity = 46/116 (39.66%), Postives = 71/116 (61.21%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPT-STNIGFGFHQFMTLSELT-SNSHLILNDNIFIRCKVNI 1564
            GY++      NG  +GKGTH+SLYF + +G+FD +LQW FRQ VTL L++Q  +  H+  T K +  PNS +F +P    NI  G  +F++ S L  S +  I +D +F++  V++
Sbjct:  433 GYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKAD--PNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 546          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 77.0258 bits (188), Expect = 2.009e-14
Identity = 45/114 (39.47%), Postives = 66/114 (57.89%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPT-STNIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            GYKM   +  NG   GKGTH+SL+F + +G++D +L W F+Q VTL L++Q +   H+    K +  PNS +F +PT   NI  G   F+  + L  N   I +D IFI+  V+
Sbjct:  425 GYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVD 535          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 7.604e-16
Identity = 46/116 (39.66%), Postives = 71/116 (61.21%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPT-STNIGFGFHQFMTLSELT-SNSHLILNDNIFIRCKVNI 1564
            GY++      NG  +GKGTH+SLYF + +G+FD +LQW FRQ VTL L++Q  +  H+  T K +  PNS +F +P    NI  G  +F++ S L  S +  I +D +F++  V++
Sbjct:  439 GYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKAD--PNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 552          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 1.559e-13
Identity = 44/110 (40.00%), Postives = 64/110 (58.18%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPT-STNIGFGFHQFMTLSELTSNSHLILNDNIFIR 1549
            GYKM   +  NG   GKGTH+SL+F + +G++D +L W F+Q VTL L++Q +   H+    K +  PNS +F +PT   NI  G   F+  + L  N   I +D IFI+
Sbjct:  450 GYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIK 556          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 1.751e-13
Identity = 45/114 (39.47%), Postives = 66/114 (57.89%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPT-STNIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            GYKM   +  NG   GKGTH+SL+F + +G++D +L W F+Q VTL L++Q +   H+    K +  PNS +F +PT   NI  G   F+  + L  N   I +D IFI+  V+
Sbjct:  451 GYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVD 561          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.337e-13
Identity = 44/115 (38.26%), Postives = 66/115 (57.39%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTST-NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVNI 1564
            GYKM L +  NG  TG+GTH+SL+F + KG  D +LQW F Q VTL L++   R  HV    + +    S +F +P S  NI  G   F  +S++ + +  + +D IFI+  V++
Sbjct:  387 GYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNR-EHVIDAFRPDV--TSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDL 498          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 5.604e-13
Identity = 46/118 (38.98%), Postives = 70/118 (59.32%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETF-PN--SKAFIQPTST-NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVNI 1564
            GYKM L I  NG  TG+GTH+SL+F + KG  D +L+W F Q VTL L++Q  R  HV     ++ F P+  S +F +P +  NI  G   F  +S++ + +  + +D IFI+  V++
Sbjct:  387 GYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNR-EHV-----IDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDL 498          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A0F7GWW3 (TNF receptor associated factor 4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 6.442e-26
Identity = 56/112 (50.00%), Postives = 75/112 (66.96%), Query Frame = 3
Query:  348 EIKSQMPRKSCGFTDEMRKIENHIRIYNNLPIDCPYSNIGCVNNGISHDSLADHLQSEIFMHTKLLMYFVGNMNNEMNTLTAHNNELGTEIETLKTEMNGLKLNSDRKQINL 683
            +++ +   KSC + DE+RK+E+H R      + CPYSNIGC    IS D + DHLQSEIF+HTKLLM FV N NNEM  L A+NN L    E L+ E+N LKL+ DR+++ +
Sbjct:   28 KLQVKCKEKSCDYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEMLKANNNGLSPVNELLRNEINELKLDGDRRRVEI 139          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: H2YYB2 (MATH domain-containing protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 2.529e-16
Identity = 49/116 (42.24%), Postives = 69/116 (59.48%), Query Frame = 2
Query: 1217 KNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTST-NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            + GYKM   I PNG   GKGTH+SL+F + KG++D +L W FRQ VTL L++Q     H+  T + +  P S +F QPTS  NI  G   F+  S +  +S+ +  D I+IR  V+
Sbjct:   39 RYGYKMCARIYPNGDGMGKGTHMSLFFVVMKGEYDALLPWPFRQKVTLMLLDQGVDRRHLSDTFRPD--PTSSSFKQPTSDMNIASGCPLFVAHSVIKGSSY-VKEDTIYIRIHVD 151          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: C3ZG42 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_68997 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.386e-16
Identity = 52/120 (43.33%), Postives = 70/120 (58.33%), Query Frame = 2
Query: 1217 KNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETF---PNSKAFIQPTST-NIGFGFHQFMTLSELTSNSHL-ILNDNIFIRCKVN 1561
            + GYKM   I  NG   GKG+HISL+F L +G FD +L+W FRQ VT  L++Q  R  HV     ++ F   P S +F +PTS  NI  G   FM LS+L S  H  + +D IF++  V+
Sbjct:  364 RTGYKMCARIYLNGDGMGKGSHISLFFVLMRGHFDGLLRWPFRQKVTFMLLDQNNR-EHV-----IDAFRPDPTSSSFKRPTSDMNIASGCPLFMPLSQLESTRHAYVRDDAIFLKIIVD 477          

