TNF receptor associated factor-2

Overview
NameTNF receptor associated factor-2
Smed IDSMED30004800
Length (bp)1732
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor associated factor-2 (SMED30004800) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor associated factor-2 (SMED30004800) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor associated factor-2 (SMED30004800) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor associated factor-2 (SMED30004800) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004800

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30004800h1SMcG0014764 dd_Smed_v4_4380_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004800h1SMcG0014764 dd_Smed_v4_4380_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004800h1SMcG0014764 dd_Smed_v4_4380_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004800h1SMcG0014764 dd_Smed_v4_4380_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 59.3066 bits (142), Expect = 1.124e-8
Identity = 99/433 (22.86%), Postives = 172/433 (39.72%), Query Frame = 1
Query:  103 HKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDIL--EISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKVMSSEKLNDHFISNVEGHSKILIELIGQLRNEMRDLKENDTKKNESIESLRNEVDELKRNEAKNQSQITSLLISDTRNEA-----AIESLRNEINAIKHENQELKTLMRNSNNNLWN----------KLGQMDIEMND-RCRIDTVKSVNNAIEIMRIAGSELEQQMKIVDRKCQELNGNVKAETDKLVKE-----MREMRNYGMTKKVEILCQPQDXXXXXXXXXXXXKLHNGEIKWTI---------GKINEIKYMESDFFFDFLNPYKMQLRVE------NVKNRLEFQLWIYRKEFDDDNLSWPMKANVTI 1287
            +K   V  + D YKC  C+ ++ +  Q  CG  FCE C+   + +    C ACQ E I+  ++ K+     +I  + + C NE  S  C    M  HL L   +N +C F  + C ++    EK+                     LR ++RD  E   K  E+  S             K+Q  + +L +S  +NE+     +I+SL N+I + + E +  K ++RN+ + + +          KL ++D E+   R   +   S+ +++E ++   +ELE     VD+   ++  N      +L +      + ++R   M  + ++L                   +NG + W I           + +   + S  F+     YKM  RV            L     I R E+ D  L WP K  VT+
Sbjct:   39 YKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQ-ESIVKDKVFKDNCCKREILALQIYCRNE--SRGCAEQLMLGHL-LVHLKN-DCHFEELPC-VRPDCKEKV---------------------LRKDLRDHVEKACKYREATCS-----------HCKSQVPMIALQVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELES----VDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVL---------------ETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEY-DALLPWPFKQKVTL 413          
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 56.6102 bits (135), Expect = 9.466e-8
Identity = 104/457 (22.76%), Postives = 186/457 (40.70%), Query Frame = 1
Query:  103 HKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDIL--EISKNYGLNIQISKITVKCPNEN--CSYECKLMEMNEHLR-LCSTRNVECPFSGIGCQLKVMSSEKLNDH------FISNVEGHSKILIELIGQLRNEMRD---LKENDTKKNESIESLRNEV--DELKRNEAKNQSQITSLL----------ISDTRNEA-----AIESLRNEINAIKHENQELKTLMRNSNNNLWN----------KLGQMDIEMND-RCRIDTVKSVNNAIEIMRIAGSELEQQMKIVDRKCQELNGNVKAETDKLVKE-----MREMRNYGMTKKVEILCQPQDXXXXXXXXXXXXKLHNGEIKWTI---------GKINEIKYMESDFFFDFLNPYKMQLRVE------NVKNRLEFQLWIYRKEFDDDNLSWPMKANVTI 1287
            +K   V  + D YKC  C+ ++ +  Q  CG  FCE C+   + +    C ACQ E I+  ++ K+     +I  + + C NE+  C+ +  L  +  HL+  C     E P     C+ KV+  + L DH      +      H K  + +I   ++E  D   +  +   K      LR+E    ++K +EA +  Q  +LL          +S  +NE+     +I+SL N+I + + E +  K ++RN+ + + +          KL ++D E+   R   +   S+ +++E ++   +ELE     VD+   ++  N      +L +      + ++R   M  + ++L                   +NG + W I           + +   + S  F+     YKM  RV            L     I R E+ D  L WP K  VT+
Sbjct:   39 YKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQ-ESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFE--ELPCVRPDCKEKVLRKD-LRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELES----VDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVL---------------ETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEY-DALLPWPFKQKVTL 471          
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 56.6102 bits (135), Expect = 9.466e-8
Identity = 104/457 (22.76%), Postives = 186/457 (40.70%), Query Frame = 1
Query:  103 HKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDIL--EISKNYGLNIQISKITVKCPNEN--CSYECKLMEMNEHLR-LCSTRNVECPFSGIGCQLKVMSSEKLNDH------FISNVEGHSKILIELIGQLRNEMRD---LKENDTKKNESIESLRNEV--DELKRNEAKNQSQITSLL----------ISDTRNEA-----AIESLRNEINAIKHENQELKTLMRNSNNNLWN----------KLGQMDIEMND-RCRIDTVKSVNNAIEIMRIAGSELEQQMKIVDRKCQELNGNVKAETDKLVKE-----MREMRNYGMTKKVEILCQPQDXXXXXXXXXXXXKLHNGEIKWTI---------GKINEIKYMESDFFFDFLNPYKMQLRVE------NVKNRLEFQLWIYRKEFDDDNLSWPMKANVTI 1287
            +K   V  + D YKC  C+ ++ +  Q  CG  FCE C+   + +    C ACQ E I+  ++ K+     +I  + + C NE+  C+ +  L  +  HL+  C     E P     C+ KV+  + L DH      +      H K  + +I   ++E  D   +  +   K      LR+E    ++K +EA +  Q  +LL          +S  +NE+     +I+SL N+I + + E +  K ++RN+ + + +          KL ++D E+   R   +   S+ +++E ++   +ELE     VD+   ++  N      +L +      + ++R   M  + ++L                   +NG + W I           + +   + S  F+     YKM  RV            L     I R E+ D  L WP K  VT+
Sbjct:   39 YKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQ-ESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFE--ELPCVRPDCKEKVLRKD-LRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELES----VDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVL---------------ETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEY-DALLPWPFKQKVTL 471          
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 55.0694 bits (131), Expect = 2.900e-7
Identity = 33/98 (33.67%), Postives = 49/98 (50.00%), Query Frame = 1
Query:  139 YKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDILE---ISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECP 423
            Y+C IC   +  A Q  CG  FC+ CI + I + G  CP    E +LE      N+    +I  + VKCPNE C ++ +L  + +H   C    ++CP
Sbjct:   68 YECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPV-DNEILLENQLFPDNFAKR-EILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCP 163          
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 55.0694 bits (131), Expect = 2.900e-7
