TPA_inf: embryonic lethal abnormal vision 1-like protein

Overview
NameTPA_inf: embryonic lethal abnormal vision 1-like protein (DAA34917.1)
Smed IDSMED30004786
Length (bp)1880
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TPA_inf: embryonic lethal abnormal vision 1-like protein (SMED30004786) t-SNE clustered cells

Violin plots show distribution of expression levels for TPA_inf: embryonic lethal abnormal vision 1-like protein (SMED30004786) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004786

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30004786SMESG000081081.1 PL06018B2A09_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
testis primordiumSMED30004786SMESG000081081.1 Contig5361_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Human
Match: ELAVL4 (ELAV like RNA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:3315])

HSP 1 Score: 393.275 bits (1009), Expect = 5.035e-132
Identity = 214/386 (55.44%), Postives = 252/386 (65.28%), Query Frame = 3
Query:  297 VDWNG-TICERNME-SVTPSPTSN-----DSLNMNC-----------ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPA--------VAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            ++WNG  +    ME  V+  PTSN      S N NC           ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  + Q                       +PNR     P+   A   RL       D L  MA     F+P         V  +    T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:    1 MEWNGLKMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 363          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Human
Match: ELAVL4 (ELAV like RNA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:3315])

HSP 1 Score: 390.578 bits (1002), Expect = 4.444e-131
Identity = 209/370 (56.49%), Postives = 244/370 (65.95%), Query Frame = 3
Query:  339 VTPSPTSN-----DSLNMNC-----------ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPA--------VAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            V+  PTSN      S N NC           ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  + Q                       +PNR     P+   A   RL       D L  MA     F+P         V  +    T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:    5 VSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 351          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Human
Match: ELAVL4 (ELAV like RNA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:3315])

HSP 1 Score: 390.578 bits (1002), Expect = 5.089e-131
Identity = 209/370 (56.49%), Postives = 244/370 (65.95%), Query Frame = 3
Query:  339 VTPSPTSN-----DSLNMNC-----------ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPA--------VAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            V+  PTSN      S N NC           ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  + Q                       +PNR     P+   A   RL       D L  MA     F+P         V  +    T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   15 VSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 361          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Human
Match: ELAVL4 (ELAV like RNA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:3315])

HSP 1 Score: 390.578 bits (1002), Expect = 5.346e-131
Identity = 209/370 (56.49%), Postives = 244/370 (65.95%), Query Frame = 3
Query:  339 VTPSPTSN-----DSLNMNC-----------ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPA--------VAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            V+  PTSN      S N NC           ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  + Q                       +PNR     P+   A   RL       D L  MA     F+P         V  +    T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   12 VSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 358          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Human
Match: ELAVL4 (ELAV like RNA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:3315])

HSP 1 Score: 390.193 bits (1001), Expect = 5.957e-131
Identity = 209/370 (56.49%), Postives = 244/370 (65.95%), Query Frame = 3
Query:  339 VTPSPTSN-----DSLNMNC-----------ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPA--------VAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            V+  PTSN      S N NC           ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  + Q                       +PNR     P+   A   RL       D L  MA     F+P         V  +    T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   12 VSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 358          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Celegans
Match: exc-7 (pep chromosome:WBcel235:II:9575971:9581490:1 gene:WBGene00001368.1 transcript:F35H8.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:exc-7)

HSP 1 Score: 248.825 bits (634), Expect = 1.613e-75
Identity = 116/173 (67.05%), Postives = 142/173 (82.08%), Query Frame = 3
Query:  384 ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPST 902
            E+KTNLI+NYLP  MTQEEVR+LFTSIGE+ESCKLVRDK TG+SLGY FV +VR  DA +A+ + NGLRLQNKTIKVS ARPS++ IKG+NLY+ G+PK MT  ELE  F   G+IIT+RIL DN TGLS+GV F+RFD++ EA++AIK LNG +P   SE ITVKFAN+P++
Sbjct:   39 ESKTNLIINYLPQGMTQEEVRSLFTSIGEIESCKLVRDKVTGQSLGYGFVNYVREEDALRAVSSFNGLRLQNKTIKVSYARPSNDQIKGSNLYVSGIPKSMTLHELESIFRPFGQIITSRILSDNVTGLSKGVGFVRFDKKDEADVAIKTLNGSIPSGCSEQITVKFANNPAS 211          

HSP 2 Score: 96.2857 bits (238), Expect = 7.308e-21
Identity = 46/89 (51.69%), Postives = 61/89 (68.54%), Query Frame = 3
Query: 1110 AVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            +VAA+       G+C+FVYNLS +T++  LWQLF  FGA+  VKI+RD  T +CKG+ FV+MSNY EA  ++ SLNG  L  + LQV F
Sbjct:  361 SVAATLPPSDTAGYCLFVYNLSSDTDDTLLWQLFSQFGAIVNVKILRD-LTQQCKGYAFVSMSNYTEAYNAMLSLNGTNLAGKTLQVVF 448          

HSP 3 Score: 51.2174 bits (121), Expect = 1.734e-6
Identity = 22/57 (38.60%), Postives = 35/57 (61.40%), Query Frame = 3
Query: 1206 LFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            LF   G +++ K+VRD  T +  G+GFV     E+AL ++ S NG  L N+ ++VS+
Sbjct:   61 LFTSIGEIESCKLVRDKVTGQSLGYGFVNYVREEDALRAVSSFNGLRLQNKTIKVSY 117          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Celegans
Match: sup-26 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8])

HSP 1 Score: 85.5001 bits (210), Expect = 4.371e-18
Identity = 52/152 (34.21%), Postives = 76/152 (50.00%), Query Frame = 3
Query:  393 TNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILY--DNKTGLSRGVAFIRFDQRCEAEMAIKKLNG 842
            TNL +  L PN   + +R + +  G + S K + DK T    GY FV F  P  A  A+  LN      + ++  +A+   +     NLYI  LP   T+  LE + ++ G +I+ RIL   DN+   SRGV F R D + + E+ I  LNG
Sbjct:  107 TNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVDGLN-----TEGVQAQMAKLQQQEQDPTNLYIANLPLDFTEQMLETELNKFGMVISTRILRTPDNQ---SRGVGFARMDSKEKCEVIISALNG 250          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Celegans
Match: sup-26 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8])

HSP 1 Score: 85.5001 bits (210), Expect = 4.371e-18
Identity = 52/152 (34.21%), Postives = 76/152 (50.00%), Query Frame = 3
Query:  393 TNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILY--DNKTGLSRGVAFIRFDQRCEAEMAIKKLNG 842
            TNL +  L PN   + +R + +  G + S K + DK T    GY FV F  P  A  A+  LN      + ++  +A+   +     NLYI  LP   T+  LE + ++ G +I+ RIL   DN+   SRGV F R D + + E+ I  LNG
Sbjct:  107 TNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVDGLN-----TEGVQAQMAKLQQQEQDPTNLYIANLPLDFTEQMLETELNKFGMVISTRILRTPDNQ---SRGVGFARMDSKEKCEVIISALNG 250          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Celegans
Match: sup-26 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8])

HSP 1 Score: 84.7297 bits (208), Expect = 1.164e-17
Identity = 52/152 (34.21%), Postives = 76/152 (50.00%), Query Frame = 3
Query:  393 TNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILY--DNKTGLSRGVAFIRFDQRCEAEMAIKKLNG 842
            TNL +  L PN   + +R + +  G + S K + DK T    GY FV F  P  A  A+  LN      + ++  +A+   +     NLYI  LP   T+  LE + ++ G +I+ RIL   DN+   SRGV F R D + + E+ I  LNG
Sbjct:   43 TNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVDGLN-----TEGVQAQMAKLQQQEQDPTNLYIANLPLDFTEQMLETELNKFGMVISTRILRTPDNQ---SRGVGFARMDSKEKCEVIISALNG 186          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Celegans
Match: sup-26 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8])

HSP 1 Score: 85.1149 bits (209), Expect = 1.394e-17
Identity = 52/152 (34.21%), Postives = 76/152 (50.00%), Query Frame = 3
Query:  393 TNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILY--DNKTGLSRGVAFIRFDQRCEAEMAIKKLNG 842
            TNL +  L PN   + +R + +  G + S K + DK T    GY FV F  P  A  A+  LN      + ++  +A+   +     NLYI  LP   T+  LE + ++ G +I+ RIL   DN+   SRGV F R D + + E+ I  LNG
Sbjct:   43 TNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVDGLN-----TEGVQAQMAKLQQQEQDPTNLYIANLPLDFTEQMLETELNKFGMVISTRILRTPDNQ---SRGVGFARMDSKEKCEVIISALNG 186          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Fly
Match: fne (gene:FBgn0086675 transcript:FBtr0306739)

HSP 1 Score: 383.259 bits (983), Expect = 9.638e-129
Identity = 199/349 (57.02%), Postives = 243/349 (69.63%), Query Frame = 3
Query:  378 NCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTT---------------GESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQ-QLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            N E++TNLIVNYLP  MTQEE+R+LF+SIGE+ESCKLVRDK +               G+SLGY FV +VR  DAEKA+ TLNGLRLQNK IKVS ARPSSESIKGANLY+ GLPK ++Q +LE  F+  GKIIT+RIL DN +GLS+GV FIRFDQR EAE AI++LNG  P   +EPITVKFAN+PS + +                   ++A  TP  +     +   L S  R++Y     DLL     AN +          A+T +GWCIFVYNL+PETEE  LWQLFGPFGAVQ+VK++RD  T+KCKGFGFVTM+NY+EA+++IQSLNG+ LGNRVLQVSF
Sbjct:   21 NDESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSVLPASLTALNPALQQGQSLGYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYARPSSESIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNGKTPKGYAEPITVKFANNPSNSAKAQ-------------IAPPLTAYLTPQAAAATRRLAGALPSAGRIRYSPLAGDLL-----ANSIL------PGNAMTGSGWCIFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSLNGYTLGNRVLQVSF 345          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Fly
Match: fne (gene:FBgn0086675 transcript:FBtr0343650)

HSP 1 Score: 383.259 bits (983), Expect = 9.638e-129
Identity = 199/349 (57.02%), Postives = 243/349 (69.63%), Query Frame = 3
Query:  378 NCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTT---------------GESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQ-QLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            N E++TNLIVNYLP  MTQEE+R+LF+SIGE+ESCKLVRDK +               G+SLGY FV +VR  DAEKA+ TLNGLRLQNK IKVS ARPSSESIKGANLY+ GLPK ++Q +LE  F+  GKIIT+RIL DN +GLS+GV FIRFDQR EAE AI++LNG  P   +EPITVKFAN+PS + +                   ++A  TP  +     +   L S  R++Y     DLL     AN +          A+T +GWCIFVYNL+PETEE  LWQLFGPFGAVQ+VK++RD  T+KCKGFGFVTM+NY+EA+++IQSLNG+ LGNRVLQVSF
Sbjct:   21 NDESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSVLPASLTALNPALQQGQSLGYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYARPSSESIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNGKTPKGYAEPITVKFANNPSNSAKAQ-------------IAPPLTAYLTPQAAAATRRLAGALPSAGRIRYSPLAGDLL-----ANSIL------PGNAMTGSGWCIFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSLNGYTLGNRVLQVSF 345          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Fly
Match: fne (gene:FBgn0086675 transcript:FBtr0343651)