HSP 2 Score: 30.4166 bits (67), Expect = 3.386e-16
Identity = 13/33 (39.39%), Postives = 17/33 (51.52%), Query Frame = 3
Query: 1131 LLWKIEKFSEKIADVKNGFNTEIYNKSVIKTVT 1229
            LLWKI+ F+ K  D   G  T IY+     + T
Sbjct:  333 LLWKIQDFTRKRHDAITGKTTSIYSPCFYTSRT 365          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 1.052e-15
Identity = 33/116 (28.45%), Postives = 55/116 (47.41%), Query Frame = 3
Query:  351 IKSQMPRKSCGFTDEMRKIENHIRIYNNLPIDCPYSNIGCVNNGISHDSLADHLQSEIFMHTKLLMYFVGNMNNEMNTLTAHNNELGTE-IETLKTEMNGLKLNSDRKQINLNYFF 695
            I  + P   C +T E+ +++ H+       ++CP   IGC    +  D +A HL  ++  HT+L+M F   + +E+N    HNNE   E I  LK  +   K  +D K   + +  
Sbjct:   97 IVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEIN----HNNETTKEDISHLKEVLRVQKALNDEKTAQMEFLI 208          

HSP 2 Score: 56.225 bits (134), Expect = 1.052e-15
Identity = 21/59 (35.59%), Postives = 41/59 (69.49%), Query Frame = 1
Query:  193 TPCGCRFCFTCISEYLNKNTKFCPGNSEDCKNELISMNDNLAVDNGINIKISKLKVKCP 369
            + CGC +C+TCI  YL++N  +CPG+  +CK + +++  ++  +  ++ +IS++ VKCP
Sbjct:   44 SACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCP 102          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: C3ZHV2 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_89402 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.684e-15
Identity = 47/123 (38.21%), Postives = 70/123 (56.91%), Query Frame = 2
Query: 1208 ISHKNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQ-QTRFA--HVKYTAKVETFPNSKAFI-QPT-STNIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            +S K GYKM + ICPNG   GKG  +SL+ C+ KG+FD +L W F Q V +S+I+Q Q   A  +++Y  K  T  ++  F+ +P    N  FG   F  LS L    + I ++ +FI  +V+
Sbjct:  274 LSSKYGYKMAISICPNGDGQGKGKFMSLFMCIIKGEFDALLPWPFAQKVIISVIDQCQDPDARKNIEYVIKPNTCKDNLQFLGRPIHERNPSFGTQMFCPLSHLHRGDY-IRDNTMFISVQVD 395          