Identity = 33/98 (33.67%), Postives = 49/98 (50.00%), Query Frame = 1
Query:  139 YKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDILE---ISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECP 423
            Y+C IC   +  A Q  CG  FC+ CI + I + G  CP    E +LE      N+    +I  + VKCPNE C ++ +L  + +H   C    ++CP
Sbjct:   68 YECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPV-DNEILLENQLFPDNFAKR-EILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCP 163          
BLAST of TNF receptor associated factor-2 vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 52.373 bits (124), Expect = 8.145e-7
Identity = 37/146 (25.34%), Postives = 63/146 (43.15%), Query Frame = 1
Query:  139 YKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPA-----CQCEDILEISKNYGLNIQISKITVKCPNEN--CSYECKLMEMNEHLRLCSTRNVE------CPFSGIGCQL-KVMSSEKLNDHFISNVEGHSKILIELIGQ 534
            Y+CAIC   +N      CG  FC  C+  +++     CP          DI     NY    +I ++   CPN +  CS     +E++ HL  C  R  +      CPF+ I C       + +L +H  +++  H +++++   Q
Sbjct:  102 YECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCPMDNKRLSAEHDIF--PDNYTRR-EIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEKCPFAKIKCDFVGRPETNQLEEHLKADMPHHMQLMLQAFQQ 244          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 62.003 bits (149), Expect = 1.007e-9
Identity = 41/131 (31.30%), Postives = 59/131 (45.04%), Query Frame = 1
Query:  112 VIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDILEISKNYGLNI-----------QISKITVKCPNENCSYECKLMEM-NEHLRLCSTRNVECPFSGIGCQLKVMSSEK 468
            V+   +   Y+C  C  I+    QA CG  FC  C  +   +G   C AC+ E I E  +   LNI           +I  +  KCPNE CS+   L +  N+H   C+   V+C      CQ+ ++ SEK
Sbjct:   34 VLSVSMEPKYQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGIFE-EETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCE----ACQVLILLSEK 159          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 62.003 bits (149), Expect = 1.007e-9
Identity = 41/131 (31.30%), Postives = 59/131 (45.04%), Query Frame = 1
Query:  112 VIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDILEISKNYGLNI-----------QISKITVKCPNENCSYECKLMEM-NEHLRLCSTRNVECPFSGIGCQLKVMSSEK 468
            V+   +   Y+C  C  I+    QA CG  FC  C  +   +G   C AC+ E I E  +   LNI           +I  +  KCPNE CS+   L +  N+H   C+   V+C      CQ+ ++ SEK
Sbjct:   34 VLSVSMEPKYQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGIFE-EETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCE----ACQVLILLSEK 159          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 62.003 bits (149), Expect = 1.072e-9
Identity = 41/131 (31.30%), Postives = 59/131 (45.04%), Query Frame = 1
Query:  112 VIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDILEISKNYGLNI-----------QISKITVKCPNENCSYECKLMEM-NEHLRLCSTRNVECPFSGIGCQLKVMSSEK 468
            V+   +   Y+C  C  I+    QA CG  FC  C  +   +G   C AC+ E I E  +   LNI           +I  +  KCPNE CS+   L +  N+H   C+   V+C      CQ+ ++ SEK
Sbjct:   47 VLSVSMEPKYQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGIFE-EETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCE----ACQVLILLSEK 172          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 55.8398 bits (133), Expect = 1.048e-7
Identity = 34/98 (34.69%), Postives = 49/98 (50.00%), Query Frame = 1
Query:  139 YKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDILE---ISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECP 423
            Y+C IC   + +A Q  CG  FC+ CI + I + G  CP    E +LE      N+    +I  +TVKC N  CS + +L ++ +HL  C      CP
Sbjct:   69 YECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPV-DNEVLLEEQLFPDNFA-KREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCP 164          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 55.8398 bits (133), Expect = 1.048e-7
Identity = 34/98 (34.69%), Postives = 49/98 (50.00%), Query Frame = 1
Query:  139 YKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDILE---ISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECP 423
            Y+C IC   + +A Q  CG  FC+ CI + I + G  CP    E +LE      N+    +I  +TVKC N  CS + +L ++ +HL  C      CP
Sbjct:   69 YECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPV-DNEVLLEEQLFPDNFA-KREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCP 164          
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 53.9138 bits (128), Expect = 5.114e-7
Identity = 32/97 (32.99%), Postives = 47/97 (48.45%), Query Frame = 1
Query:  139 YKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDILE---ISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVEC 420
            Y+C IC   +  A Q  CG  FC+ CI + I + G  CP    E ++E      N+    +I  + VKCP++ C+   +L  +  HL  C    VEC
Sbjct:   70 YECPICLMALREAVQTPCGHRFCKACILKSIRDAGHKCPV-DNESLMENQLFPDNFA-KREILSLRVKCPSQGCTETMELRHLERHLVRCDFAGVEC 164          
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 53.1434 bits (126), Expect = 1.038e-6
Identity = 40/129 (31.01%), Postives = 62/129 (48.06%), Query Frame = 1
Query:   91 LLSEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIE-NGGANCPACQCEDI--LEISKNYGLNIQISKITVKCPNEN-CSYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKVMSSE 465
             + + +++ V  + D YKCA C+ +++N HQ  CG  FCE+CI+  IE +    CP    E+I   EI K+     ++  + V C N   C  +  L    EHL  C      C  S  GC  +++  E
Sbjct:   26 FVPKQEYLFVEQLQDRYKCASCHLVLHNPHQTGCGHRFCEKCISNLIELSETPQCPI-DMENIKSHEIFKDNCCKREVLNLLVYCKNSPACDVKVMLGRYQEHLGQCLYEMTLC--SNDGCHDQMIRKE 151          
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 51.6026 bits (122), Expect = 2.601e-6
Identity = 26/114 (22.81%), Postives = 52/114 (45.61%), Query Frame = 1
Query:   94 LSEHKFVIVNDITDDYKCAICNGIVNNAHQ-AICGCNFCEECINRFIENGGANCPACQCE-DILEISKNYGLNIQISKITVKC--PNENCSYECKLMEMNEHLRLCSTRNVECP 423
            +  + +  +  +   + C +C   +    Q + CG  FC+ C+  F+  G   CP  Q   D  +I  +  L  Q+  ++++C    E C +  +L ++  HL +C+   + CP
Sbjct:    1 MPGYDYKFLEKLRRKFLCPLCGKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDRDLETQVMGLSIRCIHSEEGCRWSGQLKQLQPHLNICAFNVIPCP 114          