HSP 1 Score: 383.259 bits (983), Expect = 9.638e-129
Identity = 199/349 (57.02%), Postives = 243/349 (69.63%), Query Frame = 3
Query:  378 NCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTT---------------GESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQ-QLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            N E++TNLIVNYLP  MTQEE+R+LF+SIGE+ESCKLVRDK +               G+SLGY FV +VR  DAEKA+ TLNGLRLQNK IKVS ARPSSESIKGANLY+ GLPK ++Q +LE  F+  GKIIT+RIL DN +GLS+GV FIRFDQR EAE AI++LNG  P   +EPITVKFAN+PS + +                   ++A  TP  +     +   L S  R++Y     DLL     AN +          A+T +GWCIFVYNL+PETEE  LWQLFGPFGAVQ+VK++RD  T+KCKGFGFVTM+NY+EA+++IQSLNG+ LGNRVLQVSF
Sbjct:   21 NDESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSVLPASLTALNPALQQGQSLGYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYARPSSESIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNGKTPKGYAEPITVKFANNPSNSAKAQ-------------IAPPLTAYLTPQAAAATRRLAGALPSAGRIRYSPLAGDLL-----ANSIL------PGNAMTGSGWCIFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSLNGYTLGNRVLQVSF 345          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Fly
Match: fne (gene:FBgn0086675 transcript:FBtr0306738)

HSP 1 Score: 382.489 bits (981), Expect = 2.327e-128
Identity = 199/352 (56.53%), Postives = 243/352 (69.03%), Query Frame = 3
Query:  378 NCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTG------------------ESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQ-QLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            N E++TNLIVNYLP  MTQEE+R+LF+SIGE+ESCKLVRDK +G                  +SLGY FV +VR  DAEKA+ TLNGLRLQNK IKVS ARPSSESIKGANLY+ GLPK ++Q +LE  F+  GKIIT+RIL DN +GLS+GV FIRFDQR EAE AI++LNG  P   +EPITVKFAN+PS + +                   ++A  TP  +     +   L S  R++Y     DLL     AN +          A+T +GWCIFVYNL+PETEE  LWQLFGPFGAVQ+VK++RD  T+KCKGFGFVTM+NY+EA+++IQSLNG+ LGNRVLQVSF
Sbjct:   21 NDESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQQGQSLGYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYARPSSESIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNGKTPKGYAEPITVKFANNPSNSAKAQ-------------IAPPLTAYLTPQAAAATRRLAGALPSAGRIRYSPLAGDLL-----ANSIL------PGNAMTGSGWCIFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSLNGYTLGNRVLQVSF 348          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Fly
Match: fne (gene:FBgn0086675 transcript:FBtr0333319)

HSP 1 Score: 382.489 bits (981), Expect = 2.327e-128
Identity = 199/352 (56.53%), Postives = 243/352 (69.03%), Query Frame = 3
Query:  378 NCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTG------------------ESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQ-QLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            N E++TNLIVNYLP  MTQEE+R+LF+SIGE+ESCKLVRDK +G                  +SLGY FV +VR  DAEKA+ TLNGLRLQNK IKVS ARPSSESIKGANLY+ GLPK ++Q +LE  F+  GKIIT+RIL DN +GLS+GV FIRFDQR EAE AI++LNG  P   +EPITVKFAN+PS + +                   ++A  TP  +     +   L S  R++Y     DLL     AN +          A+T +GWCIFVYNL+PETEE  LWQLFGPFGAVQ+VK++RD  T+KCKGFGFVTM+NY+EA+++IQSLNG+ LGNRVLQVSF
Sbjct:   21 NDESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQQGQSLGYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYARPSSESIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNGKTPKGYAEPITVKFANNPSNSAKAQ-------------IAPPLTAYLTPQAAAATRRLAGALPSAGRIRYSPLAGDLL-----ANSIL------PGNAMTGSGWCIFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSLNGYTLGNRVLQVSF 348          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Zebrafish
Match: elavl4 (ELAV like neuron-specific RNA binding protein 4 [Source:NCBI gene;Acc:30737])

HSP 1 Score: 390.963 bits (1003), Expect = 8.716e-131
Identity = 206/352 (58.52%), Postives = 238/352 (67.61%), Query Frame = 3
Query:  345 PSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGAL--------TATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            PSP        N ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  T Q                       +PNR     P+   A   RL       D L  MA     F+P    S  +L        T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   74 PSPMQTGG--SNDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNPSQKTSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDSMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 400          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Zebrafish
Match: elavl4 (ELAV like neuron-specific RNA binding protein 4 [Source:NCBI gene;Acc:30737])

HSP 1 Score: 388.267 bits (996), Expect = 7.558e-130
Identity = 198/333 (59.46%), Postives = 234/333 (70.27%), Query Frame = 3
Query:  378 NCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            N ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  T Q                       +PNR     P+   A   R ++    ID + ++   N      +   TG    TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   83 NDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNPSQKTSQ---------------ALLSQLYQSPNR-RYPGPLHHQA--QRFRFSPITIDSMTSLVGMN------IPGHTG----TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 387          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Zebrafish
Match: elavl4 (ELAV like neuron-specific RNA binding protein 4 [Source:NCBI gene;Acc:30737])

HSP 1 Score: 385.571 bits (989), Expect = 9.564e-129
Identity = 206/355 (58.03%), Postives = 238/355 (67.04%), Query Frame = 3
Query:  345 PSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYD---NKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGAL--------TATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            PSP        N ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D     TG SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  T Q                       +PNR     P+   A   RL       D L  MA     F+P    S  +L        T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   66 PSPMQTGG--SNDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGPTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNPSQKTSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDSMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 395          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Zebrafish
Match: elavl4 (ELAV like neuron-specific RNA binding protein 4 [Source:NCBI gene;Acc:30737])

HSP 1 Score: 385.571 bits (989), Expect = 1.195e-128
Identity = 206/355 (58.03%), Postives = 238/355 (67.04%), Query Frame = 3
Query:  345 PSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYD---NKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGAL--------TATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            PSP        N ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D     TG SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  T Q                       +PNR     P+   A   RL       D L  MA     F+P    S  +L        T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   74 PSPMQTGG--SNDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGPTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNPSQKTSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDSMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 403          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Zebrafish
Match: elavl3 (ELAV like neuron-specific RNA binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-980526-76])

HSP 1 Score: 382.874 bits (982), Expect = 1.468e-128
Identity = 193/331 (58.31%), Postives = 234/331 (70.69%), Query Frame = 3
Query:  384 ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            ++KTNLIVNYLP NMTQEE ++LF SIGE+ESCKLVRDK TG+SLGY FV +V PNDA+KAI TLNGL+LQ KTIKVS ARPSS SI+ ANLY+ GLPK M+Q ++E+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  T Q                A ++ +          P+       R ++    ID + ++A  N L  P         T  GWCIFVYNLSPE +E+ LWQLFGPFGAV  VK++RD TTNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   35 DSKTNLIVNYLPQNMTQEEFKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKDMEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRNEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKTGQ----------------ALLTQLYQTAARRYTGPLHH--QTQRFRFSPITIDSMTSLAGVN-LTGP---------TGAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 337          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Xenopus
Match: psmc3 (proteasome 26S subunit, ATPase 3 [Source:Xenbase;Acc:XB-GENE-1009848])

HSP 1 Score: 391.349 bits (1004), Expect = 9.013e-132
Identity = 203/347 (58.50%), Postives = 241/347 (69.45%), Query Frame = 3
Query:  339 VTPSPTSNDSLNMNCEN-KTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            V+  PTSN S     ++ KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  T Q                       +PNR     P+   A   R ++    ID + ++   N      +   TG    TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   14 VSNGPTSNTSNGAATDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNPSQKTSQ---------------ALLSQLYQSPNR-RYPGPLHHQA--QRFRFSPITIDGMTSLVGMN------IPGHTG----TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 332          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Xenopus
Match: psmc3 (proteasome 26S subunit, ATPase 3 [Source:Xenbase;Acc:XB-GENE-1009848])

HSP 1 Score: 390.578 bits (1002), Expect = 6.203e-131
Identity = 201/339 (59.29%), Postives = 234/339 (69.03%), Query Frame = 3
Query:  384 ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPA--------VAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  T Q                       +PNR     P+   A   RL       D L  MA     F+P         V  +    T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   56 DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNPSQKTSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 371          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Xenopus
Match: trerf1 (transcriptional regulating factor 1 [Source:Xenbase;Acc:XB-GENE-940630])

HSP 1 Score: 382.489 bits (981), Expect = 2.010e-128
Identity = 200/346 (57.80%), Postives = 237/346 (68.50%), Query Frame = 3
Query:  351 PTSNDSLNMNCEN----KTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            PT N++ N    N    KTNLIVNYLP NMTQEE+++LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS                    T       +PNR       QQ    SR  +    ID + ++A  N    P  A        TGWCIFVYNL+P+ +E+ LWQ+FGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:    9 PTCNNTANFESSNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKVNH---------------TILSQLYQSPNRRYPGPLAQQAQRFSR--FSPMTIDGMTSLAGIN---FPGHA-------GTGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 327          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Xenopus
Match: pnpla2 (patatin like phospholipase domain containing 2 [Source:Xenbase;Acc:XB-GENE-953517])

HSP 1 Score: 382.489 bits (981), Expect = 5.226e-128
Identity = 199/340 (58.53%), Postives = 234/340 (68.82%), Query Frame = 3
Query:  384 ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAP---------AVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            ++KTNLIVNYLP NMTQEE ++LF SIGE+ESCKLVRDK TG+SLGY FV +V PNDA+KAI TLNGL+LQ KTIKVS ARPSS SI+ ANLY+  LPK M Q E+E+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  +SEPITVKFAN+PS  T Q                A ++ +          P+       RL       D L  MA     F+P         A  + TG  TA GWCIFVYNLSPE +E+ LWQLFGPFGAV  VK++RD TTNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   32 DSKTNLIVNYLPQNMTQEEFKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSSLPKTMNQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGASEPITVKFANNPSQKTGQ----------------ALLTHLYQTTARRYTGPLHHQTQRFRL-------DSLINMAYGVKRFSPITIDSVTNLAGVSLTGPTTA-GWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 347          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Xenopus
Match: trerf1 (transcriptional regulating factor 1 [Source:Xenbase;Acc:XB-GENE-940630])

HSP 1 Score: 380.563 bits (976), Expect = 5.329e-127
Identity = 203/373 (54.42%), Postives = 245/373 (65.68%), Query Frame = 3
Query:  303 WNGTICERNMESVTPSPTSNDSLNM-----NC----------ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            W G +       ++  PT N++ N      NC          ++KTNLIVNYLP NMTQEE+++LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS                    T       +PNR       QQ    SR  +    ID + ++A  N    P  A        TGWCIFVYNL+P+ +E+ LWQ+FGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   22 WTGQVIAAMETQLSNGPTCNNTANCPNTINNCSSPVESSNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKVNH---------------TILSQLYQSPNRRYPGPLAQQAQRFSR--FSPMTIDGMTSLAGIN---FPGHA-------GTGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 367          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Mouse
Match: Elavl4 (ELAV like RNA binding protein 4 [Source:MGI Symbol;Acc:MGI:107427])