HSP 2 Score: 38.1206 bits (87), Expect = 1.684e-15
Identity = 15/32 (46.88%), Postives = 21/32 (65.62%), Query Frame = 3
Query: 1113 KINGEELLWKIEKFSEKIADVKNGFNTEIYNK 1208
            K NG +LLWKI  ++EK+AD K G    +Y+ 
Sbjct:  240 KANGCQLLWKITSYNEKLADAKAGRRVSLYSP 271          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 1.065e-16
Identity = 45/114 (39.47%), Postives = 65/114 (57.02%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPT-STNIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            GYKM   +  NG   GKGTH+SL+F + +G++D +L W F+Q VTL L++Q     H+    K +  PNS +F +PT   NI  G   F+  + L  N   I +D IFI+  V+
Sbjct:   39 GYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDAFKPD--PNSSSFRRPTGEMNIASGCPLFVAQTVL-ENGTYIKDDTIFIKVTVD 149          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 82.4185 bits (202), Expect = 2.742e-16
Identity = 45/117 (38.46%), Postives = 72/117 (61.54%), Query Frame = 2
Query: 1220 NGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTS-TNIGFGFHQFMTLSELTS--NSHLILNDNIFIRCKVN 1561
            +GYK+   +   G  T +GTH+SLY  L +GDFD +L W FRQ+VTL++++Q     HV  +   +   N+  F +PTS TN   GF +F+T ++L +  N+  + +D +FI+ KV+
Sbjct:  429 SGYKLSARVYLGGEGTARGTHLSLYVMLMRGDFDSLLPWPFRQNVTLAVLDQSGNRNHVSLSFTPDLASNN--FRRPTSETNAALGFPRFITHADLEAPRNAAYVRDDTLFIKVKVD 543          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 79.7221 bits (195), Expect = 1.598e-15
Identity = 48/117 (41.03%), Postives = 69/117 (58.97%), Query Frame = 2
Query: 1217 KNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTST-NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVNI 1564
            K GYKM L I  NG  TG+GTH+SL+F + +G  D +L+W F Q VTL L++Q  R  H+    + +   +S +F +P S  NI  G   F  LS+L S +  I +D IFI+  V++
Sbjct:  343 KYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHIIDAFRPDI--SSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDL 456          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 79.337 bits (194), Expect = 3.288e-15
Identity = 48/117 (41.03%), Postives = 69/117 (58.97%), Query Frame = 2
Query: 1217 KNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTST-NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVNI 1564
            K GYKM L I  NG  TG+GTH+SL+F + +G  D +L+W F Q VTL L++Q  R  H+    + +   +S +F +P S  NI  G   F  LS+L S +  I +D IFI+  V++
Sbjct:  456 KYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHIIDAFRPDI--SSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDL 569          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 78.9518 bits (193), Expect = 3.430e-15
Identity = 47/122 (38.52%), Postives = 72/122 (59.02%), Query Frame = 2
Query: 1211 SHKNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETF-PN--SKAFIQPTST-NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVNI 1564
            S K GYKM L +  NG  TG+G+H+SL+F + +G +D +L+W F Q VTL L++Q  R  H+     ++ F P+  S +F +P S  NI  G   F  L++L   S  + +D IFI+  V++
Sbjct:  413 SSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNNR-EHI-----IDAFRPDISSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVDL 528          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 2.781e-15
Identity = 45/114 (39.47%), Postives = 67/114 (58.77%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTST-NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            GY+M      NG   G+GTH+SL+F + +G++D +L W FRQ VTL+L++Q      +  T K +  P S +F +PTS  NI  G   F++   L S S+L  +D IFI+  V+
Sbjct:  360 GYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPD--PASSSFRRPTSDMNIASGCPLFVSHVALESASYL-QDDTIFIKVVVD 470          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 4.338e-15
Identity = 41/114 (35.96%), Postives = 67/114 (58.77%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPT-STNIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            GYKM      NG   G+GTH+SL+F + +G++D +L+W FR+ VTLSL++Q     H+  T   +  P S +F +P    N+  G   F++   L  +S+L+ +D +F+R  V+
Sbjct:  303 GYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPD--PASGSFRRPDGDMNVASGCPLFVSHVALEGSSYLV-DDTVFVRVVVD 413          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 58.9214 bits (141), Expect = 1.795e-9
Identity = 32/105 (30.48%), Postives = 58/105 (55.24%), Query Frame = 2
Query: 1250 PNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPT--STNIGFGFHQFMTLSELTSNSHLILNDNIFIRCKV 1558
            P+    G+  H++L+  L +GD+D  L W F+  + +S+++Q  R + V  T  ++  P   AF +P+      GFG+  FM ++ L   S+L  +D + +RC+V
Sbjct:  460 PSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDS-VHVTEMMDADPQLSAFQRPSVHRNPKGFGYMNFMDINTLHHRSYL-RDDCLVVRCEV 562          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 83.1889 bits (204), Expect = 4.749e-17
Identity = 47/116 (40.52%), Postives = 68/116 (58.62%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSK------AFIQP-TSTNIGFGFHQFMTLSELTSNSHLILNDNIFIR 1549
            GYKM L   PNG+  GKGTH+SL   + KG++D IL+W FR+ +TLSLINQ  ++     +  VE +P+         F +P  + N+G G+  F++  EL S  + I +D IFI 
Sbjct:  374 GYKMRLKAYPNGYGDGKGTHLSLSIRIMKGEYDAILEWPFRRKITLSLINQSEQW----RSETVEIYPDDATPDKKHKFERPIENENVGCGYSCFISHMELNSGDY-IKDDVIFIE 484          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 77.0258 bits (188), Expect = 5.328e-15
Identity = 43/114 (37.72%), Postives = 68/114 (59.65%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTST-NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            GYK    + PNG   GKG+H+SL+F L +G+FD +L W FRQ VT  L++ Q R   +  T + +  P S +F +PTS  NI  G   F++ + L + ++ + +D +FI+  V+
Sbjct:  413 GYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLD-QDRVHDIGDTFRPD--PTSSSFKRPTSNMNIASGCPLFISHTNLQTRAY-VRDDTMFIKIAVD 522          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV3])

HSP 1 Score: 74.3294 bits (181), Expect = 3.007e-14
Identity = 41/120 (34.17%), Postives = 68/120 (56.67%), Query Frame = 2
Query: 1217 KNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQ---TRFAHVKYTAKVETFPNSKAFI-QPT-STNIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            K+GY++   +C NG   GKGTH+S++  + KG FD +L+W F   VT  L+NQ        HVK++ K    P+++ F+ +P    N  FG  +F+   E+ S +  I +D +F++  V+
Sbjct:  339 KHGYRLCASVCLNGDGKGKGTHMSVFVSVLKGAFDALLKWPFHYRVTFFLLNQHENPEERKHVKFSIKPNPIPDNEPFLGRPRLEKNASFGGAKFIKHEEIESGN-FIKDDTVFLKVSVD 457          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 60.4622 bits (145), Expect = 8.358e-14
Identity = 32/119 (26.89%), Postives = 70/119 (58.82%), Query Frame = 2
Query: 1211 SHKNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPT-STNIGFGFHQFMTLSELTSNSHLILNDN-IFIRCKVN 1561
            +H+ GYK+   + PNG  + +  ++S++  L +G++D IL W F++++T++LI+Q      +  +   +  P S +F +PT + N+  G  +F + + L +  +  +N+N +F++  V+
Sbjct:  411 THRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDN---GMNISETFDPDPCSISFQRPTRNINVASGCPRFCSQTVLRTRGY--MNENCVFVKVVVD 524          

HSP 2 Score: 34.6538 bits (78), Expect = 8.358e-14
Identity = 16/41 (39.02%), Postives = 23/41 (56.10%), Query Frame = 3
Query: 1089 LEFKINQMKINGEELLWKIEKFSEKIADVKNGFNTEIYNKS 1211
            L  +I Q        LWKI+KF+E+ A+ K+G  T IY+  
Sbjct:  368 LRIQIQQAISYDGTFLWKIDKFTERYAEAKSGNATSIYSSP 408          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO37750 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SER6])

