5-oxoprolinase

Overview
Name5-oxoprolinase
Smed IDSMED30004785
Length (bp)3999
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 5-oxoprolinase (SMED30004785) t-SNE clustered cells

Violin plots show distribution of expression levels for 5-oxoprolinase (SMED30004785) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 5-oxoprolinase (SMED30004785) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 5-oxoprolinase (SMED30004785) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004785

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30004785SMESG000025866.1 dd_Smed_v4_5008_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004785SMESG000025866.1 dd_Smed_v4_5008_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004785SMESG000025866.1 dd_Smed_v4_5008_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 5-oxoprolinase vs. Ensembl Human
Match: OPLAH (5-oxoprolinase, ATP-hydrolysing [Source:HGNC Symbol;Acc:HGNC:8149])

HSP 1 Score: 1465.67 bits (3793), Expect = 0.000e+0
Identity = 742/1259 (58.94%), Postives = 937/1259 (74.42%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGIISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSR--TDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKD 3850
            AIDRGGTFTDV+ +     +  LKLLSEDP NY DAP E IRRI+E+E G+    +Q +D  +I  IRMGTTVATNALLERKGE  ALL+T GFRDLL+IG Q+R ++FDL + +PE+LY  V+EV+ERV+L   +      G    GR  + + V+ P++   +R  L+ LL  GI+S+AV L HSY +  HE+++G +A EL F  +SLSS+ MPM+++VPRG T  ADAYLTP I++Y+  F  GF G   +  +LFM+SDGGL+PM  F GS A+LSGPAGGV+GY+ TT+  +  QP++GFDMGGTSTDVSRY G  EH++E+ TAG+ +Q+PQLDINTVAAGGGSRLFFR   G+F+VGPESAGAHPGP CYRK G +TVTDANLVL R+L   FP IFGP ENQPL  +AS KA++ +  EVN F  +        +S+E+VA+GF+ VANE+MCRPIR+LTQ +G+D S H+LACFGGAGGQHAC+IAR LGM  V IHR SG+LSA GLALADVV E QEPC LLY    F+++ +R+  L+E C++ L++QGF    I  E FL++RY+GTDCALMVS +    T    +   F  +F+ RY  EFGF++  R +++DD+RVRG+G SG+   R E      +   + ++    YF+ GY  T VYLL +L     + GP +IID N TI+VEP C   V + GD+ I++G +        + D +QLSIFSHRFMSIAEQMGR+LQRT+ISTNIKERLDFSCALFGPDGGLV+NAPHIPVHLGAMQ TVQ+Q+++L     PGDV+LSNHP  GGSHLPDLTVITPVF  G   P+FY+A+RGHHADIGG TPGSMPPHS  + +EGAVF +F +V+  +FQE+ V EAL+ P + P CSG+RN+ DN+SDLRAQVAAN+KG  LV ELI +YGL+VVQ+YMG+IQ NAELAVR ML+  G S  ++    E+S+ED MD G+ I+L+V I   +GSA+FDF+G+G +  GNLN P AV  S LIYCLRC+VG D+PLNQGCL P++V+IP  S L+P+ +AAVVGGNVLTSQR+VDVI  AFGACAASQGCMNNVT G+  +GYYET+AGG+GAGPSWHGRSG+H+HMTNTRITD EILESRYPVIL RF L+RG+GG G+F GGDGV R L FR + +LS+LTERR F PYGL  GE G +GLN+LI+  K  R +++GGK S+ + PGDV  L TPGGGG+G+ +