HSP 1 Score: 393.275 bits (1009), Expect = 3.311e-132
Identity = 214/386 (55.44%), Postives = 252/386 (65.28%), Query Frame = 3
Query:  297 VDWNG-TICERNME-SVTPSPTSN-----DSLNMNC-----------ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPA--------VAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            ++WNG  +    ME  V+  PTSN      S N NC           ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  + Q                       +PNR     P+   A   RL       D L  MA     F+P         V  +    T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:    1 MEWNGLKMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 363          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Mouse
Match: Elavl4 (ELAV like RNA binding protein 4 [Source:MGI Symbol;Acc:MGI:107427])

HSP 1 Score: 390.578 bits (1002), Expect = 3.874e-131
Identity = 209/370 (56.49%), Postives = 244/370 (65.95%), Query Frame = 3
Query:  339 VTPSPTSN-----DSLNMNC-----------ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPA--------VAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            V+  PTSN      S N NC           ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  + Q                       +PNR     P+   A   RL       D L  MA     F+P         V  +    T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   12 VSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 358          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Mouse
Match: Elavl4 (ELAV like RNA binding protein 4 [Source:MGI Symbol;Acc:MGI:107427])

HSP 1 Score: 390.578 bits (1002), Expect = 3.916e-131
Identity = 209/370 (56.49%), Postives = 244/370 (65.95%), Query Frame = 3
Query:  339 VTPSPTSN-----DSLNMNC-----------ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPA--------VAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            V+  PTSN      S N NC           ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  + Q                       +PNR     P+   A   RL       D L  MA     F+P         V  +    T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   12 VSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 358          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Mouse
Match: Elavl4 (ELAV like RNA binding protein 4 [Source:MGI Symbol;Acc:MGI:107427])

HSP 1 Score: 389.808 bits (1000), Expect = 1.075e-130
Identity = 209/370 (56.49%), Postives = 244/370 (65.95%), Query Frame = 3
Query:  339 VTPSPTSN-----DSLNMNC-----------ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPA--------VAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            V+  PTSN      S N NC           ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  + Q                       +PNR     P+   A   RL       D L  MA     F+P         V  +    T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   29 VSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 375          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Mouse
Match: Elavl4 (ELAV like RNA binding protein 4 [Source:MGI Symbol;Acc:MGI:107427])

HSP 1 Score: 388.652 bits (997), Expect = 1.625e-130
Identity = 205/362 (56.63%), Postives = 244/362 (67.40%), Query Frame = 3
Query:  339 VTPSPTSN-----DSLNMNC-----------ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            V+  PTSN      S N NC           ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  + Q                       +PNR     P+   A   R ++    ID + ++   N      +   TG    TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   15 VSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQ---------------ALLSQLYQSPNR-RYPGPLHHQA--QRFRFSPITIDGMTSLVGMN------IPGHTG----TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 348          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. UniProt/SwissProt
Match: sp|P26378|ELAV4_HUMAN (ELAV-like protein 4 OS=Homo sapiens OX=9606 GN=ELAVL4 PE=1 SV=3)

HSP 1 Score: 387.497 bits (994), Expect = 6.420e-129
Identity = 214/393 (54.45%), Postives = 254/393 (64.63%), Query Frame = 3
Query:  297 VDWNG--TICERNMESVTPSPTSN-----DSLNMNC-----------ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLK---YPSSGIDLL---PAMATA-NPLFAPA--------VAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            ++WNG   I       V+  PTSN      S N NC           ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  + Q                       +PNR     P+   A   RL      + G+  L   P   +A  P F+P         V  +    T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:    1 MEWNGLKMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACPPRFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 377          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. UniProt/SwissProt
Match: sp|O09032|ELAV4_RAT (ELAV-like protein 4 OS=Rattus norvegicus OX=10116 GN=Elavl4 PE=1 SV=2)

HSP 1 Score: 387.497 bits (994), Expect = 7.469e-129
Identity = 214/393 (54.45%), Postives = 254/393 (64.63%), Query Frame = 3
Query:  297 VDWNG--TICERNMESVTPSPTSN-----DSLNMNC-----------ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLK---YPSSGIDLL---PAMATA-NPLFAPA--------VAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            ++WNG   I       V+  PTSN      S N NC           ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  + Q                       +PNR     P+   A   RL      + G+  L   P   +A  P F+P         V  +    T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:    1 MEWNGLKMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACPPRFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 377          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. UniProt/SwissProt
Match: sp|Q61701|ELAV4_MOUSE (ELAV-like protein 4 OS=Mus musculus OX=10090 GN=Elavl4 PE=1 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 7.469e-129
Identity = 214/393 (54.45%), Postives = 254/393 (64.63%), Query Frame = 3
Query:  297 VDWNG--TICERNMESVTPSPTSN-----DSLNMNC-----------ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLK---YPSSGIDLL---PAMATA-NPLFAPA--------VAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            ++WNG   I       V+  PTSN      S N NC           ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  + Q                       +PNR     P+   A   RL      + G+  L   P   +A  P F+P         V  +    T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:    1 MEWNGLKMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACPPRFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 377          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. UniProt/SwissProt
Match: sp|Q5R9Z6|ELAV2_PONAB (ELAV-like protein 2 OS=Pongo abelii OX=9601 GN=ELAVL2 PE=2 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 4.241e-128
Identity = 198/339 (58.41%), Postives = 234/339 (69.03%), Query Frame = 3
Query:  384 ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALT--------ATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            ++KTNLIVNYLP NMTQEE+++LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  T Q                       +PNR     P+ Q A   RL       D L  MA     F+P       +L          TGWCIFVYNL+P+ +E+ LWQ+FGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   36 DSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKTNQ---------------AILSQLYQSPNRR-YPGPLAQQAQRFRL-------DNLLNMAYGVKRFSPMTIDGMTSLAGINIPGHPGTGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 351          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. UniProt/SwissProt
Match: sp|Q12926|ELAV2_HUMAN (ELAV-like protein 2 OS=Homo sapiens OX=9606 GN=ELAVL2 PE=1 SV=2)

HSP 1 Score: 384.415 bits (986), Expect = 4.241e-128
Identity = 198/339 (58.41%), Postives = 234/339 (69.03%), Query Frame = 3
Query:  384 ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALT--------ATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            ++KTNLIVNYLP NMTQEE+++LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  T Q                       +PNR     P+ Q A   RL       D L  MA     F+P       +L          TGWCIFVYNL+P+ +E+ LWQ+FGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   36 DSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKTNQ---------------AILSQLYQSPNRR-YPGPLAQQAQRFRL-------DNLLNMAYGVKRFSPMTIDGMTSLAGINIPGHPGTGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 351          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. TrEMBL
Match: F9W2W2 (Embryonic lethal abnormal vision 1-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 810.061 bits (2091), Expect = 0.000e+0
Identity = 466/466 (100.00%), Postives = 466/466 (100.00%), Query Frame = 3
Query:   87 MSNQESMPDEMTNCSNAIISSTTDQRASGDTGDHCKEXXXXXXXXXXXXXXXXXXXXXXXXENQSSLMGQVDWNGTICERNMESVTPSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSFXXXXXXXXXXXXXXXXXXXXXXXXXESLLTATAVVE 1484
            MSNQESMPDEMTNCSNAIISSTTDQRASGDTGDHCKENKSSNQESNNLLNSDSSLDDVNGSENQSSLMGQVDWNGTICERNMESVTPSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNLSLALLKQAAQLQTAAVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSFKSTPNPKMKTSSTSPTSSPIPASCSESLLTATAVVE
Sbjct:    1 MSNQESMPDEMTNCSNAIISSTTDQRASGDTGDHCKENKSSNQESNNLLNSDSSLDDVNGSENQSSLMGQVDWNGTICERNMESVTPSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNLSLALLKQAAQLQTAAVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSFKSTPNPKMKTSSTSPTSSPIPASCSESLLTATAVVE 466          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. TrEMBL
Match: A0A0A7M220 (Embryonic lethal abnormal vision 3 (Fragment) OS=Schmidtea polychroa OX=50054 GN=elav3 PE=2 SV=1)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 290/292 (99.32%), Postives = 292/292 (100.00%), Query Frame = 3
Query:  501 TTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            TTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAE+AIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNLSLALLKQAAQLQTAAVSAVSTPNRSNLLSPIQQLASISRLKYP+SGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF
Sbjct:    1 TTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAELAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNLSLALLKQAAQLQTAAVSAVSTPNRSNLLSPIQQLASISRLKYPTSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 292          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. TrEMBL
Match: E2IXF8 (ELAV2 OS=Schmidtea mediterranea OX=79327 GN=elav2 PE=2 SV=1)

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 265/336 (78.87%), Postives = 304/336 (90.48%), Query Frame = 3
Query:  369 LNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            L+ + +NKTNLIVNYLPPNMTQEEVRALF+SIG VESCKLVRDKTTGESLGY+FVK++   DAEKAI+TLNGLRLQNKTIKVSLARPSSE+IKGANLYICGLPKKMTQ+ELE  FSQCGKIITARILYDNKTGLSRGVAFIRFDQR EA++AIKKLN + P+NS+EPI VKFANSPS T+RQDN+SLA+LKQAAQ+      + +  +RS+L+SP+QQLAS++RLKYP+S +D +P++   N L APA AASTGALTATGWCIFVYNL+PET++ATLWQLFGPFGAVQTVKI+RD+ TNKCKGFGFVTMSNYEEALL+IQSLNGF LGNR+LQVSF
Sbjct:   45 LSNSLDNKTNLIVNYLPPNMTQEEVRALFSSIGVVESCKLVRDKTTGESLGYSFVKYLNYPDAEKAIRTLNGLRLQNKTIKVSLARPSSEAIKGANLYICGLPKKMTQMELENLFSQCGKIITARILYDNKTGLSRGVAFIRFDQRSEAQLAIKKLNSYQPENSTEPIIVKFANSPS-TSRQDNISLAILKQAAQIPNQNAQSANPQSRSSLISPLQQLASVARLKYPTS-MDFMPSLTGNNSLLAPAFAASTGALTATGWCIFVYNLAPETDDATLWQLFGPFGAVQTVKIIRDTATNKCKGFGFVTMSNYEEALLAIQSLNGFTLGNRILQVSF 378          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. TrEMBL
Match: A0A5J4NBP7 (ELAV like protein 2/3/4 OS=Paragonimus westermani OX=34504 GN=DEA37_0006880 PE=4 SV=1)