HSP 1 Score: 72.0182 bits (175), Expect = 1.045e-13
Identity = 40/116 (34.48%), Postives = 70/116 (60.34%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQT-RFAHVKYTAKVETFPNSKAFIQPT--STNIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            GYK  + + P G  +G+GTH+SLY  L  G++D +L W F   +TL+L++Q T + A    +      PN K+F +P+  ST++GFG+ QF++   L S  + + +D +F++  ++
Sbjct:  348 GYKFKVVLFPYGNGSGEGTHLSLYIRLLPGEYDSLLPWPFEGQITLTLLDQSTDKRAKRHISQSFSPDPNWKSFQRPSKNSTSLGFGYPQFVSHRGLESIGY-VRDDVLFLKVTID 462          

HSP 2 Score: 22.3274 bits (46), Expect = 1.045e-13
Identity = 9/26 (34.62%), Postives = 15/26 (57.69%), Query Frame = 3
Query: 1131 LLWKIEKFSEKIADVKNGFNTEIYNK 1208
            LLW+I+ F E   + K    TE+++ 
Sbjct:  315 LLWRIDDFWEAFDEGKRKPGTELHSP 340          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000001369.2 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:101170323])

HSP 1 Score: 80.8777 bits (198), Expect = 1.073e-15
Identity = 42/120 (35.00%), Postives = 71/120 (59.17%), Query Frame = 2
Query: 1217 KNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQP---TSTNIGFGFHQFMTLSELTS--NSHLILNDNIFIRCKVN 1561
            + GYKM +    NG   G+GTH+SLY  L  GDFD +L W F+Q+V+LS+++Q     H  +  + +  P +  F QP   +++N+  GF  F++L  L +  N+  + +D +F++ KV+
Sbjct:  461 RCGYKMAMKAYLNGDGEGRGTHLSLYVVLMPGDFDALLPWPFKQTVSLSVLDQSGARNHQSFNFRPD--PTNTCFHQPAAESASNVAVGFPCFISLDALEAPGNAVYVKDDTLFVKVKVD 578          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 77.7962 bits (190), Expect = 8.751e-15
Identity = 47/122 (38.52%), Postives = 71/122 (58.20%), Query Frame = 2
Query: 1211 SHKNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETF-PN--SKAFIQPTST-NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVNI 1564
            S K GYKM L +  NG  TG+GTH+SL+F + +  +D +L+W F Q VTL L++Q  R  H+     ++ F P+  S +F +P S  NI  G   F  L++L   S  + +D IFI+  V++
Sbjct:  398 SSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNR-EHI-----IDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVDL 513          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 77.7962 bits (190), Expect = 9.068e-15
Identity = 47/122 (38.52%), Postives = 71/122 (58.20%), Query Frame = 2
Query: 1211 SHKNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETF-PN--SKAFIQPTST-NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVNI 1564
            S K GYKM L +  NG  TG+GTH+SL+F + +  +D +L+W F Q VTL L++Q  R  H+     ++ F P+  S +F +P S  NI  G   F  L++L   S  + +D IFI+  V++
Sbjct:  405 SSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNR-EHI-----IDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVDL 520          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 77.411 bits (189), Expect = 9.109e-15
Identity = 44/114 (38.60%), Postives = 68/114 (59.65%), Query Frame = 2
Query: 1223 GYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTST-NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            GYKM   +  NG   GKGTH+SL+F + +G++D +L W F+Q VTL L++Q     H+    K +  P+S +F +P +  NI  G   F++ S L S ++ I +D IFI+  V+
Sbjct:  333 GYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPD--PSSSSFRRPVAEMNIASGCPLFVSQSVLESGTY-IKDDTIFIKVTVD 443          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 77.7962 bits (190), Expect = 1.016e-14
Identity = 47/117 (40.17%), Postives = 68/117 (58.12%), Query Frame = 2
Query: 1217 KNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTST-NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVNI 1564
            K GYKM L I  NG  TG+GTH+SL+F + +G  D +L+W F Q VTL L++Q  R  H+    + +    S +F +P S  NI  G   F  LS+L + +  I +D IFI+  V++
Sbjct:  480 KYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQSNR-EHIIDAFRPDV--TSSSFQRPVSEMNIASGCPLFCPLSKLDAKNSYIRDDTIFIKAIVDL 593          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000038724.1 (SMESG000038724.1)

HSP 1 Score: 173.711 bits (439), Expect = 1.235e-117
Identity = 81/108 (75.00%), Postives = 83/108 (76.85%), Query Frame = 3
Query:  351 IKSQMPRKSCGFTDEMRKIENHIRIYNNLPIDCPYSNIGCVNNGISHDSLADHLQSEIFMHTKLLMYFVGNMNNEMNTLTAHNNELGTEIETLKTEMNGLKLNSDRKQ 674
            +K + P KSCGFTDEMRKIENHIRIYNNLPIDCPYSNIGCVNNGISHDSLADHLQSEIFMHTKLLMY                      IETLKTEMNGLKLNSDRKQ
Sbjct:   18 LKVKCPEKSCGFTDEMRKIENHIRIYNNLPIDCPYSNIGCVNNGISHDSLADHLQSEIFMHTKLLMY---------------------RIETLKTEMNGLKLNSDRKQ 104          

HSP 2 Score: 164.081 bits (414), Expect = 1.235e-117
Identity = 85/87 (97.70%), Postives = 86/87 (98.85%), Query Frame = 3
Query:  972 IKESDQIKIIEEIKTNQAFNLENISNKIDGKMETVKKALLEFKINQMKINGEELLWKIEKFSEKIADVKNGFNTEIYNKSVIKTVTK 1232
            IKESDQIKIIEEIKTNQAFNLENISNKIDGKMETVKKALLEFKINQMKINGEELLWKIEKFSEKIAD KNGFNTEIY+KSVIKTVTK
Sbjct:  190 IKESDQIKIIEEIKTNQAFNLENISNKIDGKMETVKKALLEFKINQMKINGEELLWKIEKFSEKIADAKNGFNTEIYSKSVIKTVTK 276          