Sbjct:   11 AIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGIRRILEQEAGMLLPRDQPLDSSHIASIRMGTTVATNALLERKGERVALLVTRGFRDLLHIGTQARGDLFDLAVPMPEVLYEEVLEVDERVVLHRGEAG---TGTPVKGRTGDLLEVQQPVDLGALRGKLEGLLSRGIRSLAVVLMHSYTWAQHEQQVGVLARELGFTHVSLSSEAMPMVRIVPRGHTACADAYLTPAIQRYVQGFCRGFQGQLKDVQVLFMRSDGGLAPMDTFSGSSAVLSGPAGGVVGYSATTYQQEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDINTVAAGGGSRLFFRS--GLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFGPGENQPLSPEASRKALEAVATEVNSFLTNGPCPA-SPLSLEEVAMGFVRVANEAMCRPIRALTQARGHDPSAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLLSALGLALADVVHEAQEPCSLLYAPETFVQLDQRLSRLEEQCVDALQAQGFPRSQISTESFLHLRYQGTDCALMVSAHQHPATARSPRAGDFGAAFVERYMREFGFVIPERPVVVDDVRVRGTGRSGL---RLEDAPKAQTGPPRVDKMTQCYFEGGYQETPVYLLAELGYGHKLHGPCLIIDSNSTILVEPGCQAEVTKTGDICISVG-AEVPGTVGPQLDPIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQETVQFQIQHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFWPGQTRPVFYVASRGHHADIGGITPGSMPPHSTMLQQEGAVFLSFKLVQGGVFQEEAVTEALRAPGKVPNCSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQANAELAVRDMLRAFGTSRQARGLPLEVSSEDHMDDGSPIRLRVQISLSQGSAVFDFSGTGPEVFGNLNAPRAVTLSALIYCLRCLVGRDIPLNQGCLAPVRVVIPRGSILDPSPEAAVVGGNVLTSQRVVDVILGAFGACAASQGCMNNVTLGNAHMGYYETVAGGAGAGPSWHGRSGVHSHMTNTRITDPEILESRYPVILRRFELRRGSGGRGRFRGGDGVTRELLFREEALLSVLTERRAFRPYGLHGGEPGARGLNLLIR--KNGRTVNLGGKTSVTVYPGDVFCLHTPGGGGYGDPE 1257          
BLAST of 5-oxoprolinase vs. Ensembl Human
Match: OPLAH (5-oxoprolinase, ATP-hydrolysing [Source:HGNC Symbol;Acc:HGNC:8149])

HSP 1 Score: 165.622 bits (418), Expect = 2.890e-45
Identity = 81/132 (61.36%), Postives = 101/132 (76.52%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVIL 475
            AIDRGGTFTDV+ +     +  LKLLSEDP NY DAP E IRRI+E+E G+    +Q +D  +I  IRMGTTVATNALLERKGE  ALL+T GFRDLL+IG Q+R ++FDL + +PE+LY  V+EV+ERV+L
Sbjct:  107 AIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGIRRILEQEAGMLLPRDQPLDSSHIASIRMGTTVATNALLERKGERVALLVTRGFRDLLHIGTQARGDLFDLAVPMPEVLYEEVLEVDERVVL 238          
BLAST of 5-oxoprolinase vs. Ensembl Celegans
Match: Y38F2AR.12 (pep chromosome:WBcel235:IV:2399515:2412410:-1 gene:WBGene00021430.1 transcript:Y38F2AR.12a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y38F2AR.12)