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 51.2174 bits (121), Expect = 3.576e-6
Identity = 40/129 (31.01%), Postives = 62/129 (48.06%), Query Frame = 1
Query:   91 LLSEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIE-NGGANCPACQCEDI--LEISKNYGLNIQISKITVKCPNEN-CSYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKVMSSE 465
             + + +++ V  + D YKCA C+ +++N HQ  CG  FCE+CI+  IE +    CP    E+I   EI K+     ++  + V C N   C  +  L    EHL  C      C  S  GC  +++  E
Sbjct:   26 FVPKQEYLFVEQLQDRYKCASCHLVLHNPHQTGCGHRFCEKCISNLIELSETPQCPI-DMENIKSHEIFKDNCCKREVLNLLVYCKNSPACDVKVMLGRYQEHLGQCLYEMTLC--SNDGCHDQMIRKE 151          
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 58.151 bits (139), Expect = 2.311e-8
Identity = 107/461 (23.21%), Postives = 183/461 (39.70%), Query Frame = 1
Query:  103 HKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDIL--EISKNYGLNIQISKITVKCPNE--NCSYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKVMSSEK-----LNDH------FISNVEGHSKILIELIGQLRNEMRD---LKENDTKKNESIESLRNEV--DELKRNEAKNQSQITSLL----------ISDTRNEA-----AIESLRNEINAIKHENQELKTLMRNSNNNLWN----------KLGQMDIEMND-RCRIDTVKSVNNAIEIMRIAGSELEQQMKIVDRKCQELNGNVKAETDKLVKE-----MREMRNYGMTKKVEILCQPQDXXXXXXXXXXXXKLHNGEIKWTI---------GKINEIKYMESDFFFDFLNPYKMQLRVE------NVKNRLEFQLWIYRKEFDDDNLSWPMKANVTI 1287
            +K   V  + D YKC  C  ++ N  Q  CG  FCE C+   + +    C ACQ E I+  ++ K+     +I  + V C NE   C+ +  L  +  HL+       EC F  + C L+    EK     L DH      +      H K  + +I   ++E  D   +  +   K      LR+E    ++K +EA +  Q  +LL          +S  +NE+     +I+SL N+I + + E +  K ++RN+ + + +          KL ++D E+   R   +   S+ +++E ++   +ELE     VD+   +   N      +L +      + ++R   M  + ++L                   +NG + W I           + +   + S  F+     YKM  RV            L     I R E+ D  L WP K  VT+
Sbjct:   38 YKEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQ-ESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLK------NECQFEELPC-LRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELES----VDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVL---------------ETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEY-DALLPWPFKQKVTL 470          
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 58.151 bits (139), Expect = 2.311e-8
Identity = 107/461 (23.21%), Postives = 183/461 (39.70%), Query Frame = 1
Query:  103 HKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDIL--EISKNYGLNIQISKITVKCPNE--NCSYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKVMSSEK-----LNDH------FISNVEGHSKILIELIGQLRNEMRD---LKENDTKKNESIESLRNEV--DELKRNEAKNQSQITSLL----------ISDTRNEA-----AIESLRNEINAIKHENQELKTLMRNSNNNLWN----------KLGQMDIEMND-RCRIDTVKSVNNAIEIMRIAGSELEQQMKIVDRKCQELNGNVKAETDKLVKE-----MREMRNYGMTKKVEILCQPQDXXXXXXXXXXXXKLHNGEIKWTI---------GKINEIKYMESDFFFDFLNPYKMQLRVE------NVKNRLEFQLWIYRKEFDDDNLSWPMKANVTI 1287
            +K   V  + D YKC  C  ++ N  Q  CG  FCE C+   + +    C ACQ E I+  ++ K+     +I  + V C NE   C+ +  L  +  HL+       EC F  + C L+    EK     L DH      +      H K  + +I   ++E  D   +  +   K      LR+E    ++K +EA +  Q  +LL          +S  +NE+     +I+SL N+I + + E +  K ++RN+ + + +          KL ++D E+   R   +   S+ +++E ++   +ELE     VD+   +   N      +L +      + ++R   M  + ++L                   +NG + W I           + +   + S  F+     YKM  RV            L     I R E+ D  L WP K  VT+
Sbjct:   38 YKEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQ-ESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLK------NECQFEELPC-LRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELES----VDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVL---------------ETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEY-DALLPWPFKQKVTL 470          
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 55.4546 bits (132), Expect = 1.391e-7
Identity = 38/121 (31.40%), Postives = 53/121 (43.80%), Query Frame = 1
Query:  139 YKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCE-------DILEISKNYGLNI---QISKITVKCPNENCSYECKLMEMNE-HLRLCSTRNVECPFSGIGCQLKVMSSEK 468
            Y C+ C  I+    QA CG  +C  C+   + +G  NC AC  E        ILE S  +  N    ++  +   CPN+ C+++  L E    H  LC     ECP     C+  V  SEK
Sbjct:   32 YLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECP----ACKGLVRLSEK 148          
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 54.6842 bits (130), Expect = 2.474e-7
Identity = 35/114 (30.70%), Postives = 59/114 (51.75%), Query Frame = 1
Query:   97 SEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIE-NGGANCPACQCEDIL---EISKNYGLNIQISKITVKCPN-ENCSYECKLMEMNEHLRLCSTRNVECP 423
            +E++FV    + + YKCA C+ +++N HQ  CG  FC++CI    E N    CP  +  +++   E+ K+     ++  + V C N   C+    L    +HL+ CS + V CP
Sbjct:   31 TEYQFV--EQLEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDK--EVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQHCSFQAVPCP 140          
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 54.6842 bits (130), Expect = 2.474e-7
Identity = 35/114 (30.70%), Postives = 59/114 (51.75%), Query Frame = 1
Query:   97 SEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIE-NGGANCPACQCEDIL---EISKNYGLNIQISKITVKCPN-ENCSYECKLMEMNEHLRLCSTRNVECP 423
            +E++FV    + + YKCA C+ +++N HQ  CG  FC++CI    E N    CP  +  +++   E+ K+     ++  + V C N   C+    L    +HL+ CS + V CP
Sbjct:   31 TEYQFV--EQLEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDK--EVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQHCSFQAVPCP 140          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|B6CJY4|TRAF6_CERAT (TNF receptor-associated factor 6 OS=Cercocebus atys OX=9531 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 4.955e-7
Identity = 34/98 (34.69%), Postives = 49/98 (50.00%), Query Frame = 1
Query:  139 YKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDILE---ISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECP 423
            Y+C IC   +  A Q  CG  FC+ CI + I + G  CP    E +LE      N+    +I  + VKCPNE C ++ +L  + +H   C    V+CP