HSP 3 Score: 88.5817 bits (218), Expect = 1.235e-117
Identity = 47/49 (95.92%), Postives = 48/49 (97.96%), Query Frame = 2
Query:  818 SENFKNINSGEQEKHKIISEIETKYQEQIKQFNNKCQQIETQIENTNKQ 964
            SENFKNINSGEQEKHKIISEIETKYQEQI+QFNNK QQIETQIENTNKQ
Sbjct:  139 SENFKNINSGEQEKHKIISEIETKYQEQIQQFNNKWQQIETQIENTNKQ 187          

HSP 4 Score: 51.2174 bits (121), Expect = 1.235e-117
Identity = 24/24 (100.00%), Postives = 24/24 (100.00%), Query Frame = 1
Query:  301 MNDNLAVDNGINIKISKLKVKCPE 372
            MNDNLAVDNGINIKISKLKVKCPE
Sbjct:    1 MNDNLAVDNGINIKISKLKVKCPE 24          

HSP 5 Score: 30.0314 bits (66), Expect = 1.235e-117
Identity = 13/13 (100.00%), Postives = 13/13 (100.00%), Query Frame = 1
Query:  736 TKLQSILDGKIRD 774
            TKLQSILDGKIRD
Sbjct:  108 TKLQSILDGKIRD 120          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000026104.1 (SMESG000026104.1)

HSP 1 Score: 119.013 bits (297), Expect = 2.800e-57
Identity = 57/103 (55.34%), Postives = 77/103 (74.76%), Query Frame = 3
Query:  366 PRKSCGFTDEMRKIENHIRIYNNLPIDCPYSNIGCVNNGISHDSLADHLQSEIFMHTKLLMYFVGNMNNEMNTLTAHNNELGTEIETLKTEMNGLKLNSDRKQ 674
            P +SC  T E+RKIE+H+RI N   ++CPYSNIGC    ISH ++ DHL+S+  +HTKLLM FVGN+NNEM+ L  +NNEL  E ++L+TE+N LKL+ +R Q
Sbjct:  100 PEQSCEHTCELRKIEDHVRICNYRAVECPYSNIGCDKYEISHHNVVDHLRSDTMIHTKLLMDFVGNLNNEMSILKTNNNELREENKSLRTEINQLKLDVERSQ 202          

HSP 2 Score: 95.1301 bits (235), Expect = 2.800e-57
Identity = 42/67 (62.69%), Postives = 52/67 (77.61%), Query Frame = 1
Query:  175 LVNAHITPCGCRFCFTCISEYLNKNTKFCPGNSEDCKNELISMNDNLAVDNGINIKISKLKVKCPES 375
            L+NAH  PCGCRFC TCISEYL+   K CPG +E+C+ ELI+MN N+ +D  +N+KISKL VKCPE 
Sbjct:   36 LINAHSAPCGCRFCLTCISEYLDIENKICPGETEECQIELINMNGNIIIDRPMNVKISKLIVKCPEQ 102          

HSP 3 Score: 48.9062 bits (115), Expect = 2.800e-57
Identity = 20/36 (55.56%), Postives = 27/36 (75.00%), Query Frame = 3
Query:   66 MSLKLENIWSLIRNDNFKPVTNIEKELMCSICQQLL 173
            M+ KLEN+W  I+NDNF  V  IE E+MC +C++LL
Sbjct:    1 MAAKLENVWEAIKNDNFHTVGEIEDEMMCLLCKKLL 36          

HSP 4 Score: 114.775 bits (286), Expect = 2.450e-32
Identity = 53/120 (44.17%), Postives = 79/120 (65.83%), Query Frame = 2
Query: 1211 SHKNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTSTNIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVNILL 1570
            +HK GYKM L +CP G    + T++S+YFCL KGDFDEIL+W FR SVT ++INQ+TR  H   T  ++ + +++ F Q  +    +G    ++L EL+++  L++ D IFI+C VNI L
Sbjct:  482 THKIGYKMRLKLCPGGDDEDESTYLSVYFCLMKGDFDEILEWPFRHSVTFAIINQRTRLDHFSRTLSIDDYSSNEEFDQTINNGFIYGV-DIISLEELSTHPDLMIKDQIFIKCTVNINL 600          

HSP 5 Score: 43.8986 bits (102), Expect = 2.450e-32
Identity = 23/57 (40.35%), Postives = 36/57 (63.16%), Query Frame = 3
Query: 1041 ISNKIDGKMETVKKALLEFKINQMKINGEELLWKIEKFSEKIADVKNGFNTEIYNKS 1211
            +SNKI+  ++   K+L + K NQ K    E +WKI+KF +K+ D +NG    IY+K+
Sbjct:  424 LSNKIEESVQRFFKSL-QIKTNQNKQINSEFVWKIDKFRDKLEDAQNGQKPSIYSKA 479          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000026092.1 (SMESG000026092.1)