HSP 1 Score: 1385.16 bits (3584), Expect = 0.000e+0
Identity = 709/1264 (56.09%), Postives = 919/1264 (72.71%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILL-NPKCQLPVQGIISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGN--SRTDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDN-GYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLN-NKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKDST 3856
            AIDRGGTFTDV      +++  LK+LS DP NY DAP EAIR+++E+E G        +    I WIRMGTTVATNALLERKGE   LLIT+GF+DLL+IGNQ+RP IFD  I++PE+LY  V+EV+ERV++L   K  L     I    N  +++V   ++E +++  L +L + G+KS+A+   HS+IYP HE++ G IA +  F  +SLS Q+MPMIK+VPRGFTV ADAYLTP I +Y+D FK GF  +  +  + FMQSDGGL  M KF GSRAILSGPAGGV+G A T + +   +P++GFDMGGTSTDV RY G+LEH+ E+ TAGI IQ+PQLDI TVAAGGGSRLFFR  DG+ +VGPESA AHPGP+CYRK GYLTVTDANLVL RI+ +YFPKIFGP  ++ LD DASYKAM +ITE +N F  S   + F   SVE+VALGF+ VANE MCRPIR+LTQ +G++ S+H+LACFGGAGGQHAC++A+ LG+ +V IH+++ +LSA+G+ALADVV E Q P  ++Y   NF K+  +  +L+   +  L++QGF E  I+ + F++MRY+ TD A+M+S +     DL    D F  +    Y+ EFGF+LE+R+IIIDD+R+R  G SG  + +    +  D      +    VYF+N  ++ T VYLLE++     I+GPA++IDKN TIV+EP     + E G++++ IGN     +  TE D ++L+IFS+RFMSIAEQMGR+LQRT+ISTNIKERLDFSCALF P+GGL+ANAPHIPVHLG MQ TV++Q+ +        GDV L+NHP  GG HLPD TVITPVF KG + P+F++ANRGHHADIGG  PGSMPP++  I +EGA F +F +V   +FQE+ +I+AL+ P + PGCS +RNISDNI+DL AQ+AAN KG  LV+ LI EY L+VV +YM +IQ+ AEL VR MLK++G     K G S+LS EDFMD GT IKL V ID++EG+AIFDFTG+G ++  + N P AV  S + YCLRC+V  D+PLN GCL PI++ IPE + L+P+E A VV GNVLTSQR+ DVIFK F   AASQGCMNN+ FGD+  GYYETIAGG+GAG  +HGRSG+HTHMTNTRITD EILE+R+PVIL  + L+ G+GG GK+ GGDGV R L+F  K+ LSLLTERR F PYGL  G+ G++GLN+L    +  R +++G K S EI  GD+L ++TPGGGG+G  +++
Sbjct:    8 AIDRGGTFTDVIVFKPNSEVEVLKVLSVDPANYTDAPTEAIRQVLEREGGKKIPRGVALPTDSISWIRMGTTVATNALLERKGERIGLLITKGFKDLLFIGNQARPKIFDFNIQIPEVLYEDVVEVDERVLILEQTKELLDENAQIETTINGLQIVVEKKVDELELKEKLGELKEKGVKSVAILFLHSFIYPNHEKEAGDIAKKFGFDYVSLSHQVMPMIKVVPRGFTVCADAYLTPKIMEYLDGFKAGFSDIS-SVRVNFMQSDGGLCEMDKFRGSRAILSGPAGGVVGIASTAYKASDKKPVIGFDMGGTSTDVCRYSGYLEHVMETTTAGITIQAPQLDIRTVAAGGGSRLFFR--DGLLIVGPESASAHPGPVCYRKNGYLTVTDANLVLGRIIPEYFPKIFGPNADEELDKDASYKAMAEITERINRFMESTTHQKF---SVEEVALGFLAVANEEMCRPIRTLTQSRGFNPSEHVLACFGGAGGQHACAVAKVLGISQVRIHKYASLLSAYGIALADVVDESQTPAQVVYEEENFPKLYSQFMDLRSKSLAGLKTQGFTESQIETKYFMHMRYEKTDTAIMISCDIGKSEDLASFRDEFRTT----YRREFGFVLEDRNIIIDDVRIRTRGKSGCHVEKTIKQAAEDQRQAVLKSVSSVYFENLKFVETGVYLLEEMLAGQIINGPALLIDKNSTIVIEPSSTVTITEHGNVELQIGNDVE-KDLTTEVDPIRLAIFSNRFMSIAEQMGRILQRTAISTNIKERLDFSCALFNPEGGLIANAPHIPVHLGGMQYTVKFQIDHRGIENIKEGDVYLANHPTAGGCHLPDFTVITPVFFKGHKTPVFFVANRGHHADIGGLVPGSMPPNAHHIDQEGASFISFKLVDEGVFQEQRLIDALKAPGKVPGCSAARNISDNIADLNAQIAANRKGIQLVTSLIEEYSLDVVHAYMQHIQNTAELCVREMLKKVGRKVLEKTGKSQLSGEDFMDDGTVIKLTVDIDSEEGTAIFDFTGTGPESYSSCNAPRAVTMSAVTYCLRCLVEKDIPLNNGCLAPIQIKIPEGTLLSPSETAPVVAGNVLTSQRLCDVIFKTFDIVAASQGCMNNLVFGDETCGYYETIAGGAGAGNGFHGRSGVHTHMTNTRITDPEILENRFPVILREWKLRDGSGGSGKWEGGDGVVRQLEFTRKLTLSLLTERRAFQPYGLHGGQPGQRGLNLL---KRGGRAVNIGSKASFEIQKGDILCIETPGGGGYGAPENS 1257          
BLAST of 5-oxoprolinase vs. Ensembl Celegans
Match: Y38F2AR.12 (pep chromosome:WBcel235:IV:2399515:2409831:-1 gene:WBGene00021430.1 transcript:Y38F2AR.12c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y38F2AR.12)

HSP 1 Score: 1066.22 bits (2756), Expect = 0.000e+0
Identity = 546/956 (57.11%), Postives = 705/956 (73.74%), Query Frame = 2
Query: 1001 MGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGN--SRTDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDN-GYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLN-NKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKDST 3856
            MGGTSTDV RY G+LEH+ E+ TAGI IQ+PQLDI TVAAGGGSRLFFR  DG+ +VGPESA AHPGP+CYRK GYLTVTDANLVL RI+ +YFPKIFGP  ++ LD DASYKAM +ITE +N F  S   + F   SVE+VALGF+ VANE MCRPIR+LTQ +G++ S+H+LACFGGAGGQHAC++A+ LG+ +V IH+++ +LSA+G+ALADVV E Q P  ++Y   NF K+  +  +L+   +  L++QGF E  I+ + F++MRY+ TD A+M+S +     DL    D F  +    Y+ EFGF+LE+R+IIIDD+R+R  G SG  + +    +  D      +    VYF+N  ++ T VYLLE++     I+GPA++IDKN TIV+EP     + E G++++ IGN     +  TE D ++L+IFS+RFMSIAEQMGR+LQRT+ISTNIKERLDFSCALF P+GGL+ANAPHIPVHLG MQ TV++Q+ +        GDV L+NHP  GG HLPD TVITPVF KG + P+F++ANRGHHADIGG  PGSMPP++  I +EGA F +F +V   +FQE+ +I+AL+ P + PGCS +RNISDNI+DL AQ+AAN KG  LV+ LI EY L+VV +YM +IQ+ AEL VR MLK++G     K G S+LS EDFMD GT IKL V ID++EG+AIFDFTG+G ++  + N P AV  S + YCLRC+V  D+PLN GCL PI++ IPE + L+P+E A VV GNVLTSQR+ DVIFK F   AASQGCMNN+ FGD+  GYYETIAGG+GAG  +HGRSG+HTHMTNTRITD EILE+R+PVIL  + L+ G+GG GK+ GGDGV R L+F  K+ LSLLTERR F PYGL  G+ G++GLN+L    +  R +++G K S EI  GD+L ++TPGGGG+G  +++