Sbjct:   68 YECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPV-DNEILLENQLFPDNFAKR-EILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCP 163          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|B6CJY5|TRAF6_MACMU (TNF receptor-associated factor 6 OS=Macaca mulatta OX=9544 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 5.130e-7
Identity = 34/98 (34.69%), Postives = 49/98 (50.00%), Query Frame = 1
Query:  139 YKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDILE---ISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECP 423
            Y+C IC   +  A Q  CG  FC+ CI + I + G  CP    E +LE      N+    +I  + VKCPNE C ++ +L  + +H   C    V+CP
Sbjct:   68 YECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPV-DNEILLENQLFPDNFAKR-EILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCP 163          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|Q6IWL4|TRAF6_DANRE (TNF receptor-associated factor 6 OS=Danio rerio OX=7955 GN=traf6 PE=1 SV=2)

HSP 1 Score: 55.8398 bits (133), Expect = 7.911e-7
Identity = 34/98 (34.69%), Postives = 49/98 (50.00%), Query Frame = 1
Query:  139 YKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDILE---ISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECP 423
            Y+C IC   + +A Q  CG  FC+ CI + I + G  CP    E +LE      N+    +I  +TVKC N  CS + +L ++ +HL  C      CP
Sbjct:   69 YECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPV-DNEVLLEEQLFPDNFA-KREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCP 164          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 9.729e-7
Identity = 38/121 (31.40%), Postives = 53/121 (43.80%), Query Frame = 1
Query:  139 YKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCE-------DILEISKNYGLNI---QISKITVKCPNENCSYECKLMEMNE-HLRLCSTRNVECPFSGIGCQLKVMSSEK 468
            Y C+ C  I+    QA CG  +C  C+   + +G  NC AC  E        ILE S  +  N    ++  +   CPN+ C+++  L E    H  LC     ECP     C+  V  SEK
Sbjct:   32 YLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECP----ACKGLVRLSEK 148          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|Q3ZCC3|TRAF6_BOVIN (TNF receptor-associated factor 6 OS=Bos taurus OX=9913 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.035e-6
Identity = 34/98 (34.69%), Postives = 48/98 (48.98%), Query Frame = 1
Query:  139 YKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDILE---ISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECP 423
            Y+C IC   +  A Q  CG  FC+ CI + I + G  CP    E +LE      N+    +I  + VKCPNE C ++ +L  + EH   C    + CP
Sbjct:   69 YECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPV-DNEILLENQLFPDNFAKR-EILSLMVKCPNEGCLHKMELRHLEEHQAHCEFALMSCP 164          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 4.323e-27
Identity = 62/184 (33.70%), Postives = 104/184 (56.52%), Query Frame = 1
Query:   79 KISQLLSEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPA----CQCEDIL---EISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKVMSSEKLNDHFISNVEGHSKILIELIGQLRNEMRDLKENDTKKNESIESLRNE 609
            KI++LL  + F +   + D+ KC +C  ++ NA Q+ CGC FC +CI  ++  G   CP     C+ E++     I  +Y +N +I+K+ VKCP E C   C+L+++ EHLRLC+ ++  CPF  +GC    M  + L +H  +    HSK++I++I  +RN+   L   + +  E I  ++N 
Sbjct:    5 KINRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDFFGLTTKEVELREDINLIKNH 188          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 1.077e-22
Identity = 108/422 (25.59%), Postives = 205/422 (48.58%), Query Frame = 1
Query:   61 INEKLNKISQLLSEHKFVIVND-ITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPA--CQC-EDIL----EISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKVMSSEKLNDHFISNVEGHSKILIELIGQLRNEMRDLKENDTKKNESIESLRNEVDELKRNEAKNQSQITSLLISDTRN-EAAIESLRNEINAIKHENQELKTLMRNSNNNLWNKLGQMDIEMNDRCRIDTVKSVNNAIEIMRIAGSELEQQMKIVDRKCQELNGNVKAETDKLVKEMREMRNYGMTKKVEILCQPQDXXXXXXXXXXXXKLHNGEIKWTIGKINEIKYMESDFFFDFLNP--YKMQLRVENVKNRLEFQLWIYRKEFDDDNLSWPMKANVTIEI 1293
            I  KL+ + +LLS++    V++ + +D  C +CN ++ +A ++ CGC++C  CI  ++      CP    +C ED L    ++ +N  L+ +IS+I VKCPN  C+Y  +L+ + EHL  C+  +VECP   IGC+ + +  +++  H    V  H+++++    +L++E   +  N+    E I  L+ EV  +++     ++     LI + RN +  I  L  +I  +K+   E+ TL+ +  + L  K  + DI++  R  I+ +K   N +E+  +  ++++ Q+K + ++   +  N+ +  +   +  R+M N     K   LC   D                 +  W I + ++ +   +D + D      YK  L +    + L     I + E  DD L WPM+  VT+ I
Sbjct:    2 IPSKLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSE---INHNNETTKEDISHLK-EVLRVQKALNDEKTAQMEFLIEELRNKDNMILVLSQDIQEVKN---EMITLLTSKESEL--KKLKSDIQIF-RQEIEFMK---NDLEV--VGSTDIKNQVKDLKKEIFGIKMNIDSNNE---ERERKMNNLIRLNK---LCPNVDM----------------DFMWRIEEYSKKRRTVTDVYSDSFQSHNYKFCLNLYIYGDNLGLWCVIMKGE-KDDFLEWPMRRTVTLSI 385          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: A0A0F7GWW3 (TNF receptor associated factor 4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.140e-17
Identity = 52/149 (34.90%), Postives = 85/149 (57.05%), Query Frame = 1
Query:  283 ISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKVMSSEKLNDHFISNVEGHSKILIELIGQLRNEMRDLKENDTKKNESIESLRNEVDELKRNEAKNQSQITSLLISDTRNEAAIESLRNEINAIK 729
            I  +Y +N++I+K+ VKC  ++C Y  +L +M +H R C  R+V CP+S IGC    +S +K+ DH  S +  H+K+L++ +    NEM  LK N+   +   E LRNE++ELK +  + + +I  L          IE L  +I A++
Sbjct:   16 ICVDYPMNMKIAKLQVKCKEKSCDYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEMLKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALR 164          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: A0A2B4SG57 (TNF receptor-associated factor 4 OS=Stylophora pistillata OX=50429 GN=TRAF4 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.147e-11
Identity = 66/258 (25.58%), Postives = 112/258 (43.41%), Query Frame = 1
Query:   94 LSEHKFVIVNDITDDYKCAICNGIVNNAHQAI-CGCNFCEECINRFIENGGANCPACQ---CEDILEISKNYGLNIQISKITVKCPNENCSYECKL--MEMNEHLR-LCSTRNVECPFSGIGCQLKVMSSEKLNDHFISNVEGHSKILI-----------ELIGQL---RNEMRDLKENDTKKNESIESLRNEVDE-------LKRNEAKNQSQITSLLISDTRNEAAIESLRNEINAIKHENQELKTLMRNSNNNLW 783
            L  + +   +D+ +D++C +C+  + +  Q + CG  FC  C+          CPA +     D  EI ++     +I  + VKCP+  C +  +L  +E++ H+R  C    V C +  +GC+  V        H  S VEGH K+ +           EL+  L     +M  L  ND +K++ +E L+ EV E       L   + KN  QI  L+  D  N   +E L  ++     + + L+   R     +W