HSP 1 Score: 117.472 bits (293), Expect = 8.334e-51
Identity = 58/103 (56.31%), Postives = 72/103 (69.90%), Query Frame = 3
Query:  366 PRKSCGFTDEMRKIENHIRIYNNLPIDCPYSNIGCVNNGISHDSLADHLQSEIFMHTKLLMYFVGNMNNEMNTLTAHNNELGTEIETLKTEMNGLKLNSDRKQ 674
            P   C F  E+RK+E+HIR+ N     CPYSNIGC  + IS D ++DHLQSEI MHTKLL+ FVGN NNEM+ L   NNEL  E + L+ E+N LKLN +R+Q
Sbjct:   99 PEVLCEFQSELRKMEDHIRMCNYQSSQCPYSNIGCDKSKISSDKISDHLQSEILMHTKLLIDFVGNFNNEMSMLKTSNNELREENKLLRMEINELKLNCERRQ 201          

HSP 2 Score: 97.4413 bits (241), Expect = 8.334e-51
Identity = 45/71 (63.38%), Postives = 57/71 (80.28%), Query Frame = 1
Query:  178 VNAHITPCGCRFCFTCISEYLNKNTKFCPGNSEDCKNELISMNDNLAVDNGINIKISKLKVKCPESLVDLQ 390
            VNAH  PCGCRFCF C+SEYL +N ++CPG++EDCK ELIS+ +N+ VD  +N+KISKL VKCPE L + Q
Sbjct:   37 VNAHSAPCGCRFCFVCVSEYLCEN-RYCPGDTEDCKLELISITENIMVDRPMNVKISKLLVKCPEVLCEFQ 106          

HSP 3 Score: 26.5646 bits (57), Expect = 8.334e-51
Identity = 10/27 (37.04%), Postives = 19/27 (70.37%), Query Frame = 3
Query:   66 MSLKLENIWSLIRNDNFKPVTNIEKEL 146
            M+ KLENIW  +++ +++ +  IE E+
Sbjct:    1 MATKLENIWESMKSYDYETIGEIEDEM 27          

HSP 4 Score: 121.709 bits (304), Expect = 1.113e-32
Identity = 57/119 (47.90%), Postives = 76/119 (63.87%), Query Frame = 2
Query: 1211 SHKNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTST-NIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVNI 1564
            SHKNGY M L + P+G     GT++S+YFCL K D+D IL W FR SVTL+LINQ+T+  HV Y  K E   N K   +P +    G GF QF++  EL +N  L +++ IFI+C VN+
Sbjct:  359 SHKNGYNMCLLVYPDGNEVDNGTYLSVYFCLMKSDYDNILLWPFRHSVTLALINQRTKLDHVSYNIKCEDLTNPKDLCKPKNKYGNGIGFPQFISQKELLTNQDLSMSNQIFIKCTVNV 477          

HSP 5 Score: 38.1206 bits (87), Expect = 1.113e-32
Identity = 22/64 (34.38%), Postives = 36/64 (56.25%), Query Frame = 3
Query: 1017 NQAFNLENISNKIDGKMETVKKALLEFKINQMKINGEELLWKIEKFSEKIADVKNGFNTEIYNK 1208
            N+A  +E +S KI+  ++ V + LLE +  Q ++   E +W+IE   +KI    NG N   Y+K
Sbjct:  293 NKASTME-MSKKINNTVKNVDRRLLEMETIQNQMFNGEFVWRIENVKDKIVKAINGTNQSFYSK 355          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025558.1 (SMESG000025558.1)

HSP 1 Score: 149.828 bits (377), Expect = 3.917e-49
Identity = 68/119 (57.14%), Postives = 88/119 (73.95%), Query Frame = 2
Query: 1208 ISHKNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTSTNIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVNI 1564
            ++HKNG+KM L + P+GFS GKGTH+ +YF L KG+FD IL+W FR SVT +LINQ+TR  HV  T K    PN++AFIQPT  N G+GFHQF++  EL SN  L+ N+ IFI+C V+I
Sbjct:  328 LTHKNGFKMCLCVYPDGFSDGKGTHLPVYFHLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSKTVKCANNPNNEAFIQPTDRNTGWGFHQFVSHEELLSNPDLMRNNQIFIKCSVDI 446          

HSP 2 Score: 65.0846 bits (157), Expect = 3.917e-49
Identity = 40/95 (42.11%), Postives = 62/95 (65.26%), Query Frame = 3
Query:  948 RIRINSEKIKESDQIKIIE----EIKTNQAFNLENISNKIDGKMETVKKALLEFKINQ-MKINGEELLWKIEKFSEKIADVKNGFNTEIYNKSVI 1217
            ++ I   + K +DQ++ I+    E+ T++  NL  ISNKID  M+ V + LLE   NQ  +INGE  +WK++KF++K+AD KNG N  IY++S +
Sbjct:  236 QVEIGDLQRKCADQVEEIKLLNLEMPTSRK-NLTEISNKIDKSMDNVDRKLLEMAANQNQRINGE-FVWKLDKFTDKMADAKNGINAIIYSESFL 328          

HSP 3 Score: 120.553 bits (301), Expect = 2.329e-45
Identity = 59/108 (54.63%), Postives = 74/108 (68.52%), Query Frame = 3
Query:  351 IKSQMPRKSCGFTDEMRKIENHIRIYNNLPIDCPYSNIGCVNNGISHDSLADHLQSEIFMHTKLLMYFVGNMNNEMNTLTAHNNELGTEIETLKTEMNGLKLNSDRKQ 674
            +K + P KSC F DE+RK+E+H R+       CPYSNIGC    IS D ++DHLQSEI  HTKLLM FVGN NNEM  L A+NN L   IE L+ E+N LKL+ +R++
Sbjct:   94 LKVKCPEKSCEFVDELRKMEDHSRMCKYRSAACPYSNIGCDKCNISQDKVSDHLQSEILAHTKLLMNFVGNFNNEMEMLKANNNGLSAVIELLRNEINDLKLDGERRR 201          