Sbjct:    1 MGGTSTDVCRYSGYLEHVMETTTAGITIQAPQLDIRTVAAGGGSRLFFR--DGLLIVGPESASAHPGPVCYRKNGYLTVTDANLVLGRIIPEYFPKIFGPNADEELDKDASYKAMAEITERINRFMESTTHQKF---SVEEVALGFLAVANEEMCRPIRTLTQSRGFNPSEHVLACFGGAGGQHACAVAKVLGISQVRIHKYASLLSAYGIALADVVDESQTPAQVVYEEENFPKLYSQFMDLRSKSLAGLKTQGFTESQIETKYFMHMRYEKTDTAIMISCDIGKSEDLASFRDEFRTT----YRREFGFVLEDRNIIIDDVRIRTRGKSGCHVEKTIKQAAEDQRQAVLKSVSSVYFENLKFVETGVYLLEEMLAGQIINGPALLIDKNSTIVIEPSSTVTITEHGNVELQIGNDVE-KDLTTEVDPIRLAIFSNRFMSIAEQMGRILQRTAISTNIKERLDFSCALFNPEGGLIANAPHIPVHLGGMQYTVKFQIDHRGIENIKEGDVYLANHPTAGGCHLPDFTVITPVFFKGHKTPVFFVANRGHHADIGGLVPGSMPPNAHHIDQEGASFISFKLVDEGVFQEQRLIDALKAPGKVPGCSAARNISDNIADLNAQIAANRKGIQLVTSLIEEYSLDVVHAYMQHIQNTAELCVREMLKKVGRKVLEKTGKSQLSGEDFMDDGTVIKLTVDIDSEEGTAIFDFTGTGPESYSSCNAPRAVTMSAVTYCLRCLVEKDIPLNNGCLAPIQIKIPEGTLLSPSETAPVVAGNVLTSQRLCDVIFKTFDIVAASQGCMNNLVFGDETCGYYETIAGGAGAGNGFHGRSGVHTHMTNTRITDPEILENRFPVILREWKLRDGSGGSGKWEGGDGVVRQLEFTRKLTLSLLTERRAFQPYGLHGGQPGQRGLNLL---KRGGRAVNIGSKASFEIQKGDILCIETPGGGGYGAPENS 943          
BLAST of 5-oxoprolinase vs. Ensembl Celegans
Match: Y38F2AR.12 (pep chromosome:WBcel235:IV:2399515:2403143:-1 gene:WBGene00021430.1 transcript:Y38F2AR.12b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y38F2AR.12)

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 298/503 (59.24%), Postives = 378/503 (75.15%), Query Frame = 2
Query: 2351 SISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLN-NKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKDST 3856
            +I  + +ERLDFSCALF P+GGL+ANAPHIPVHLG MQ TV++Q+ +        GDV L+NHP  GG HLPD TVITPVF KG + P+F++ANRGHHADIGG  PGSMPP++  I +EGA F +F +V   +FQE+ +I+AL+ P + PGCS +RNISDNI+DL AQ+AAN KG  LV+ LI EY L+VV +YM +IQ+ AEL VR MLK++G     K G S+LS EDFMD GT IKL V ID++EG+AIFDFTG+G ++  + N P AV  S + YCLRC+V  D+PLN GCL PI++ IPE + L+P+E A VV GNVLTSQR+ DVIFK F   AASQGCMNN+ FGD+  GYYETIAGG+GAG  +HGRSG+HTHMTNTRITD EILE+R+PVIL  + L+ G+GG GK+ GGDGV R L+F  K+ LSLLTERR F PYGL  G+ G++GLN+L +     R +++G K S EI  GD+L ++TPGGGG+G  +++
Sbjct:   17 TIFLSFQERLDFSCALFNPEGGLIANAPHIPVHLGGMQYTVKFQIDHRGIENIKEGDVYLANHPTAGGCHLPDFTVITPVFFKGHKTPVFFVANRGHHADIGGLVPGSMPPNAHHIDQEGASFISFKLVDEGVFQEQRLIDALKAPGKVPGCSAARNISDNIADLNAQIAANRKGIQLVTSLIEEYSLDVVHAYMQHIQNTAELCVREMLKKVGRKVLEKTGKSQLSGEDFMDDGTVIKLTVDIDSEEGTAIFDFTGTGPESYSSCNAPRAVTMSAVTYCLRCLVEKDIPLNNGCLAPIQIKIPEGTLLSPSETAPVVAGNVLTSQRLCDVIFKTFDIVAASQGCMNNLVFGDETCGYYETIAGGAGAGNGFHGRSGVHTHMTNTRITDPEILENRFPVILREWKLRDGSGGSGKWEGGDGVVRQLEFTRKLTLSLLTERRAFQPYGLHGGQPGQRGLNLLKRG---GRAVNIGSKASFEIQKGDILCIETPGGGGYGAPENS 516          
BLAST of 5-oxoprolinase vs. Ensembl Fly