Sbjct:   10 LGGYDYEFTSDVPEDFECPVCHLPMKDPVQIVQCGHRFCSICMESLFRLPSPFCPADRHPLSRD--EIFQDTACGRKILDLIVKCPSNGCPWRGELRDVELDVHIRDECPKTEVHCEYKYLGCE-AVFLRPTAKSHSESQVEGHLKLAVRSLEATKHQVQELVSHLNCQAQKMERLMTNDEEKSQQMERLKAEVAEKSKQVEQLIARDDKNTKQIEQLVTRDKENCKEMERLMEKVYEQSQQIERLRMTARKCAPFVW 264          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: A0A1A6GSE2 (TNF receptor-associated factor OS=Neotoma lepida OX=56216 GN=A6R68_02378 PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 8.210e-11
Identity = 62/247 (25.10%), Postives = 109/247 (44.13%), Query Frame = 1
Query:   97 SEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINR----FIENGG-------------------ANCPACQCEDILEISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKVMSSEKLNDHFISNVEGHSKILIELIGQLRNEMRDLKENDTKKNESIESLRNEVDELKR-----------NEAKNQSQITSLL--ISDTRNEAAIESLRNEINAIK 729
            +E++FV    + + YKCA C+ +++N HQ  CG  FC+ CI       +E G                     N P C    IL   +++  N+      V CPN+ C       E+NEHL +C     +CPF   GC +K      L +H  + +  H  +++E   QL  ++ +L ++  +K   I+ L + V + ++             A  ++Q+  LL  ++  +N   + SL   I+++K
Sbjct:   31 TEYQFV--EQLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLSCFLVERGTYVFKDNCCKREVLNLYVYCKNAPGCNARIILGRFQDHEENV-CPAYPVSCPNK-CLRTIPRTEVNEHLTVCPEAEQDCPFKHYGCAVKGKRG-NLQEHEQAALRDHMLLVLEKNFQLEQQISELYQSLEQKESKIQQLADTVKKFEKEFKQFTQIHIDKSAWLEAQVRQLLQIVNQQQNRFDLRSLVEAIDSVK 272          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 61.6178 bits (148), Expect = 1.283e-9
Identity = 42/149 (28.19%), Postives = 67/149 (44.97%), Query Frame = 1
Query:   55 SNINEKLNKISQLLSEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDILE-------ISKNYGLNI---QISKITVKCPNENCSYECKLMEMN-EHLRLCSTRNVECPFSGIGCQLKVMSSEK 468
            S+++  L  IS+       V+   +   Y+C  C G++    QA CG  FC  C  +   +G   C AC+ E I E       I++ +  N    +I  +  KCPN+ CS+   L E   +H   C    V+C      CQ+ ++ S+K
Sbjct:   18 SSVDSTLPGISRQ------VLSVSMEPKYQCQQCKGVLRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGIFEMEHSMLSITEAFPDNAARREIDGLPAKCPNDGCSWNGTLKEYEVQHEGRCEFERVKCE----ACQMMILLSDK 156          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 52.7582 bits (125), Expect = 8.200e-7
Identity = 32/115 (27.83%), Postives = 47/115 (40.87%), Query Frame = 1
Query:  112 VIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDILE----------ISKNYGLNIQISKITVKCPNENCSYECKLMEMNE-HLRLCSTRNVECP 423
            ++ N + D + C IC  I+    QA CG  FC  C N+ + +G   C AC  EDI E             +     ++  +   C NE CS+   + E    H   C    + CP
Sbjct:   23 ILANKLEDKHLCNICQKILRRPFQAQCGHRFCSYCFNKTVSSGPQKCSACIKEDIFEEPTSILKQGCAFPDNAAKREVEALEAVCINEGCSWTGTIKEYEATHEGQCDFMIIPCP 137          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 52.373 bits (124), Expect = 1.005e-6
Identity = 33/120 (27.50%), Postives = 54/120 (45.00%), Query Frame = 1
Query:   79 KISQLLSEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDIL----EISKNYGLNIQISKITVKCPNEN-CSYECKLMEMNEHLRLCSTRNVECP 423
            ++  +L+      V  + D + C  C G+V N HQ  CG  FC  CI   +EN   +   C  + IL    E+ ++     ++  + V C N   CS    L  + +HL+ C    ++CP
Sbjct:   25 ELESVLAGRTLSFVVKLDDQFVCPACGGVVFNPHQTGCGHIFCSPCIRVILENNETS--KCPFDGILIKPEEVFQDNCCKRELLNLEVFCTNSPACSQTIPLCNLQDHLKSCQYEALQCP 142          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 50.8322 bits (120), Expect = 2.676e-6
Identity = 39/117 (33.33%), Postives = 53/117 (45.30%), Query Frame = 1
Query:  139 YKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPA---CQCEDILEISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKVMSSEKLNDH 480
            Y+C IC   + +A Q  CG  FC  CI + I + G  CP       ED L    N+    +I  +TV+C N  C  + +L  +  H+  C    V CP     CQ  V  SE L +H
Sbjct:   68 YECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCPVDNEVLTEDQL-FPDNFA-KREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCP----QCQESVWKSE-LEEH 177          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 50.447 bits (119), Expect = 3.749e-6
Identity = 39/117 (33.33%), Postives = 53/117 (45.30%), Query Frame = 1
Query:  139 YKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPA---CQCEDILEISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKVMSSEKLNDH 480
            Y+C IC   + +A Q  CG  FC  CI + I + G  CP       ED L    N+    +I  +TV+C N  C  + +L  +  H+  C    V CP     CQ  V  SE L +H
Sbjct:   68 YECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCPVDNEVLTEDQL-FPDNFA-KREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCP----QCQESVWKSE-LEEH 177          
BLAST of TNF receptor associated factor-2 vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 47.7506 bits (112), Expect = 5.435e-6
Identity = 31/110 (28.18%), Postives = 49/110 (44.55%), Query Frame = 1
Query:  139 YKCAICNGIVNNAHQAICGCNFCEECI--NRFIENGGANCPACQCEDILEISKNYGLNI---QISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKV 453
            Y+C IC   +    Q  CG  FC  CI  +  + + G  CP      +L   + +  N    +I  +TV+CPN+ C +  +L  + EH   C    V C    + C++ V
Sbjct:   63 YECPICLMALREPVQTPCGHRFCRACILHSMRLRDAGPKCPVDNA--VLHEGQLFPDNFAKREILSLTVRCPNKPCGHRGELRALQEHQLRCEYAQVPC----VRCEMPV 166          
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Match: EDO34728 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNG3])

HSP 1 Score: 50.447 bits (119), Expect = 1.962e-7
Identity = 35/134 (26.12%), Postives = 65/134 (48.51%), Query Frame = 1
Query:  106 KFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCE-------DILEISKNYGLNIQISKITVKC--PNENCSYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKVMSSEKLNDH 480
            +FV   D++ +  C IC G++ +  ++ C   FC ECI+++++N  +NCP C+ +        +L + +N      ISK+ + C    + C     L  +  H  +C    V C ++  G   KV+  + L+ H
Sbjct:    7 RFV---DVSPELVCCICTGVLEDPVESPCRHVFCSECISKWLQN-NSNCPTCRSQVRAKNLKPVLPLVRNI-----ISKLKIHCDFKTQGCKAIVSLESLRRHATICVMAPVTCTYANCG---KVVPKKDLDKH 128          
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Match: EDO41243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z7])