HSP 4 Score: 81.6481 bits (200), Expect = 2.329e-45
Identity = 36/63 (57.14%), Postives = 49/63 (77.78%), Query Frame = 1
Query:  184 AHITPCGCRFCFTCISEYLNKNTKFCPGNSEDCKNELISMNDNLAVDNGINIKISKLKVKCPE 372
            A   PCGCRFCF+CIS +L+   K CPG +E+CK E+++++ N+ VD  +NIKIS+LKVKCPE
Sbjct:   38 ARCVPCGCRFCFSCISGFLDGGNKICPGFTEECKLEILNLDKNIYVDQPMNIKISRLKVKCPE 100          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025517.1 (SMESG000025517.1)

HSP 1 Score: 150.214 bits (378), Expect = 6.516e-49
Identity = 66/118 (55.93%), Postives = 86/118 (72.88%), Query Frame = 2
Query: 1208 ISHKNGYKMILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQTRFAHVKYTAKVETFPNSKAFIQPTSTNIGFGFHQFMTLSELTSNSHLILNDNIFIRCKVN 1561
            ++HKNG+K+ L + P+G   GKGTH+S++ CL KG+FD IL+W FR SVT +LINQ+TR  HV  TAK   +PNSK  IQPT  N GFGF QF++L EL+SN  L  N+ IFI+C V+
Sbjct:  172 LTHKNGFKICLRVDPDGNGVGKGTHLSVFVCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSLTAKYANYPNSKELIQPTDRNAGFGFPQFVSLKELSSNPDLTRNNQIFIKCSVD 289          

HSP 2 Score: 62.003 bits (149), Expect = 6.516e-49
Identity = 33/82 (40.24%), Postives = 53/82 (64.63%), Query Frame = 3
Query:  972 IKESDQIKIIEEIKTNQAFNLENISNKIDGKMETVKKALLEFKINQMKINGEELLWKIEKFSEKIADVKNGFNTEIYNKSVI 1217
            IK+ + I  I +++  Q  +L  +SNKID     V + LLE   NQ ++N  E +WK++KF++K+AD KN  NT+IY++S +
Sbjct:   91 IKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNEINTDIYSESFL 172          