HSP 1 Score: 516.153 bits (1328), Expect = 5.894e-169
Identity = 285/397 (71.79%), Postives = 317/397 (79.85%), Query Frame = 3
Query:  300 DWNGTICERNMESVTPSPTSNDSLNMNCE----NKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNG------HMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNR------------SNLLSPIQQLASIS-RLKY--------PSSG---IDLLPAMATA----NPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            +W  T  + N      SPT N  +++N      NKTNLIVNYLPP M+QEEV+ALF+SIGEVESCKLVR+K TGESLGYAFVK++R  DAEKAI+TLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQ ELEE F+QCG+IITARILYDNKTGLSRGVAFIRFDQR EAE+AI++LNG      H  D  SEPITVKFANSP+ + R D+LSLALLKQAAQLQ+ A S V+ P+R            + LLSP+QQ+ASIS RLKY         S+G    D LPAMA+A    NPL APAVAAS+GALTATGWCIFVYNL+PETEEA LWQLFGPFGAVQTVKI+RD TTNKCKGFGFVTMSNYEEALL+I SLNGFALGNRVLQVSF
Sbjct:  332 EWLSTALQSN------SPTDNGVMSINYSSDNTNKTNLIVNYLPPFMSQEEVKALFSSIGEVESCKLVREKATGESLGYAFVKYIRAADAEKAIRTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQAELEELFNQCGRIITARILYDNKTGLSRGVAFIRFDQRHEAELAIRRLNGYQAPPEHPNDAPSEPITVKFANSPN-SIRHDSLSLALLKQAAQLQSVAASVVTPPSRTAATAAATAVAAAGLLSPLQQIASISNRLKYSNALTGGGASAGACPADFLPAMASAAAVVNPLLAPAVAASSGALTATGWCIFVYNLAPETEEANLWQLFGPFGAVQTVKIIRDPTTNKCKGFGFVTMSNYEEALLAIHSLNGFALGNRVLQVSF 721          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. TrEMBL
Match: A0A183TIH1 (ELAV-like protein 2 OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS16269 PE=4 SV=1)

HSP 1 Score: 508.834 bits (1309), Expect = 1.326e-166
Identity = 277/381 (72.70%), Postives = 309/381 (81.10%), Query Frame = 3
Query:  351 PTSNDSLNMNCE-----NKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSS------EPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRS------------NLLSPIQQLASIS-RLKY-----------PSSGIDLLP----AMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            P S DS +++ +     NKTNLIVNYLPP MTQ+EV+ALF+SIGEVESCKLVR+K +GESLGYAFVKFVR NDAEKAI+TLNGLRLQNKTIKVSLARPSSESIKGANLYICGLP+KMTQ ELEE FSQCGKIITARILYDNKTGLSRGVAFIRFDQR EAE+AI++LNG+ P +        EPITVKFANSP+ + R D+LSLALLKQAAQLQ+ A S V+ P RS             LL+P+QQ+ASIS RLKY           P++  D LP    A A  NPL APA+AAS+GALTATGWCIFVYNL+PETEE+ LWQLFGPFGAVQTVKI+RD TTNKCKGFGFVTMSNYEEALL+I SLNGFALGNRVLQVSF
Sbjct:  328 PASADSCSISGQSGEPVNKTNLIVNYLPPYMTQDEVKALFSSIGEVESCKLVREKASGESLGYAFVKFVRANDAEKAIRTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPRKMTQAELEELFSQCGKIITARILYDNKTGLSRGVAFIRFDQRHEAELAIRRLNGYQPPSDYPGASPLEPITVKFANSPN-SIRHDSLSLALLKQAAQLQSVAASVVTPPTRSAATAAATAVAAAGLLNPLQQIASISNRLKYSTALAGGAHNQPANASDFLPAVASAAAVVNPLLAPAMAASSGALTATGWCIFVYNLAPETEESNLWQLFGPFGAVQTVKIIRDPTTNKCKGFGFVTMSNYEEALLAIHSLNGFALGNRVLQVSF 707          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Cavefish
Match: elavl4 (ELAV like neuron-specific RNA binding protein 4 [Source:NCBI gene;Acc:30737])

HSP 1 Score: 390.963 bits (1003), Expect = 2.868e-131
Identity = 206/352 (58.52%), Postives = 238/352 (67.61%), Query Frame = 3
Query:  345 PSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGAL--------TATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            PSP        N ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  T Q                       +PNR     P+   A   RL       D L  MA     F+P    S  +L        T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   43 PSPMQTSG--SNDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNPSQKTSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDSMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 369          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Cavefish
Match: elavl4 (ELAV like neuron-specific RNA binding protein 4 [Source:NCBI gene;Acc:30737])

HSP 1 Score: 390.963 bits (1003), Expect = 3.311e-131
Identity = 206/352 (58.52%), Postives = 238/352 (67.61%), Query Frame = 3
Query:  345 PSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGAL--------TATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            PSP        N ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  T Q                       +PNR     P+   A   RL       D L  MA     F+P    S  +L        T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   45 PSPMQTSG--SNDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNPSQKTSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDSMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 371          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Cavefish
Match: elavl4 (ELAV like neuron-specific RNA binding protein 4 [Source:NCBI gene;Acc:30737])

HSP 1 Score: 390.963 bits (1003), Expect = 6.630e-131
Identity = 206/352 (58.52%), Postives = 238/352 (67.61%), Query Frame = 3
Query:  345 PSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGAL--------TATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            PSP        N ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  T Q                       +PNR     P+   A   RL       D L  MA     F+P    S  +L        T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   74 PSPMQTSG--SNDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNPSQKTSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDSMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 400          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Cavefish
Match: elavl4 (ELAV like neuron-specific RNA binding protein 4 [Source:NCBI gene;Acc:30737])

HSP 1 Score: 388.267 bits (996), Expect = 5.938e-130
Identity = 201/344 (58.43%), Postives = 237/344 (68.90%), Query Frame = 3
Query:  345 PSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            PSP        N ++KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  T Q                       +PNR     P+   A   R ++    ID + ++   N      +   TG    TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   74 PSPMQTSG--SNDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNPSQKTSQ---------------ALLSQLYQSPNR-RYPGPLHHQA--QRFRFSPITIDSMTSLVGMN------IPGHTG----TGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 387          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Cavefish
Match: ELAVL2 (ELAV like RNA binding protein 2 [Source:NCBI gene;Acc:103047015])

HSP 1 Score: 386.341 bits (991), Expect = 2.567e-129
Identity = 209/375 (55.73%), Postives = 245/375 (65.33%), Query Frame = 3
Query:  306 NGTICERNMESVTPSPTSNDSLNMNC----------ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGAL--------TATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            NG  C  N  S  P+P SN     NC          ++KTNLIVNYLP NMTQEE+++LF SIGE+ESCKLVRDK TG+SLGY FV +V P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  +SEPITVKFAN+PS  T Q                       +PNR     P+ Q A   RL       +LL         F+P       +L          TGWCIFVYNL+P+ +E+ LWQ+FGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   36 NGPTC--NNTSNGPAPISN-----NCSSPVESTGIEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDRRVEAEEAIKGLNGQKPPGASEPITVKFANNPSQKTSQ---------------ALLSQLYQSPNR-RYPGPLAQQAQRFRLD------NLLNMAYGVKSRFSPMAIDGVTSLAGINIPGHAGTGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 381          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008168.1 (pep scaffold:Pmarinus_7.0:GL476829:41182:80090:-1 gene:ENSPMAG00000007358.1 transcript:ENSPMAT00000008168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.99 bits (258), Expect = 4.391e-24
Identity = 67/193 (34.72%), Postives = 97/193 (50.26%), Query Frame = 3
Query:  339 VTPSPTSNDSLNMNCE---NKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDN------SSEPITVKFAN 890
            + PSP+++ S N       +KTNL +  LPP  T +++  L    G++ S K + DKTT +  GY FV F  P+ A+KA+  L    +Q +  K     P+       NLYI  LP  + + ELE    Q G +I+ RIL D   G SRGV F R +   + E  I++ NG    +       SEP+  KFA+
Sbjct:   14 MAPSPSTHSSANSTSGEQLSKTNLYIRGLPPGTTDQDLVKLCQPYGKIVSTKAILDKTTNQCKGYGFVDFDGPSAAQKAVTALKASGIQAQMAKQQEQDPT-------NLYISNLPVTIDEQELEGMLKQFGHVISTRILRD-IVGTSRGVGFARMESTEKCEAVIQRFNGKFLTSPPGVPVPSEPLLCKFAD 198          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Sea Lamprey
Match: RBMS2 (RNA binding motif single stranded interacting protein 2 [Source:HGNC Symbol;Acc:HGNC:9909])

HSP 1 Score: 97.0561 bits (240), Expect = 8.928e-22
Identity = 62/174 (35.63%), Postives = 86/174 (49.43%), Query Frame = 3
Query:  387 NKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNG---HMPDN---SSEPITVKFAN 890
            +KTNL +  LPP  T +++  L    G++ S K + DK T +  GY FV F  P  A+KA+  L    +Q +  K     P+       NLYI  LP  M + ELE      G++I+ RIL D   G SRGV F R +   + E  I+  NG    +P      SEP+  KFA+
Sbjct:   56 SKTNLYIRGLPPGTTDQDLTKLCQPYGKIVSTKAILDKNTNQCKGYGFVHFDSPAAAQKAVTALKANGVQAQMAKQQEQDPT-------NLYISNLPLSMDEQELEGMLKPFGQVISTRILRD-ANGTSRGVGFARMESTEKCEAVIQHFNGKFIQIPPGVPAPSEPLLCKFAD 221          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 83.9593 bits (206), Expect = 3.092e-17
Identity = 51/152 (33.55%), Postives = 84/152 (55.26%), Query Frame = 3
Query:  393 TNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKV--SLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNG 842
             +L V  L P++T+  +   F+  G V S ++ RD  T  SLGYA+V F +P DAE+A+ T+N   ++ K I++  S   PS       N++I  L K +    + + FS  G I++ +++ D     SRG  F+ F+ +  A+ AI+K+NG
Sbjct:   11 ASLYVGDLHPDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGNILSCKVVCDENG--SRGYGFVHFETQEAADRAIEKMNG 160          

HSP 2 Score: 70.8626 bits (172), Expect = 3.831e-13
Identity = 47/184 (25.54%), Postives = 89/184 (48.37%), Query Frame = 3
Query:  393 TNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSE------------------SIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFAN 890
            TN+ +     +M ++++R  F   G+  S  ++ D+  G+S G+ FV F +  DA++A+  +NG  L  +T+ V  A+   E                    +G NLY+  L   +   +L ++F+  G I + +++  ++ G S+G  F+ F    EA  A+ ++NG +    S+P+ V  A 
Sbjct:  194 TNVYIKNFGDDMDEDKLREFFGKFGKALSVCVMSDEC-GKSRGFGFVSFEQHEDAQRAVNEMNGKELNGRTVFVGRAQKKGERQAELKRKFEMLKQERISRYQGVNLYVKNLDDNIDDEQLRKEFAPYGTITSTKVM--SEEGRSKGFGFVCFSSPEEATKAVTEMNGRI--VGSKPLYVALAQ 372          

HSP 3 Score: 70.0922 bits (170), Expect = 6.129e-13
Identity = 46/160 (28.75%), Postives = 82/160 (51.25%), Query Frame = 3
Query:  396 NLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSL-----ARPSSESIKGA------NLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNG 842
            N+ +  L  ++  + +   F++ G + SCK+V D+    S GY FV F     A++AI+ +NG+ L ++  +        +R   E   GA      N+YI      M + +L E F + GK ++  ++ D + G SRG  F+ F+Q  +A+ A+ ++NG
Sbjct:  100 NVFIKNLDKSIDNKAMYDTFSAFGNILSCKVVCDENG--SRGYGFVHFETQEAADRAIEKMNGMLLNDRLARRRFVGRFKSRKEREQEMGARAKEFTNVYIKNFGDDMDEDKLREFFGKFGKALSVCVMSD-ECGKSRGFGFVSFEQHEDAQRAVNEMNG 256          