HSP 1 Score: 47.7506 bits (112), Expect = 9.995e-6
Identity = 36/124 (29.03%), Postives = 57/124 (45.97%), Query Frame = 1
Query:  100 EHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGG-ANCPACQCEDILEISKNYGLNIQ----ISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKVM 456
            + +FVI   + ++Y C IC+  +    Q  CG  FC+EC++        A CP  +  + L++ K+  L+      I    VKCP + C +E +L ++  H R C    V C       QL  M
Sbjct:   12 DSEFVIA--VAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMDR--EPLDLKKDVFLDKAAERTILSFLVKCPCKGCKWEAELRDLEAHARNCDYELVTCSNPMCSAQLPRM 131          
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:101161132])

HSP 1 Score: 57.3806 bits (137), Expect = 2.657e-8
Identity = 34/97 (35.05%), Postives = 48/97 (49.48%), Query Frame = 1
Query:  139 YKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPA---CQCEDILEISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVEC 420
            Y+C IC   + NA Q  CG  FC+ CI + I + G  CP       ED L    N+    +I  +TV+CPN +C  + +L  + +HL  C    V C
Sbjct:   76 YECPICLMALRNAIQTRCGHRFCKSCIEKSIRDTGQRCPVDNEMLSEDQL-FPDNFA-KREILSLTVRCPNSDCGEKMELRHLEKHLAQCQFATVPC 170          
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 52.373 bits (124), Expect = 1.126e-6
Identity = 36/132 (27.27%), Postives = 59/132 (44.70%), Query Frame = 1
Query:  106 KFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDILE----------ISKNYGLNIQISKITVKCPNENCSYECKLMEMN-EHLRLCSTRNVECPFSGIGCQLKVMSSEK 468
            K ++ N + D + C  C+ I+    QA CG  FC  C NR + NG   C AC  E+I E             +  +  ++  ++  C NENC ++  + E   +H   C    + CP     C+ ++  SE+
Sbjct:   21 KKILGNKLEDKHLCNCCHNILRRPIQAQCGHRFCSYCFNRTVSNGPQKCNACIKEEIFEEPTSILKQGCAFPDNAVRREVEGLSADCINENCPWKGTIKEYELDHEGKCEFMIIPCP----SCKERIRFSEQ 148          
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Match: ENSORLT00000001369.2 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:101170323])

HSP 1 Score: 51.2174 bits (121), Expect = 2.245e-6
Identity = 33/119 (27.73%), Postives = 54/119 (45.38%), Query Frame = 1
Query:  100 EHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDIL----EISKNYGLNIQISKITVKCPNEN-CSYECKLMEMNEHLRLCSTRNVECPFSGIGC 441
            +H    V  + +++ C IC G+V N  Q  CG  +C  C+   +E+   + P C  E       E+ ++     +IS + V C N   C+    L ++ EHL+ C    + C  S  GC
Sbjct:   53 QHSLKFVMKLKEEFICPICKGVVLNPQQNSCGHIYCFHCLQGLLESSLLSGPVCPVEKAAITPSEVFQDNCCKREISSLEVYCTNSPLCTSVLALNQLQEHLKSCQYEQLLC--SNPGC 169          
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 50.8322 bits (120), Expect = 3.051e-6
Identity = 34/115 (29.57%), Postives = 49/115 (42.61%), Query Frame = 1
Query:  112 VIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDILE----ISKNYG------LNIQISKITVKCPNENCSYECKLMEMN-EHLRLCSTRNVECP 423
            ++ N + D + C  C  I+    QA CG  FC  C NR + +G   C AC  ED+ E    I K  G         ++  +   CPNE C++   + E    H   C    + CP
Sbjct:   24 ILANCLEDKHLCNSCEKILRRPLQAQCGHRFCCFCFNRTVSSGPQKCSACIKEDLFEEPTSILKQGGAFHDNAARREVEALAAVCPNEGCTWTGTVKEYEASHEGSCDFTIIMCP 138          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000075241.1 (SMESG000075241.1)

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 322/473 (68.08%), Postives = 368/473 (77.80%), Query Frame = 1
Query:   61 INEKLNKISQLLSEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPA----CQCEDILEISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKVMSSEKLNDHFISNVEGHSKILIELIGQLRNEMRDLKENDTKKNESIESLRNEVDELKRNEAKNQSQITSLLISDTRNEAAIESLRNEINAIKHENQELKTLMRNSNNNLWNKLGQMDIEMNDRCRIDTVKSVNNAIEIMRIAGSELEQQMKIVDRKCQELNGNVKAETDKLVKEMREMRNYGMTKKVEILCQPQDXXXXXXXXXXXXKLHNGEIKWTIGKINEIKYMESDFFFDFLNPYKMQLRVENVKNRLEFQLWIYRKEFDDDNLSWPMKANVTIEIGLCSDMNVYKSMTMPCTVDKPKNNNWKSSDVIYFHHSLLRENKLFYENCVVLCYVTFC 1467
            +NEKLNKIS+LL EHKF + N+I +DY+C IC  I+NNA+QAICGCNFC+ECINR I+    +CP     C   ++     N+ LNIQISK+ +KCPNENCS++CKL++M+EHL  CS  +              +S  + N++  S+++    +LIE + QLRNE++D                                   L ++D R +  IESLRNEINAIKHENQELKTLMRNS+NNLW+KL QMDIEMND+CR DTVKS+ + +E M+I   ELE+QMKI+DRKCQELNGNVKAETDKLVKEMREMRNYGMTKKVEILCQPQDENETEEITEFLEKLHNGEIKWTIGKINEIKYMESD+FFDFLNPYKMQLRVENVKNRLEFQLWIYRKEFDDDNLSWPMKANV IEIGLCSDMNVYKSMTMPCTVDKPKNNNWKSSDVIYFHHSLLRENKLFYENCVVLCYVTFC
Sbjct:    1 MNEKLNKISKLLLEHKFSMANEINNDYQCGICKEIINNAYQAICGCNFCQECINRLIDRRVLHCPGNTDECSFSNLSCFVINHRLNIQISKLVLKCPNENCSHKCKLIDMDEHLSFCSIESD-----------NDISRVRRNENLESSIDSQINMLIESMAQLRNEVKD-----------------------------------LKLNDVRKDNVIESLRNEINAIKHENQELKTLMRNSDNNLWDKLNQMDIEMNDKCRNDTVKSIIDDVEAMKIDKLELEKQMKIIDRKCQELNGNVKAETDKLVKEMREMRNYGMTKKVEILCQPQDENETEEITEFLEKLHNGEIKWTIGKINEIKYMESDYFFDFLNPYKMQLRVENVKNRLEFQLWIYRKEFDDDNLSWPMKANVKIEIGLCSDMNVYKSMTMPCTVDKPKNNNWKSSDVIYFHHSLLRENKLFYENCVVLCYVTFC 427          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000075530.1 (SMESG000075530.1)

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 317/477 (66.46%), Postives = 354/477 (74.21%), Query Frame = 1
Query:   52 MSNINEKLNKISQLLSEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDILEISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKVMSSEKLNDHFISNVEGHSKILIELIGQLRNEMRDLKENDTKKNESIESLRNEVDELKRNEAKNQSQITSLLISDTRNEAAIESLRNEINAIKHENQELKTLMRNSNNNLWNKLGQMDIEMNDRCRIDTVKSVNNAIEIMRIAGSELEQQMKIVDRKCQELNGN------VKAETDKLVKEMREMRNYGMTKKVEILCQPQDXXXXXXXXXXXXKLHNGEIKWTIGKINEIKYMESDFFFDFLNPYKMQLRVENVKNRLEFQLWIYRKEFDDDNLSWPMKANVTIEIGLCSDMNVYKSMTMPCTVDKPKNNNWKSSDVIYFHHSLLRENKLFYENCVVLCYVTF 1464
            MSNIN+KLNKISQLLSEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGA CPACQCEDILEISKNYGLNIQISKITVKCPNENCSYECKL+EMNEHLRLCSTRNVECPFSGIGCQLK MSSEKLNDHFISNVEGHSKILIELIGQLRNEM+DLKEN TKK+E+IESLR                                   NEINAIKHEN+ELKTLMRNSNNNLWNKL QMDIEMNDRCRIDTVKSVN+AIEIMRIAGSELEQQMKIVDRKCQELNGN      VKAETDKL  E  ++  +        L  P                H+G +   IGKINE+K++ S+ F+DF N YKMQL ++N  N+   QL I+   FD+D L WP+KA + ++I   +D    KS+T  CT+ KP N +++SSD   F H+ L + K+   NC++ CYV F