HSP 3 Score: 22.7126 bits (47), Expect = 6.516e-49
Identity = 9/20 (45.00%), Postives = 12/20 (60.00%), Query Frame = 2
Query:  878 IETKYQEQIKQFNNKCQQIE 937
            +E  +Q+QI Q    CQQ E
Sbjct:   71 VENDFQQQITQCATNCQQAE 90          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF32.128e-1439.47TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.376e-1439.47TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.376e-1439.47TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.645e-1439.47TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.645e-1439.47TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-14.304e-1330.89TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-22.303e-1133.90TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Traf44.011e-1030.43gene:FBgn0026319 transcript:FBtr0334401[more]
Traf44.086e-1030.43gene:FBgn0026319 transcript:FBtr0077429[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX901915.13.060e-1641.67pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.13.060e-1641.67pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
traf56.210e-1634.75Tnf receptor-associated factor 5 [Source:ZFIN;Acc:... [more]
traf2b1.761e-1538.66Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b1.799e-1538.66Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF26.337e-1437.82TNF receptor associated factor 2 [Source:NCBI gene... [more]
TRAF26.949e-1437.82TNF receptor associated factor 2 [Source:NCBI gene... [more]
slc12a19.421e-1436.75solute carrier family 12 member 1 [Source:Xenbase;... [more]
ssh29.902e-1438.60slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh21.117e-1338.60slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf53.119e-1839.66TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf53.119e-1839.66TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf59.981e-1739.66TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf59.981e-1739.66TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf32.009e-1439.47TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P70191|TRAF5_MOUSE7.604e-1639.66TNF receptor-associated factor 5 OS=Mus musculus O... [more]
sp|Q60803|TRAF3_MOUSE1.559e-1340.00TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|Q13114|TRAF3_HUMAN1.751e-1339.47TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|P39429|TRAF2_MOUSE4.337e-1338.26TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|Q12933|TRAF2_HUMAN5.604e-1338.98TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7GWW36.442e-2650.00TNF receptor associated factor 4 (Fragment) OS=Sch... [more]
H2YYB22.529e-1642.24MATH domain-containing protein OS=Ciona savignyi O... [more]
C3ZG423.386e-1643.33Uncharacterized protein OS=Branchiostoma floridae ... [more]
T1E1011.052e-1528.45TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
C3ZHV21.684e-1538.21Uncharacterized protein OS=Branchiostoma floridae ... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000035169.11.065e-1639.47pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
traf52.742e-1638.46TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf2a1.598e-1541.03TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2a3.288e-1541.03TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2b3.430e-1538.52TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000000074.12.781e-1539.47pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.14.338e-1535.96pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
traf61.795e-930.48TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO483944.749e-1740.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494645.328e-1537.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328493.007e-1434.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352378.358e-1426.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377501.045e-1334.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000001369.21.073e-1535.00TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf2b8.751e-1538.52TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b9.068e-1538.52TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf39.109e-1538.60TNF receptor associated factor 3 [Source:NCBI gene... [more]
unm_sa8081.016e-1440.17TNF receptor-associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038724.11.235e-11775.00SMESG000038724.1[more]
SMESG000026104.12.800e-5755.34SMESG000026104.1[more]
SMESG000026092.18.334e-5156.31SMESG000026092.1[more]
SMESG000025558.13.917e-4957.14SMESG000025558.1[more]
SMESG000025517.16.516e-4955.93SMESG000025517.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004809 ID=SMED30004809|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1580bp
TATTAATAGTTCAAAGTTCACCAAAATTTATTGAATAATTTCATATCAAC
CTTTGTTAAATGCAAATGTCTCTGAAATTGGAAAATATTTGGTCACTCAT
TAGAAATGATAATTTTAAACCCGTAACAAATATCGAAAAGGAATTGATGT
GTTCCATTTGTCAACAGTTACTGACTGGTTAATGCTCACATTACCCCTTG
TGGCTGCAGATTTTGTTTTACTTGTATTTCGGAATATTTAAACAAAAATA
CGAAATTTTGCCCCGGCAATTCAGAGGACTGCAAAAATGAATTGATTAGT
ATGAATGATAATCTTGCTGTTGATAATGGTATAAATATAAAGATATCGAA
ATTAAAAGTCAAATGCCCAGAAAGTCTTGTGGATTTACAGATGAAATGAG
AAAAATCGAAAATCACATCCGAATTTATAATAACCTACCAATAGATTGTC
CCTATTCCAATATCGGGTGTGTTAATAATGGAATATCTCACGATTCATTG
GCTGATCATTTGCAATCGGAAATATTTATGCACACAAAACTATTGATGTA
TTTTGTTGGCAATATGAATAATGAGATGAATACATTGACAGCGCACAATA
ATGAATTAGGTACAGAAATCGAAACTTTAAAAACGGAAATGAACGGATTA
AAACTCAACAGTGACAGAAAACAAATAAATTTGAATTATTTTTTTTAATT
AAAATGAATTTAATTTGATAATGTAGGAAGAAATGACCAAATTGCAGAGT
ATACTGGATGGGAAAATTCGAGACATTGAAAAATTGAAATCAGAGATTAT
ACTTTTGAAAAGTTCCAAGTGAAAATTTCAAAAATATAAATTCAGGGGAA
CAAGAAAAACATAAAATAATTAGTGAAATAGAGACCAAATATCAAGAACA
AATCAAACAATTCAACAATAAATGCCAACAAATAGAAACTCAAATTGAGA
ATACGAATAAACAGTGAGAAAATTAAAGAAAGTGACCAGATAAAAATTAT
CGAGGAAATAAAAACCAACCAAGCATTTAATCTAGAGAATATATCAAATA
AAATCGACGGAAAAATGGAAACCGTTAAAAAGGCGTTATTGGAATTCAAA
ATAAATCAAATGAAAATAAACGGCGAAGAACTCTTGTGGAAAATAGAAAA
ATTCAGTGAAAAAATAGCAGATGTTAAAAATGGATTCAACACAGAAATTT
ATAACAAATCAGTCATAAAAACGGTTACAAAATGATATTATACATCTGTC
CGAATGGATTTAGCACCGGCAAAGGCACTCATATTTCTTTATATTTCTGT
TTGACGAAAGGCGATTTTGATGAAATATTACAATGGCATTTTAGACAATC
TGTCACACTTTCATTGATCAATCAGCAAACTAGGTTTGCCCATGTCAAAT
ACACTGCCAAAGTTGAGACTTTTCCAAACAGTAAAGCATTTATTCAACCA
ACAAGCACAAATATTGGATTTGGATTTCATCAATTTATGACTCTAAGCGA
ATTAACAAGCAATTCACATTTGATTCTTAACGATAACATTTTCATTAGAT
GTAAAGTTAACATTTTATTGTGATTTAATT
back to top

protein sequence of SMED30004809-orf-1

>SMED30004809-orf-1 ID=SMED30004809-orf-1|Name=SMED30004809-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=112bp
MPRKSCGFTDEMRKIENHIRIYNNLPIDCPYSNIGCVNNGISHDSLADHL
QSEIFMHTKLLMYFVGNMNNEMNTLTAHNNELGTEIETLKTEMNGLKLNS
DRKQINLNYFF*
back to top

protein sequence of SMED30004809-orf-2

>SMED30004809-orf-2 ID=SMED30004809-orf-2|Name=SMED30004809-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=114bp
MILYICPNGFSTGKGTHISLYFCLTKGDFDEILQWHFRQSVTLSLINQQT
RFAHVKYTAKVETFPNSKAFIQPTSTNIGFGFHQFMTLSELTSNSHLILN
DNIFIRCKVNILL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001817regulation of cytokine production
GO:0007165signal transduction
GO:0008063Toll signaling pathway
GO:0032088negative regulation of NF-kappaB transcription factor activity
GO:0033209tumor necrosis factor-mediated signaling pathway
GO:0042981regulation of apoptotic process
GO:0045087innate immune response
GO:0050688regulation of defense response to virus
GO:0016567protein ubiquitination
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0046872metal ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002083MATH/TRAF_dom
IPR008974TRAF-like
IPR018957Znf_C3HC4_RING-type
IPR013083Znf_RING/FYVE/PHD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1..21