HSP 4 Score: 50.0618 bits (118), Expect = 1.111e-6
Identity = 25/77 (32.47%), Postives = 44/77 (57.14%), Query Frame = 3
Query: 1146 GWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            G  ++V NL    ++  L + F P+G + + K++  S   + KGFGFV  S+ EEA  ++  +NG  +G++ L V+ 
Sbjct:  296 GVNLYVKNLDDNIDDEQLRKEFAPYGTITSTKVM--SEEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVAL 370          

HSP 5 Score: 48.1358 bits (113), Expect = 5.025e-6
Identity = 22/72 (30.56%), Postives = 39/72 (54.17%), Query Frame = 3
Query: 1155 IFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQV 1370
            +++ N   + +E  L + FG FG   +V ++ D    K +GFGFV+   +E+A  ++  +NG  L  R + V
Sbjct:  196 VYIKNFGDDMDEDKLREFFGKFGKALSVCVMSDEC-GKSRGFGFVSFEQHEDAQRAVNEMNGKELNGRTVFV 266          

HSP 6 Score: 47.7506 bits (112), Expect = 6.233e-6
Identity = 28/82 (34.15%), Postives = 45/82 (54.88%), Query Frame = 3
Query:  393 TNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSE 638
             NL V  L  N+  E++R  F   G + S K++ ++  G S G+ FV F  P +A KA+  +NG  + +K + V+LA+   E
Sbjct:  297 VNLYVKNLDDNIDDEQLRKEFAPYGTITSTKVMSEE--GRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEE 376          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Sea Lamprey
Match: sf3b4 (splicing factor 3b, subunit 4 [Source:ZFIN;Acc:ZDB-GENE-020419-22])

HSP 1 Score: 82.0333 bits (201), Expect = 6.630e-17
Identity = 51/148 (34.46%), Postives = 85/148 (57.43%), Query Frame = 3
Query:  450 LFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIK-GANLYICGLPKKMTQVELEEQFSQCGKII-TARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFA 887
            LF   G V +  + +D+ T +  GY FV+F+   DA+ AIK +N ++L  K I+V+ A   ++++  GAN++I  L  ++ +  L + FS  G I+ T + + D +TG S+G AFI F     ++ AI+ +NG    N   PI+V +A
Sbjct:   32 LFLQAGPVVNTHMPKDRITQQHQGYGFVEFLGEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDTEIDEKLLYDTFSAFGVILQTPKTMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCN--RPISVSYA 177          

HSP 2 Score: 59.3066 bits (142), Expect = 1.146e-9
Identity = 29/79 (36.71%), Postives = 46/79 (58.23%), Query Frame = 3
Query: 1143 TGWCIFVYNLSPETEEATLWQLFGPFGAV-QTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
             G  IF+ NL  E +E  L+  F  FG + QT K +RD  T   KG+ F+  +++E +  +I+++NG  L NR + VS+
Sbjct:   98 VGANIFIGNLDTEIDEKLLYDTFSAFGVILQTPKTMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRPISVSY 176          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Sea Lamprey
Match: tia1l (cytotoxic granule-associated RNA binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2167])

HSP 1 Score: 77.0258 bits (188), Expect = 5.395e-16
Identity = 46/174 (26.44%), Postives = 81/174 (46.55%), Query Frame = 3
Query:  387 NKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGAN----------------------LYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNG 842
            +  ++ V  L P ++ +++RA F   G++   ++V+D  TG+S GY FV F +  DAE AI+ + G  L  + I+ + A     + KG+                       +Y  G+ + +T+  + + F   G+I+  R+  D      +G +FIRF     A  AI  +NG
Sbjct:    1 DHYHVFVGDLSPEISTDDLRAAFAPFGKISDARVVKDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKGSQDTDPKHLSFEEVLNQSSPTNCTVYCGGITQGLTEQLMRQTFLLFGQILEIRVFPD------KGYSFIRFATHESAAHAIVSVNG 168          

HSP 2 Score: 55.0694 bits (131), Expect = 1.348e-8
Identity = 27/74 (36.49%), Postives = 42/74 (56.76%), Query Frame = 3
Query: 1155 IFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            +FV +LSPE     L   F PFG +   ++V+D  T K KG+GFV+     +A  +IQ + G  LG R ++ ++
Sbjct:    5 VFVGDLSPEISTDDLRAAFAPFGKISDARVVKDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNW 78          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 85.1149 bits (209), Expect = 7.171e-18
Identity = 43/134 (32.09%), Postives = 70/134 (52.24%), Query Frame = 3
Query:  399 LIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFD 800
            + +  L  + T++ +R  F   G V   K+++D  TG S G+ F+ F +P+  ++ +KT +   L  K I    A P  E  K   +++ G+   +   E EE FSQ G II A+++ D  TG SRG  F+ +D
Sbjct:  161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQH--ILDGKVIDPKRAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYD 292          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 76.2554 bits (186), Expect = 4.518e-15
Identity = 48/152 (31.58%), Postives = 79/152 (51.97%), Query Frame = 3
Query:  399 LIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKV--SLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHM 848
            L V  L P++++  +  +F+ IG V S ++ RD  T  SLGYA+V F       KAI+ LN   ++ +  ++  S   PS       N++I  L   +    L + FS  G I++++I  D + G S+G  F+ F++   A+ AI  LNG +
Sbjct:   40 LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGML 190          

HSP 2 Score: 66.2402 bits (160), Expect = 8.174e-12
Identity = 50/183 (27.32%), Postives = 85/183 (46.45%), Query Frame = 3
Query:  393 TNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESI------------------KGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFA 887
            TNL V  +    T E+ + LF   G + S  L +D   G+  G+ FV + +  DA KA++ LN   L  + + V  A+  +E +                  +G NL++  L   +   +LEE+F+  G I +A+++   + G S+G  F+ F    EA  AI + N  +   + +P+ V  A
Sbjct:  219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVM-RTENGKSKGFGFVCFSTPEEATKAITEKNQQIV--AGKPLYVAIA 397          

HSP 3 Score: 60.077 bits (144), Expect = 5.567e-10
Identity = 76/329 (23.10%), Postives = 123/329 (37.39%), Query Frame = 3
Query:  396 NLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYIC-GLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFAN--SPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVS 1373
            N+ +  L P++  + +   F+  G++ S K+  D+  G+S G+ FV F     A++AI  LNG+ L                  G  +Y+   L +K    +LEE           +  Y N                    + +K +N    D   + +  KF    S S     D           +    AV AV   N S L     +   + R +  +  + +L     A  L   A           G  +FV NL    ++  L + F P+G + + K++R +   K KGFGFV  S  EEA  +I   N   +  + L V+
Sbjct:  127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDEN-GKSKGFGFVHFEEEGAAKEAIDALNGMLL-----------------NGQEIYVAPHLSRKERDSQLEE----------TKAHYTN--------------------LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNG---EKLYVGRAQKKNERMHVLKKQYEAYRLEKMA--------KYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVA 395          

HSP 4 Score: 52.373 bits (124), Expect = 1.507e-7
Identity = 21/87 (24.14%), Postives = 48/87 (55.17%), Query Frame = 3
Query: 1110 AVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQV 1370
            A  + + ++  +   ++V +L P   EA L+ +F P G+V ++++ RD+ T    G+ +V  +++E    +I+ LN   +  R+ ++
Sbjct:   25 ATGSESQSVENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRI 111          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 74.7146 bits (182), Expect = 9.831e-15
Identity = 44/165 (26.67%), Postives = 88/165 (53.33%), Query Frame = 3
Query:  399 LIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGA--NLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFA 887
            L V  L   +T++ ++  F   G + + K++ DK   +++ YAFV++ + +DA  A++TLNG +++N  +K++ A  S +S      NL++  L   +    L   F      ++  +++D +TG SRG  F+ F  + +A+ A+  + G   D +  P+ + +A
Sbjct:   77 LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNN-KNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQ--DLNGRPLRINWA 238          

HSP 2 Score: 47.3654 bits (111), Expect = 5.181e-6
Identity = 30/106 (28.30%), Postives = 50/106 (47.17%), Query Frame = 3
Query:  306 NGTICERNMESVTPSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLA 623
            NG   E N+  +  +  S  S   + ++  NL V  L  N+  E +R  F       S  ++ D  TG S GY FV F   +DA+ A+ ++ G  L  + ++++ A
Sbjct:  136 NGKQIENNIVKINWAFQSQQS---SSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWA 238          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Yeast
Match: HSH49 (U2-snRNP associated splicing factor; similar to the mammalian splicing factor SAP49; proposed to function as a U2-snRNP assembly factor along with Hsh155p and binding partner Cus1p; contains two RNA recognition motifs (RRM) [Source:SGD;Acc:S000005846])

HSP 1 Score: 68.1662 bits (165), Expect = 1.820e-13
Identity = 58/190 (30.53%), Postives = 94/190 (49.47%), Query Frame = 3
Query:  369 LNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNG-LRLQNKTIKVSLAR--------PSSES----IKGANLYICGLPKKMTQVELEEQFSQCGKIITA-RILYDNKTGLSRG---VAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFA 887
            +N + ++   + V  + P +T+E++  LF  I  V   K  +DK      GYAF++F    DA+ AIK +N  +RL ++ IKV            PS+ S    +  A L+I  L   +   +L + F++ GK+I    I Y     LS G    A++ F+   +A++AIK LN  +  N+   ITV +A
Sbjct:    1 MNYSADSGNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIMNNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAKLFIKNLADSIDSDQLVKIFNKFGKLIREPEIFY-----LSNGKLKCAYVYFEDFEKADLAIKSLNNQLVANNR--ITVDYA 183          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 59.6918 bits (143), Expect = 5.408e-10
Identity = 42/185 (22.70%), Postives = 85/185 (45.95%), Query Frame = 3
Query:  372 NMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTI--KVSLARPSSESIKGAN-----------LYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFA 887
            N   E    + V  L  ++  E ++  F  IG V   +++ ++ T  S GY +V F   + AEKAI+ + G  +  + I   +S ++P+  + +              L++  L     +  + E F++ G++++ RI    +T   +G  +++F    +A+ A+  L G   DN   P+ + F+
Sbjct:  161 NEETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDN--RPVRLDFS 343          

HSP 2 Score: 52.373 bits (124), Expect = 1.249e-7
Identity = 25/75 (33.33%), Postives = 43/75 (57.33%), Query Frame = 3
Query: 1152 CIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
             +F+ NLS   +   +++LF   G V +V+I     T + KGFG+V  SN E+A  ++ +L G  + NR +++ F
Sbjct:  268 TLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDF 342          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Nematostella
Match: EDO34879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN30])