Sbjct:    1 MSNINKKLNKISQLLSEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGAKCPACQCEDILEISKNYGLNIQISKITVKCPNENCSYECKLIEMNEHLRLCSTRNVECPFSGIGCQLKEMSSEKLNDHFISNVEGHSKILIELIGQLRNEMKDLKENSTKKDEAIESLR-----------------------------------NEINAIKHENKELKTLMRNSNNNLWNKLDQMDIEMNDRCRIDTVKSVNDAIEIMRIAGSELEQQMKIVDRKCQELNGNVQIIHQVKAETDKLTNETEKINKF--------LKMP----------------HDGHLLLPIGKINEMKFIWSEVFYDFQNLYKMQLMLKNAANKFNIQLRIHSGVFDED-LQWPVKAKINVDIISSNDFQAPKSLTKTCTITKPANYSYESSDQFSFAHTDLDKCKMLDNNCLIACYVEF 417          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000075241.1 (SMESG000075241.1)

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 308/455 (67.69%), Postives = 352/455 (77.36%), Query Frame = 1
Query:  115 IVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPA----CQCEDILEISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKVMSSEKLNDHFISNVEGHSKILIELIGQLRNEMRDLKENDTKKNESIESLRNEVDELKRNEAKNQSQITSLLISDTRNEAAIESLRNEINAIKHENQELKTLMRNSNNNLWNKLGQMDIEMNDRCRIDTVKSVNNAIEIMRIAGSELEQQMKIVDRKCQELNGNVKAETDKLVKEMREMRNYGMTKKVEILCQPQDXXXXXXXXXXXXKLHNGEIKWTIGKINEIKYMESDFFFDFLNPYKMQLRVENVKNRLEFQLWIYRKEFDDDNLSWPMKANVTIEIGLCSDMNVYKSMTMPCTVDKPKNNNWKSSDVIYFHHSLLRENKLFYENCVVLCYVTFC 1467
            + N+I +DY+C IC  I+NNA+QAICGCNFC+ECINR I+    +CP     C   ++     N+ LNIQISK+ +KCPNENCS++CKL++M+EHL  CS  +              +S  + N++  S+++    +LIE + QLRNE++D                                   L ++D R +  IESLRNEINAIKHENQELKTLMRNS+NNLW+KL QMDIEMND+CR DTVKS+ + +E M+I   ELE+QMKI+DRKCQELNGNVKAETDKLVKEMREMRNYGMTKKVEILCQPQDENETEEITEFLEKLHNGEIKWTIGKINEIKYMESD+FFDFLNPYKMQLRVENVKNRLEFQLWIYRKEFDDDNLSWPMKANV IEIGLCSDMNVYKSMTMPCTVDKPKNNNWKSSDVIYFHHSLLRENKLFYENCVVLCYVTFC
Sbjct:    1 MANEINNDYQCGICKEIINNAYQAICGCNFCQECINRLIDRRVLHCPGNTDECSFSNLSCFVINHRLNIQISKLVLKCPNENCSHKCKLIDMDEHLSFCSIESD-----------NDISRVRRNENLESSIDSQINMLIESMAQLRNEVKD-----------------------------------LKLNDVRKDNVIESLRNEINAIKHENQELKTLMRNSDNNLWDKLNQMDIEMNDKCRNDTVKSIIDDVEAMKIDKLELEKQMKIIDRKCQELNGNVKAETDKLVKEMREMRNYGMTKKVEILCQPQDENETEEITEFLEKLHNGEIKWTIGKINEIKYMESDYFFDFLNPYKMQLRVENVKNRLEFQLWIYRKEFDDDNLSWPMKANVKIEIGLCSDMNVYKSMTMPCTVDKPKNNNWKSSDVIYFHHSLLRENKLFYENCVVLCYVTFC 409          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000075530.1 (SMESG000075530.1)

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 292/411 (71.05%), Postives = 314/411 (76.40%), Query Frame = 1
Query:   52 MSNINEKLNKISQLLSEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDILEISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKVMSSEKLNDHFISNVEGHSKILIELIGQLRNEMRDLKENDTKKNESIESLRNEVDELKRNEAKNQSQITSLLISDTRNEAAIESLRNEINAIKHENQELKTLMRNSNNNLWNKLGQMDIEMNDRCRIDTVKSVNNAIEIMRIAGSELEQQMKIVDRKCQELNGN------VKAETDKLVKEMREMRNYGMTKKVEILCQPQDXXXXXXXXXXXXKLHNGEIKWTIGKINEIKYMESDFFFDFLNPYKMQLRVENVKNRLEFQLWIYRKEFDDDNLSWP 1266
            MSNIN+KLNKISQLLSEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGA CPACQCEDILEISKNYGLNIQISKITVKCPNENCSYECKL+EMNEHLRLCSTRNVECPFSGIGCQLK MSSEKLNDHFISNVEGHSKILIELIGQLRNEM+DLKEN TKK+E+IESLR                                   NEINAIKHEN+ELKTLMRNSNNNLWNKL QMDIEMNDRCRIDTVKSVN+AIEIMRIAGSELEQQMKIVDRKCQELNGN      VKAETDKL  E  ++  +        L  P                H+G +   IGKINE+K++ S+ F+DF N YKMQL ++N  N+   QL I+   FD+D L WP
Sbjct:    1 MSNINKKLNKISQLLSEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGAKCPACQCEDILEISKNYGLNIQISKITVKCPNENCSYECKLIEMNEHLRLCSTRNVECPFSGIGCQLKEMSSEKLNDHFISNVEGHSKILIELIGQLRNEMKDLKENSTKKDEAIESLR-----------------------------------NEINAIKHENKELKTLMRNSNNNLWNKLDQMDIEMNDRCRIDTVKSVNDAIEIMRIAGSELEQQMKIVDRKCQELNGNVQIIHQVKAETDKLTNETEKINKF--------LKMP----------------HDGHLLLPIGKINEMKFIWSEVFYDFQNLYKMQLMLKNAANKFNIQLRIHSGVFDED-LQWP 351          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000075344.1 (SMESG000075344.1)

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 289/477 (60.59%), Postives = 334/477 (70.02%), Query Frame = 1
Query:   52 MSNINEKLNKISQLLSEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGANCPACQCEDILEISKNYGLNIQISKITVKCPNENCSYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKVMSSEKLNDHFISNVEGHSKILIELIGQLRNEMRDLKENDTKKNESIESLRNEVDELKRNEAKNQSQITSLLISDTRNEAAIESLRNEINAIKHENQELKTLMRNSNNNLWNKLGQMDIEMNDRCRIDTVKSVNNAIEIMRIAGSELEQQMKIVDRKCQELNGN------VKAETDKLVKEMREMRNYGMTKKVEILCQPQDXXXXXXXXXXXXKLHNGEIKWTIGKINEIKYMESDFFFDFLNPYKMQLRVENVKNRLEFQLWIYRKEFDDDNLSWPMKANVTIEIGLCSDMNVYKSMTMPCTVDKPKNNNWKSSDVIYFHHSLLRENKLFYENCVVLCYVTF 1464
            MSNIN+KLNKISQLLSEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGA CPACQCE++L I+KNY LNI+ISKITVKCPNENCSYECKL+EMNEHLRLCSTRNVECPFSGIGCQLK MSSEKLNDHFISNVEGHSKILIELIGQLRNEM+DLKEN  KK+E+IESLR                                   NEI AIKHENQELKTL++NSNNNLW KL Q+D+EMN R    TVK +N+ IE MRIAGSELEQQMKIVDRKCQELNGN      VKAETDKL KE   +  +   +                        ++G + W IGKINE+K + S+ F+DF NPYK+QL + N  + +  QL IY   FD+D L WP+KA + I+I   +D    KS+T+ C + KP  N+++ S         L + ++   NC ++C V F
Sbjct:    1 MSNINKKLNKISQLLSEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFIENGGAKCPACQCENVLVITKNYLLNIRISKITVKCPNENCSYECKLIEMNEHLRLCSTRNVECPFSGIGCQLKEMSSEKLNDHFISNVEGHSKILIELIGQLRNEMKDLKENSMKKDEAIESLR-----------------------------------NEIKAIKHENQELKTLIKNSNNNLWIKLNQIDVEMNGRSNNGTVKHINDKIESMRIAGSELEQQMKIVDRKCQELNGNVQIIHQVKAETDKLTKETERINKFLKMR------------------------NSGHLLWPIGKINEMKMIGSEMFYDFQNPYKIQLWLINATDNMNIQLLIYSGAFDED-LQWPVKAKLNIQITSLNDDQQSKSLTISCRIPKPAKNSYEESAEFSVARVDLDKWQMLDNNCSLVCSVKF 417          
The following BLAST results are available for this feature:
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF31.124e-822.86TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF39.466e-822.76TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF39.466e-822.76TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF62.900e-733.67TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF62.900e-733.67TNF receptor associated factor 6 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf68.145e-725.34gene:FBgn0265464 transcript:FBtr0071188[more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b1.007e-931.30Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b1.007e-931.30Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b1.072e-931.30Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf61.048e-734.69TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf61.048e-734.69TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