HSP 1 Score: 262.692 bits (670), Expect = 1.588e-82
Identity = 148/349 (42.41%), Postives = 206/349 (59.03%), Query Frame = 3
Query:  372 NMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAA--------------STGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            N   + +TNLI+NY+PP+M+QE+++ +F ++G V SCKL+RD+ TG+SLGYAFV +  P+DA KA++ +NG RLQNKT+KVS ARPSS  IK ANLYI GLPK M + E+E  F   GKIIT+++L D  +G  RG  F+RFD+RCEA+ AI  LN      ++  +TVKFAN P+  +RQ           +   T+ +    TP R+    P+     +  ++Y        P  A++   F+PA  A              +   LT  GWCIFVY L  E     L++LF P+GA+  +++  D      KG+GFV MSNYEEA  +I  LNG     ++LQVSF
Sbjct:    3 NGTSDERTNLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFARPSSTEIKNANLYISGLPKDMKEEEVEALFKPFGKIITSKVLKD-VSGEGRGTGFVRFDKRCEAQTAIDDLNNKTLPGTNVKLTVKFANPPN--SRQP------AMPLSPALTSPLGRALTPQRNFSGGPVHH--QMLNMRYS-------PMTASS---FSPACQANCHSPNNSSSNSYTNLSGLTPQGWCIFVYGLPQEATPLFLYKLFSPYGAITNIELKLD------KGYGFVNMSNYEEACHAICCLNGTPQHGKILQVSF 324          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Nematostella
Match: EDO42673 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S105])

HSP 1 Score: 198.749 bits (504), Expect = 1.258e-58
Identity = 111/332 (33.43%), Postives = 172/332 (51.81%), Query Frame = 3
Query:  384 ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTG--ALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVS 1373
            E+KT LIVNY+P +MT +  R +F ++  + +CK+VR K +G S G+ FV +    DA+KAI  LNG  + NK +KV+ +RP  ++ KGANLY+C +PK++ + E  + F   G I+  R+L D  TGL +G  F+ +D++ EA+ AI  L+G     S+  + +++A+  S   R  N                    + PN        QQ+     ++ P++            PL    +    G  +    G  ++VYN+  +  +  +  LF   G V  V I+ D    +CKGF FVTM+  EEA  +IQ+LNGF   N+ LQVS
Sbjct:    2 ESKTTLIVNYIPQDMTDQTFRMMFEAVASLNNCKIVRHKPSGWSYGFGFVDYNTTEDAQKAIDKLNGFTIGNKVLKVAFSRPGGDNTKGANLYVCNIPKQLPEAEFRKAFEAYGNIVNCRLLRDKSTGLPKGCGFVLYDKKAEAQAAISSLSGTFFPGSTMGLQIRYADDNSAKVRPPN--------------------NVPNFG------QQMGGPGPIRPPANRFQARFNPMGGGPLPQQKMTHMNGNKSQAPPGCTLYVYNIGYDANQEGITALFAQCGIVNKVDIMWDWQRQQCKGFCFVTMATQEEAQNAIQTLNGFMYTNKPLQVS 307          

HSP 2 Score: 49.6766 bits (117), Expect = 1.672e-6
Identity = 25/74 (33.78%), Postives = 40/74 (54.05%), Query Frame = 3
Query: 1155 IFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            + V  +  +  + T   +F    ++   KIVR   +    GFGFV  +  E+A  +I  LNGF +GN+VL+V+F
Sbjct:    7 LIVNYIPQDMTDQTFRMMFEAVASLNNCKIVRHKPSGWSYGFGFVDYNTTEDAQKAIDKLNGFTIGNKVLKVAF 80          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Nematostella
Match: EDO49588 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGR7])

HSP 1 Score: 86.6557 bits (213), Expect = 1.670e-19
Identity = 62/172 (36.05%), Postives = 85/172 (49.42%), Query Frame = 3
Query:  390 KTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHM-PDNSS----EPITVKFAN 890
            KTNL +  L  N T +++  L    G + S K + DK T    GY FV F  P  A+KA+       L NK I+  +A+   +     NLYI  LP+   +  LE  FS+ GK+I+ RIL D  T  S+GV F R +   + E  IK  N  M P   S    + + VKFA+
Sbjct:   14 KTNLYIRGLKANTTDDDLVRLCHKYGTIISTKAILDKDTNLCKGYGFVDFESPISAQKAVAA-----LVNKGIQAQMAKQQEQD--PTNLYIQNLPQNCDEAMLENMFSKYGKVISTRILRDKDTN-SKGVGFARMESAEKCEQVIKDFNKKMLPGEVSLRCIQELVVKFAD 177          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Nematostella
Match: EDO42417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1S3])

HSP 1 Score: 85.5001 bits (210), Expect = 7.084e-18
Identity = 55/165 (33.33%), Postives = 92/165 (55.76%), Query Frame = 3
Query:  399 LIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIK-GANLYICGLPKKMTQVELEEQFSQCGKII-TARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFA 887
            + V  L   +++  +  LF   G V +  + +D+ T    GY FV+F+   DA+ AIK +N +++  K I+V+ A   ++++  GANL+I  L  ++ +  L + FS  G I+ T +I+ D+ TG S+G AFI F     ++ AI+ +NG    N   PITV +A
Sbjct:   15 IYVGGLDEKVSEALIWELFLQSGPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRVNKASAHNKNLDVGANLFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCN--RPITVSYA 177          

HSP 2 Score: 61.2326 bits (147), Expect = 4.285e-10
Identity = 30/79 (37.97%), Postives = 48/79 (60.76%), Query Frame = 3
Query: 1143 TGWCIFVYNLSPETEEATLWQLFGPFGAV-QTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
             G  +F+ NL  E +E  L+  F  FG + QT KI+RDS T   KGF F+  ++++ +  +I+++NG  L NR + VS+
Sbjct:   98 VGANLFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCNRPITVSY 176          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Nematostella
Match: EDO33206 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSV8])

HSP 1 Score: 75.8702 bits (185), Expect = 1.879e-14
Identity = 53/184 (28.80%), Postives = 89/184 (48.37%), Query Frame = 3
Query:  393 TNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSES------------------IKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFAN 890
            TN+ V     +M  E+++ +    G++ S K++ D   G+S G+ FV F  P +AE+A+  LNG  +  + +    A+  +E                    +G NLYI  L   +    L E+FS  G I +A+++ D+K G S+G  F+ F    EA  A+ ++NG +    S+P+ V  A 
Sbjct:  194 TNVYVKNFGDDMDDEQMKEICAEAGKIVSLKVMTD-PEGKSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRLWAGRAKKRAERAAEVKAEIEKKRQERINRFQGVNLYIKNLDDPIDDERLREEFSPYGTISSAKVMKDDK-GNSKGFGFVCFSSPEEATKAVTEMNGRI--LISKPLYVALAQ 373          

HSP 2 Score: 73.9442 bits (180), Expect = 7.447e-14
Identity = 47/154 (30.52%), Postives = 81/154 (52.60%), Query Frame = 3
Query:  393 TNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLAR--PSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHM 848
             +L V  L P++T+  +   F++ G V S ++ RD  T  SLGYA+V F +P  AEKA+ T+N   ++ +  ++   +  PS       N++I  L K +    L + FS  G I++ +I  D + G  +G  F+ F+    A  AI +++G +
Sbjct:   13 ASLYVGDLAPDVTEAMLYEKFSTAGSVLSIRVCRDLVTRRSLGYAYVNFQQPGHAEKALDTMNFDPIKGRPCRIMWQQRDPSLRKSGVGNIFIKNLDKSIDNKSLYDTFSAFGNILSCKIAQD-ELGNPKGYGFVHFETEDAALEAIARVDGML 165          

HSP 3 Score: 67.781 bits (164), Expect = 6.791e-12
Identity = 44/157 (28.03%), Postives = 80/157 (50.96%), Query Frame = 3
Query:  396 NLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESI--------KGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNG 842
            N+ +  L  ++  + +   F++ G + SCK+ +D+  G   GY FV F   + A +AI  ++G+ L +K + V       E I        K  N+Y+      M   +++E  ++ GKI++ +++ D + G S+G  F+ F+   EAE A+  LNG
Sbjct:  102 NIFIKNLDKSIDNKSLYDTFSAFGNILSCKIAQDEL-GNPKGYGFVHFETEDAALEAIARVDGMLLNDKKVFVGRWMSKKERIEKMGTQPKKFTNVYVKNFGDDMDDEQMKEICAEAGKIVSLKVMTDPE-GKSKGFGFVSFETPEEAEEAVNVLNG 256          

HSP 4 Score: 50.8322 bits (120), Expect = 1.419e-6
Identity = 25/77 (32.47%), Postives = 44/77 (57.14%), Query Frame = 3
Query: 1146 GWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            G  +++ NL    ++  L + F P+G + + K+++D   N  KGFGFV  S+ EEA  ++  +NG  L ++ L V+ 
Sbjct:  296 GVNLYIKNLDDPIDDERLREEFSPYGTISSAKVMKDDKGN-SKGFGFVCFSSPEEATKAVTEMNGRILISKPLYVAL 371          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Medaka
Match: elavl4 (ELAV like RNA binding protein 4 [Source:NCBI gene;Acc:101162996])

HSP 1 Score: 390.193 bits (1001), Expect = 1.474e-130
Identity = 206/350 (58.86%), Postives = 238/350 (68.00%), Query Frame = 3
Query:  351 PTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGAL--------TATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            PT++DS       KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK TG+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  T Q                       +PNR     P+   A   RL       D L  MA     F+P    S  +L        T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   75 PTNDDS-------KTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNPSQKTSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDSMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 394          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Medaka
Match: elavl4 (ELAV like RNA binding protein 4 [Source:NCBI gene;Acc:101162996])

HSP 1 Score: 384.8 bits (987), Expect = 1.322e-128
Identity = 206/354 (58.19%), Postives = 238/354 (67.23%), Query Frame = 3
Query:  351 PTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTT----GESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGAL--------TATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            PT++DS       KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK T    G+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  T Q                       +PNR     P+   A   RL       D L  MA     F+P    S  +L        T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   70 PTNDDS-------KTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITAEVSGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNPSQKTSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDSMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 393          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Medaka
Match: elavl3 (ELAV like RNA binding protein 3 [Source:NCBI gene;Acc:101155436])

HSP 1 Score: 382.874 bits (982), Expect = 1.949e-128
Identity = 197/331 (59.52%), Postives = 237/331 (71.60%), Query Frame = 3
Query:  384 ENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            ++KTNLIVNYLP NMTQEE ++LF SIGE+ESCKLVRDK TG+SLGY FV +V PNDA+KAI TLNGL+LQ KTIKVS ARPSS SI+ ANLY+ GLPK M+Q ++E+ FSQ G+IIT+RIL D  TG+SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  T Q  L+      A +               NLL+     AS    ++    ID + ++A  N L  P         T  GWCIFVYNLSPE +E+ LWQLFGPFGAV  VK++RD TTNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   35 DSKTNLIVNYLPQNMTQEEFKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKDMEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRNEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKTGQALLTQLYQTAARRYTGPLHHQTQRFRLDNLLN-----ASYGVKRFSPITIDSMTSLAGVN-LTGP---------TGAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 350          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Medaka
Match: elavl4 (ELAV like RNA binding protein 4 [Source:NCBI gene;Acc:101162996])