egf5.114e-732.99epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
slc12a11.038e-631.01solute carrier family 12 member 1 [Source:Xenbase;... [more]
sytl22.601e-622.81synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
slc12a13.576e-631.01solute carrier family 12 member 1 [Source:Xenbase;... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf32.311e-823.21TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf32.311e-823.21TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf21.391e-731.40TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf52.474e-730.70TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf52.474e-730.70TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B6CJY4|TRAF6_CERAT4.955e-734.69TNF receptor-associated factor 6 OS=Cercocebus aty... [more]
sp|B6CJY5|TRAF6_MACMU5.130e-734.69TNF receptor-associated factor 6 OS=Macaca mulatta... [more]
sp|Q6IWL4|TRAF6_DANRE7.911e-734.69TNF receptor-associated factor 6 OS=Danio rerio OX... [more]
sp|P39429|TRAF2_MOUSE9.729e-731.40TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|Q3ZCC3|TRAF6_BOVIN1.035e-634.69TNF receptor-associated factor 6 OS=Bos taurus OX=... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZID84.323e-2733.70TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
T1E1011.077e-2225.59TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A0F7GWW31.140e-1734.90TNF receptor associated factor 4 (Fragment) OS=Sch... [more]
A0A2B4SG571.147e-1125.58TNF receptor-associated factor 4 OS=Stylophora pis... [more]
A0A1A6GSE28.210e-1125.10TNF receptor-associated factor OS=Neotoma lepida O... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b1.283e-928.19TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2a8.200e-727.83TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf51.005e-627.50TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf62.676e-633.33TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf63.749e-633.33TNF receptor associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf65.435e-628.18TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO347281.962e-726.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412439.995e-629.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
traf62.657e-835.05TNF receptor associated factor 6 [Source:NCBI gene... [more]
unm_sa8081.126e-627.27TNF receptor-associated factor 2 [Source:NCBI gene... [more]
ENSORLT00000001369.22.245e-627.73TNF receptor-associated factor 5 [Source:NCBI gene... [more]
ENSORLT00000020861.23.051e-629.57TNF receptor-associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075241.10.000e+068.08SMESG000075241.1[more]
SMESG000075530.10.000e+066.46SMESG000075530.1[more]
SMESG000075241.10.000e+067.69SMESG000075241.1[more]
SMESG000075530.10.000e+071.05SMESG000075530.1[more]
SMESG000075344.10.000e+060.59SMESG000075344.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004800 ID=SMED30004800|Name=TNF receptor associated factor-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1732bp
GTTGGATAATAATATTAAATTTTTTGAAATATTTTAATAATTATTGATTG
AATGTCGAATATAAATGAAAAATTGAATAAAATATCGCAGTTGTTATCAG
AGCATAAATTTGTGATTGTCAATGATATTACTGATGATTACAAATGCGCA
ATTTGCAATGGAATTGTCAACAATGCGCATCAAGCTATTTGCGGATGTAA
TTTCTGTGAGGAATGCATTAATAGATTTATTGAGAATGGCGGTGCCAATT
GTCCGGCATGCCAATGTGAAGATATATTAGAGATTTCAAAAAATTACGGA
TTGAATATTCAAATTTCTAAAATTACAGTGAAATGCCCAAATGAAAATTG
CAGTTATGAATGCAAGCTCATGGAAATGAATGAGCATTTGAGATTATGCT
CTACAAGAAATGTTGAATGCCCGTTCAGTGGCATTGGCTGTCAGCTGAAG
GTGATGAGCAGTGAGAAATTGAATGATCATTTCATTTCGAATGTTGAGGG
CCACAGTAAAATACTGATTGAATTGATCGGACAATTGAGAAATGAGATGA
GAGATTTGAAGGAAAACGATACGAAAAAAAATGAAAGTATTGAATCATTG
AGGAATGAGGTGGATGAACTGAAGAGAAACGAGGCTAAAAACCAATCACA
AATAACATCTTTATTAATAAGTGACACCAGAAACGAGGCAGCAATTGAAT
CATTGAGGAATGAAATCAATGCGATAAAACATGAAAATCAAGAACTGAAA
ACCCTGATGAGGAATAGTAATAATAATTTGTGGAACAAATTGGGTCAGAT
GGATATCGAGATGAATGACAGGTGCCGAATTGATACAGTGAAATCAGTAA
ATAATGCGATTGAAATTATGAGAATAGCTGGATCGGAATTGGAACAGCAA
ATGAAAATTGTTGACAGAAAATGCCAAGAATTGAATGGAAATGTGAAGGC
TGAAACGGATAAACTGGTTAAGGAAATGCGGGAAATGAGAAATTATGGAA
TGACAAAGAAAGTAGAAATATTGTGTCAACCGCAGGATGAAAATGAAACA
GAAGAAATCACTGAATTCCTTGAAAAGCTGCATAATGGTGAAATAAAGTG
GACAATCGGTAAAATCAACGAGATAAAATATATGGAAAGTGATTTTTTCT
TTGACTTTCTGAATCCGTATAAAATGCAATTGCGCGTGGAAAATGTAAAA
AATCGATTGGAATTTCAACTATGGATTTATCGAAAAGAATTTGATGATGA
CAATCTCAGCTGGCCAATGAAAGCTAATGTGACAATTGAAATTGGTTTGT
GTAGCGACATGAATGTCTACAAGTCAATGACAATGCCGTGCACTGTTGAT
AAACCCAAAAACAATAACTGGAAAAGCTCCGATGTCATCTATTTTCATCA
CTCGCTTTTAAGAGAAAACAAACTTTTTTATGAAAATTGCGTCGTTCTTT
GCTATGTGACATTTTGCTAAATAATTATCAATAATTATCATATGACTCAG
TGAAATTTTATTCGGGAATTAGGTTTTCATTTGCACGCCTTGCTGCCAAT
GTTGGTGATTATTTTAGCATTATATTGTTACAGGTGTATTATGAGCCCAC
CAGAGGAGGACAGCTCTATTCTCCCCTTGTGGGATAAATTGGTTTTTGGA
ATTAAACATTATTTCGCAACTTTTCAAAAATATTTTAAAATTCAAATTTT
GTAGAATTTATTTATTGTAAGATGAAAAGTTT
back to top

protein sequence of SMED30004800-orf-1

>SMED30004800-orf-1 ID=SMED30004800-orf-1|Name=SMED30004800-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=473bp
MSNINEKLNKISQLLSEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCN
FCEECINRFIENGGANCPACQCEDILEISKNYGLNIQISKITVKCPNENC
SYECKLMEMNEHLRLCSTRNVECPFSGIGCQLKVMSSEKLNDHFISNVEG
HSKILIELIGQLRNEMRDLKENDTKKNESIESLRNEVDELKRNEAKNQSQ
ITSLLISDTRNEAAIESLRNEINAIKHENQELKTLMRNSNNNLWNKLGQM
DIEMNDRCRIDTVKSVNNAIEIMRIAGSELEQQMKIVDRKCQELNGNVKA
ETDKLVKEMREMRNYGMTKKVEILCQPQDENETEEITEFLEKLHNGEIKW
TIGKINEIKYMESDFFFDFLNPYKMQLRVENVKNRLEFQLWIYRKEFDDD
NLSWPMKANVTIEIGLCSDMNVYKSMTMPCTVDKPKNNNWKSSDVIYFHH
SLLRENKLFYENCVVLCYVTFC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR001293Znf_TRAF
IPR013323SIAH-type
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
IPR008974TRAF-like
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0005515protein binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
GO:0006955immune response
GO:0007165signal transduction