HSP 1 Score: 384.8 bits (987), Expect = 2.173e-128
Identity = 206/354 (58.19%), Postives = 238/354 (67.23%), Query Frame = 3
Query:  351 PTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTT----GESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGAL--------TATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            PT++DS       KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK T    G+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  T Q                       +PNR     P+   A   RL       D L  MA     F+P    S  +L        T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   83 PTNDDS-------KTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITAEVSGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNPSQKTSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDSMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 406          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Medaka
Match: elavl4 (ELAV like RNA binding protein 4 [Source:NCBI gene;Acc:101162996])

HSP 1 Score: 384.415 bits (986), Expect = 2.380e-128
Identity = 206/354 (58.19%), Postives = 238/354 (67.23%), Query Frame = 3
Query:  351 PTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTT----GESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGAL--------TATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            PT++DS       KTNLIVNYLP NMTQEE R+LF SIGE+ESCKLVRDK T    G+SLGY FV ++ P DAEKAI TLNGLRLQ KTIKVS ARPSS SI+ ANLY+ GLPK MTQ ELE+ FSQ G+IIT+RIL D  TG SRGV FIRFD+R EAE AIK LNG  P  ++EPITVKFAN+PS  T Q                       +PNR     P+   A   RL       D L  MA     F+P    S  +L        T TGWCIFVYNLSP+++E+ LWQLFGPFGAV  VK++RD  TNKCKGFGFVTM+NY+EA ++I SLNG+ LG+RVLQVSF
Sbjct:   75 PTNDDS-------KTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITAEVSGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNPSQKTSQ---------------ALLSQLYQSPNR-RYPGPLHHQAQRFRL-------DNLLNMAYGVKRFSPITIDSMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 398          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Planmine SMEST
Match: SMESG000081081.1 (SMESG000081081.1)

HSP 1 Score: 824.313 bits (2128), Expect = 0.000e+0
Identity = 458/476 (96.22%), Postives = 459/476 (96.43%), Query Frame = 3
Query:   57 MRKKALTTLSMSNQESMPDEMTNCSNAIISSTTDQRASGDTGDHCKEXXXXXXXXXXXXXXXXXXXXXXXXENQSSLMGQVDWNGTICERNMESVTPSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSFXXXXXXXXXXXXXXXXXXXXXXXXXESLLTATAVVE 1484
            MRKKALTTLSMSNQESMPDEMTNCSNAIISSTTDQRASGDTGDHCKENKSSNQE                 +NQSSLMGQVDWNGTICERNMESVTPSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNLSLALLKQAAQLQTAAVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSFKSTPNPKMKTSSTSPTSSPIPASCSESLLTATAVVE
Sbjct:    1 MRKKALTTLSMSNQESMPDEMTNCSNAIISSTTDQRASGDTGDHCKENKSSNQE-----------------KNQSSLMGQVDWNGTICERNMESVTPSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNLSLALLKQAAQLQTAAVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSFKSTPNPKMKTSSTSPTSSPIPASCSESLLTATAVVE 459          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Planmine SMEST
Match: SMESG000081081.1 (SMESG000081081.1)

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 455/476 (95.59%), Postives = 456/476 (95.80%), Query Frame = 3
Query:   57 MRKKALTTLSMSNQESMPDEMTNCSNAIISSTTDQRASGDTGDHCKEXXXXXXXXXXXXXXXXXXXXXXXXENQSSLMGQVDWNGTICERNMESVTPSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSFXXXXXXXXXXXXXXXXXXXXXXXXXESLLTATAVVE 1484
            MRKKALTTLSMSNQESMPDEMTNCSNAIISSTTDQRASGDTGDHCKENK+    S                ENQSSLMGQVDWNGTICERNMESVTPSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNLSLALLKQAAQLQTAAVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSFKSTPNPKMKTSSTSPTSSPIPASCSESLLTATAVVE
Sbjct:    1 MRKKALTTLSMSNQESMPDEMTNCSNAIISSTTDQRASGDTGDHCKENKNDVNGS----------------ENQSSLMGQVDWNGTICERNMESVTPSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNLSLALLKQAAQLQTAAVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSFKSTPNPKMKTSSTSPTSSPIPASCSESLLTATAVVE 460          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Planmine SMEST
Match: SMESG000081081.1 (SMESG000081081.1)

HSP 1 Score: 805.053 bits (2078), Expect = 0.000e+0
Identity = 445/466 (95.49%), Postives = 446/466 (95.71%), Query Frame = 3
Query:   87 MSNQESMPDEMTNCSNAIISSTTDQRASGDTGDHCKEXXXXXXXXXXXXXXXXXXXXXXXXENQSSLMGQVDWNGTICERNMESVTPSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSFXXXXXXXXXXXXXXXXXXXXXXXXXESLLTATAVVE 1484
            MSNQESMPDEMTNCSNAIISSTTDQRASGDTGDHCKENK+    S                ENQSSLMGQVDWNGTICERNMESVTPSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNLSLALLKQAAQLQTAAVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSFKSTPNPKMKTSSTSPTSSPIPASCSESLLTATAVVE
Sbjct:    1 MSNQESMPDEMTNCSNAIISSTTDQRASGDTGDHCKENKNDVNGS----------------ENQSSLMGQVDWNGTICERNMESVTPSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNLSLALLKQAAQLQTAAVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSFKSTPNPKMKTSSTSPTSSPIPASCSESLLTATAVVE 450          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Planmine SMEST
Match: SMESG000081081.1 (SMESG000081081.1)

HSP 1 Score: 804.283 bits (2076), Expect = 0.000e+0
Identity = 448/466 (96.14%), Postives = 449/466 (96.35%), Query Frame = 3
Query:   87 MSNQESMPDEMTNCSNAIISSTTDQRASGDTGDHCKEXXXXXXXXXXXXXXXXXXXXXXXXENQSSLMGQVDWNGTICERNMESVTPSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSFXXXXXXXXXXXXXXXXXXXXXXXXXESLLTATAVVE 1484
            MSNQESMPDEMTNCSNAIISSTTDQRASGDTGDHCKENKSSNQE                 +NQSSLMGQVDWNGTICERNMESVTPSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNLSLALLKQAAQLQTAAVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSFKSTPNPKMKTSSTSPTSSPIPASCSESLLTATAVVE
Sbjct:    1 MSNQESMPDEMTNCSNAIISSTTDQRASGDTGDHCKENKSSNQE-----------------KNQSSLMGQVDWNGTICERNMESVTPSPTSNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNLSLALLKQAAQLQTAAVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSFKSTPNPKMKTSSTSPTSSPIPASCSESLLTATAVVE 449          
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Planmine SMEST
Match: SMESG000027406.1 (SMESG000027406.1)

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 265/336 (78.87%), Postives = 304/336 (90.48%), Query Frame = 3
Query:  369 LNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTTGESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGANLYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQRCEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNXXXXXXXXXXXXXXXXVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFAPAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDSTTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSF 1376
            L+ + +NKTNLIVNYLPPNMTQEEVRALF+SIG VESCKLVRDKTTGESLGY+FVK++   DAEKAI+TLNGLRLQNKTIKVSLARPSSE+IKGANLYICGLPKKMTQ+ELE  FSQCGKIITARILYDNKTGLSRGVAFIRFDQR EA++AIKKLN + P+NS+EPI VKFANSPS T+RQDN+SLA+LKQAAQ+      + +  +RS+L+SP+QQLAS++RLKYP+S +D +P++   N L APA AASTGALTATGWCIFVYNL+PET++ATLWQLFGPFGAVQTVKI+RD+ TNKCKGFGFVTMSNYEEALL+IQSLNGF LGNR+LQVSF
Sbjct:   45 LSNSLDNKTNLIVNYLPPNMTQEEVRALFSSIGVVESCKLVRDKTTGESLGYSFVKYLNYPDAEKAIRTLNGLRLQNKTIKVSLARPSSEAIKGANLYICGLPKKMTQMELENLFSQCGKIITARILYDNKTGLSRGVAFIRFDQRSEAQLAIKKLNSYQPENSTEPIIVKFANSPS-TSRQDNISLAILKQAAQIPNQNAQSANPQSRSSLISPLQQLASVARLKYPTS-MDFMPSLTGNNSLLAPAFAASTGALTATGWCIFVYNLAPETDDATLWQLFGPFGAVQTVKIIRDTATNKCKGFGFVTMSNYEEALLAIQSLNGFTLGNRILQVSF 378          
The following BLAST results are available for this feature:
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ELAVL45.035e-13255.44ELAV like RNA binding protein 4 [Source:HGNC Symbo... [more]
ELAVL44.444e-13156.49ELAV like RNA binding protein 4 [Source:HGNC Symbo... [more]
ELAVL45.089e-13156.49ELAV like RNA binding protein 4 [Source:HGNC Symbo... [more]
ELAVL45.346e-13156.49ELAV like RNA binding protein 4 [Source:HGNC Symbo... [more]
ELAVL45.957e-13156.49ELAV like RNA binding protein 4 [Source:HGNC Symbo... [more]
back to top
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exc-71.613e-7567.05pep chromosome:WBcel235:II:9575971:9581490:1 gene:... [more]
sup-264.371e-1834.21SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8][more]
sup-264.371e-1834.21SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8][more]
sup-261.164e-1734.21SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8][more]
sup-261.394e-1734.21SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8][more]
back to top
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fne9.638e-12957.02gene:FBgn0086675 transcript:FBtr0306739[more]
fne9.638e-12957.02gene:FBgn0086675 transcript:FBtr0343650[more]
fne9.638e-12957.02gene:FBgn0086675 transcript:FBtr0343651[more]
fne2.327e-12856.53gene:FBgn0086675 transcript:FBtr0306738[more]
fne2.327e-12856.53gene:FBgn0086675 transcript:FBtr0333319[more]
back to top
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elavl48.716e-13158.52ELAV like neuron-specific RNA binding protein 4 [S... [more]
elavl47.558e-13059.46ELAV like neuron-specific RNA binding protein 4 [S... [more]
elavl49.564e-12958.03ELAV like neuron-specific RNA binding protein 4 [S... [more]
elavl41.195e-12858.03ELAV like neuron-specific RNA binding protein 4 [S... [more]
elavl31.468e-12858.31ELAV like neuron-specific RNA binding protein 3 [S... [more]
back to top
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc39.013e-13258.50proteasome 26S subunit, ATPase 3 [Source:Xenbase;A... [more]
psmc36.203e-13159.29proteasome 26S subunit, ATPase 3 [Source:Xenbase;A... [more]
trerf12.010e-12857.80transcriptional regulating factor 1 [Source:Xenbas... [more]
pnpla25.226e-12858.53patatin like phospholipase domain containing 2 [So... [more]
trerf15.329e-12754.42transcriptional regulating factor 1 [Source:Xenbas... [more]
back to top
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Elavl43.311e-13255.44ELAV like RNA binding protein 4 [Source:MGI Symbol... [more]
Elavl43.874e-13156.49ELAV like RNA binding protein 4 [Source:MGI Symbol... [more]
Elavl43.916e-13156.49ELAV like RNA binding protein 4 [Source:MGI Symbol... [more]
Elavl41.075e-13056.49ELAV like RNA binding protein 4 [Source:MGI Symbol... [more]
Elavl41.625e-13056.63ELAV like RNA binding protein 4 [Source:MGI Symbol... [more]
back to top
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P26378|ELAV4_HUMAN6.420e-12954.45ELAV-like protein 4 OS=Homo sapiens OX=9606 GN=ELA... [more]
sp|O09032|ELAV4_RAT7.469e-12954.45ELAV-like protein 4 OS=Rattus norvegicus OX=10116 ... [more]
sp|Q61701|ELAV4_MOUSE7.469e-12954.45ELAV-like protein 4 OS=Mus musculus OX=10090 GN=El... [more]
sp|Q5R9Z6|ELAV2_PONAB4.241e-12858.41ELAV-like protein 2 OS=Pongo abelii OX=9601 GN=ELA... [more]
sp|Q12926|ELAV2_HUMAN4.241e-12858.41ELAV-like protein 2 OS=Homo sapiens OX=9606 GN=ELA... [more]
back to top
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F9W2W20.000e+0100.00Embryonic lethal abnormal vision 1-like protein OS... [more]
A0A0A7M2200.000e+099.32Embryonic lethal abnormal vision 3 (Fragment) OS=S... [more]
E2IXF80.000e+078.87ELAV2 OS=Schmidtea mediterranea OX=79327 GN=elav2 ... [more]
A0A5J4NBP75.894e-16971.79ELAV like protein 2/3/4 OS=Paragonimus westermani ... [more]
A0A183TIH11.326e-16672.70ELAV-like protein 2 OS=Schistocephalus solidus OX=... [more]
back to top
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elavl42.868e-13158.52ELAV like neuron-specific RNA binding protein 4 [S... [more]
elavl43.311e-13158.52ELAV like neuron-specific RNA binding protein 4 [S... [more]
elavl46.630e-13158.52ELAV like neuron-specific RNA binding protein 4 [S... [more]
elavl45.938e-13058.43ELAV like neuron-specific RNA binding protein 4 [S... [more]
ELAVL22.567e-12955.73ELAV like RNA binding protein 2 [Source:NCBI gene;... [more]
back to top
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008168.14.391e-2434.72pep scaffold:Pmarinus_7.0:GL476829:41182:80090:-1 ... [more]
RBMS28.928e-2235.63RNA binding motif single stranded interacting prot... [more]
pabpc43.092e-1733.55poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
sf3b46.630e-1734.46splicing factor 3b, subunit 4 [Source:ZFIN;Acc:ZDB... [more]
tia1l5.395e-1626.44cytotoxic granule-associated RNA binding protein 1... [more]
back to top
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HRP17.171e-1832.09Subunit of cleavage factor I; cleavage factor I is... [more]
PAB14.518e-1531.58Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
PUB19.831e-1526.67Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
HSH491.820e-1330.53U2-snRNP associated splicing factor; similar to th... [more]
NSR15.408e-1022.70Nucleolar protein that binds nuclear localization ... [more]
back to top
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO348791.588e-8242.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426731.258e-5833.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495881.670e-1936.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424177.084e-1833.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332061.879e-1428.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elavl41.474e-13058.86ELAV like RNA binding protein 4 [Source:NCBI gene;... [more]
elavl41.322e-12858.19ELAV like RNA binding protein 4 [Source:NCBI gene;... [more]
elavl31.949e-12859.52ELAV like RNA binding protein 3 [Source:NCBI gene;... [more]
elavl42.173e-12858.19ELAV like RNA binding protein 4 [Source:NCBI gene;... [more]
elavl42.380e-12858.19ELAV like RNA binding protein 4 [Source:NCBI gene;... [more]
back to top
BLAST of TPA_inf: embryonic lethal abnormal vision 1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081081.10.000e+096.22SMESG000081081.1[more]
SMESG000081081.10.000e+095.59SMESG000081081.1[more]
SMESG000081081.10.000e+095.49SMESG000081081.1[more]
SMESG000081081.10.000e+096.14SMESG000081081.1[more]
SMESG000027406.10.000e+078.87SMESG000027406.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30004786
GenBankDAA34917.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004786 ID=SMED30004786|Name=TPA_inf: embryonic lethal abnormal vision 1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1880bp
TAAAATTTTAAATTCAATATGTTTCTAAGCAACATTTTTTAAAAACATTA
ACTTGGATGCGAAAGAAAGCATTAACAACATTGTCAATGTCAAATCAGGA
AAGTATGCCAGACGAAATGACAAATTGCAGCAATGCCATAATTAGTTCAA
CAACTGACCAAAGAGCTTCAGGAGATACTGGAGATCACTGCAAGGAAAAT
AAAAGTTCTAATCAAGAAAGTAATAATCTGTTAAACAGTGATTCAAGTTT
AGATGATGTAAATGGATCAGAAAATCAGTCAAGTTTGATGGGACAAGTGG
ATTGGAATGGAACAATATGTGAAAGAAACATGGAATCAGTAACTCCTAGT
CCAACCAGTAATGATTCGTTAAACATGAACTGCGAAAATAAAACTAATTT
AATTGTAAATTATTTGCCACCAAATATGACTCAAGAAGAAGTACGTGCTC
TATTCACAAGTATTGGAGAGGTTGAAAGCTGTAAGTTAGTTCGAGATAAA
ACAACCGGTGAGAGTTTGGGATATGCCTTCGTTAAGTTTGTACGCCCAAA
TGACGCTGAGAAAGCAATTAAAACACTTAACGGTCTTAGATTACAAAATA
AAACAATTAAAGTTTCCTTAGCTAGACCAAGTTCAGAATCAATTAAGGGC
GCCAATTTATACATCTGTGGATTACCAAAGAAGATGACTCAAGTAGAATT
GGAAGAACAGTTTTCTCAATGTGGAAAAATAATAACTGCTAGAATTTTGT
ATGATAATAAAACCGGTTTGTCGCGAGGTGTTGCATTTATAAGATTTGAT
CAGAGGTGTGAAGCTGAGATGGCAATAAAAAAACTAAATGGTCATATGCC
AGATAATTCGAGTGAACCAATTACAGTAAAATTTGCTAATTCTCCAAGTA
CCACTACGCGTCAAGACAACTTAAGTCTCGCACTTTTGAAACAAGCTGCC
CAATTGCAGACAGCTGCTGTGAGTGCTGTTTCAACTCCTAATCGTTCGAA
TTTACTCAGTCCAATTCAACAATTAGCATCCATATCTCGATTAAAGTACC
CTTCATCTGGAATAGATTTACTTCCGGCCATGGCAACAGCAAATCCCTTA
TTTGCCCCAGCCGTGGCCGCGAGTACCGGAGCACTGACAGCAACTGGGTG
GTGTATATTTGTTTACAATTTGTCACCAGAAACTGAAGAAGCTACTCTTT
GGCAATTGTTTGGTCCTTTTGGAGCTGTTCAAACCGTCAAAATTGTAAGA
GATTCAACAACCAATAAATGCAAAGGATTCGGTTTTGTTACAATGAGTAA
TTACGAAGAAGCACTATTATCTATTCAATCTCTCAACGGATTCGCTCTAG
GAAATCGTGTACTACAAGTGTCATTTAAATCAACTCCCAATCCAAAAATG
AAGACGAGTTCTACCTCACCAACATCCAGTCCAATACCAGCTAGTTGTTC
TGAAAGTTTACTTACCGCCACTGCAGTTGTAGAGTAACCGATTGATGAAT
CCTAAAATGACAAAAAAAATTTAACAAAAAAGAATGTGAACAAAAAAAAT
AATTTTAAAAATCTCATTCCAGACAAAGTCTCATTGATAATAAACTAATT
TTTCAAATAATAATCCCTATGTTTGAGAGCTGAGGTACCTACTTTATAAT
AAATTTTTTTTGATAGATAATAGTTTGCACACATATATTTATATATATCA
ACTCTTTCAGAAAAAAAAGTCATTTTCGAATTTGATTTAAATTCATCAAA
GTTTAATTATCATTAATTTATATATAATGATAATATTTTTTTCAAAATTA
TCTATTATGTTGCAATAATTATTTGCATGTATCATTTGAAATTATTATTA
TTATTGTTATTATTATTATTATTATTATTA
back to top

protein sequence of SMED30004786-orf-1

>SMED30004786-orf-1 ID=SMED30004786-orf-1|Name=SMED30004786-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=477bp
MRKKALTTLSMSNQESMPDEMTNCSNAIISSTTDQRASGDTGDHCKENKS
SNQESNNLLNSDSSLDDVNGSENQSSLMGQVDWNGTICERNMESVTPSPT
SNDSLNMNCENKTNLIVNYLPPNMTQEEVRALFTSIGEVESCKLVRDKTT
GESLGYAFVKFVRPNDAEKAIKTLNGLRLQNKTIKVSLARPSSESIKGAN
LYICGLPKKMTQVELEEQFSQCGKIITARILYDNKTGLSRGVAFIRFDQR
CEAEMAIKKLNGHMPDNSSEPITVKFANSPSTTTRQDNLSLALLKQAAQL
QTAAVSAVSTPNRSNLLSPIQQLASISRLKYPSSGIDLLPAMATANPLFA
PAVAASTGALTATGWCIFVYNLSPETEEATLWQLFGPFGAVQTVKIVRDS
TTNKCKGFGFVTMSNYEEALLSIQSLNGFALGNRVLQVSFKSTPNPKMKT
SSTSPTSSPIPASCSESLLTATAVVE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:1990904ribonucleoprotein complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR006548ELAD_HU_SF
IPR034775ELAV/Hu_RRM1
IPR035979RBD_domain_sf
IPR002343Hud_Sxl_RNA
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002343Paraneoplastic encephalomyelitis antigenPRINTSPR00961HUDSXLRNAcoord: 170..185
score: 78.12
coord: 204..219
score: 55.21
coord: 113..128
score: 85.21
coord: 260..277
score: 61.3
coord: 186..203
score: 72.78
coord: 219..231
score: 64.1
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 114..187
e-value: 2.3E-24
score: 96.9
coord: 200..275
e-value: 3.1E-19
score: 79.9
coord: 366..439
e-value: 7.1E-23
score: 92.0
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 201..267
e-value: 8.0E-16
score: 57.6
coord: 115..185
e-value: 3.6E-21
score: 74.7
coord: 367..436
e-value: 1.0E-18
score: 66.9
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 113..191
score: 19.519
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 365..443
score: 17.114
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 199..279
score: 16.892
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 351..453
e-value: 3.5E-23
score: 84.3
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 199..282
e-value: 3.8E-24
score: 86.7
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 44..198
e-value: 1.9E-29
score: 104.3
IPR006548Splicing factor ELAV/HuTIGRFAMTIGR01661TIGR01661coord: 110..443
e-value: 8.4E-143
score: 474.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 32..60
NoneNo IPR availablePANTHERPTHR10352EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT Gcoord: 95..443
NoneNo IPR availablePANTHERPTHR10352:SF25FOUND IN NEURONS, ISOFORM A-RELATEDcoord: 95..443
NoneNo IPR availableCDDcd12377RRM3_Hucoord: 364..441
e-value: 5.09409E-50
score: 163.261
NoneNo IPR availableCDDcd12652RRM2_Hucoord: 199..277
e-value: 1.22151E-45
score: 151.684
IPR034775Splicing factor ELAV/Hu, RNA recognition motif 1CDDcd12650RRM1_Hucoord: 112..189
e-value: 2.2917E-49
score: 161.438
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 361..451
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 112..269