Match: CG4752 (gene:FBgn0034733 transcript:FBtr0071832)

HSP 1 Score: 1401.34 bits (3626), Expect = 0.000e+0
Identity = 735/1300 (56.54%), Postives = 931/1300 (71.62%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNP-KCQLPVQGIISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMV---SGNSRTD---LKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGD--MDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXX-XXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGN-KDSTTELDSKAQCNRKISTMKGSVHNYHLQQFSA 3946
            AIDRGGTFTDV       K+ T+KLLSEDPE Y+DAP E IRRI+++E G    ++  VD   I W+RMGTTVATNALLERKG+P  L++  GFRDLLYIGNQ+RP IFDL I  P  LY +V+EV+ R++     +C+L        G    K +   P++E  +R  L    D G+ S++V LAHSY  P HE ++G IA EL F  ++LS Q MPM ++V RG+T  A+AYLTP + +Y+ SFK GF    +   +LFMQSDGGL+ M  F G+RAILSGPAGGV+GYA T     +  P++GFDMGGTSTDVSRY G  EH+ ES TAG+ IQ+PQLDINTVAAGGGSRLFFR   GIF+VGPESAG+HPGP CY+K G LTVTDANL+L RIL +YFPKIFGP+EN+PLD + +     ++  E+N++ +S    D + +SVE VALGFI VANE+MCRPIR+LTQ +G DT+ H+L+CFGGAGGQHACSIAR LG+ +V +H+++GILSA+G+ALADVV E QEP  L ++  N  ++ +R++ L + C ++L  QGF    I++EPFL++RY+GTD ALMV   +G   +D   L   Y  F  +F+ RY++EFGF+L+NR II+DDIR+RG G +  +   +  +         +E    +YFD G   + +YL + L     I+GPA++ID+  TIVVEP+C   V + GD  MD+  G    ++    + D V LSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLV+NAPHIPVHLGAMQ TVQYQ+R        GDVIL+NHP  GGSHLPDLTVITPVF +    P+F++A+RGHHADIGG TPGSMPPHS S+ +EGA FK+F IV+N +FQE+++IE L  P+   G  G+RN+SDN+SDL+AQ+AAN KG  LV+ELI  YGL+VVQ+YM +IQ NAELAVR ML++IG  T  + G + L A++FMD G+ I LKV+ID ++GSA+ DFTGSG +  GN N P A+  S LIYCLRCMVGHDVPLNQGCL PI+VIIP++S L+P+E AAVVGGNV TSQRIVD + KAFG CAASQGCMNN+T GD+  GYYET+AGG+GAGP WHG  G+HTHMTNTRITD EILE RYP+IL+RF L+    G      GG+GVER L FR  + LS+LTERR   PYGL  GESG+ G N+++K D   R I + GK  +++  GD   ++TPGGGG+G  +D +   +S  Q   K    +G+V NY   Q SA
Sbjct:    9 AIDRGGTFTDVLCICPNGKVRTMKLLSEDPERYSDAPREGIRRILKEETGEDLAASGLVDTSKIGWVRMGTTVATNALLERKGDPVVLVVNSGFRDLLYIGNQARPKIFDLNIRKPANLYKSVVEVDCRIVPKQADRCELNHSWKELEGVAGTKYLEVRPVDEVAVRQALSDARDQGVSSVSVVLAHSYACPEHELRVGAIARELGFSHVTLSHQAMPMCRVVARGYTACAEAYLTPHVDRYLASFKSGFDKQLEGVDVLFMQSDGGLTNMENFRGARAILSGPAGGVVGYALTGARETEL-PLIGFDMGGTSTDVSRYAGTYEHVIESTTAGVTIQAPQLDINTVAAGGGSRLFFRS--GIFVVGPESAGSHPGPACYKKGGPLTVTDANLILGRILPQYFPKIFGPQENEPLDHEIARSKFVELQAEINNYLKS--SGDNRVLSVEDVALGFIRVANETMCRPIRALTQSRGLDTANHVLSCFGGAGGQHACSIARNLGIAKVVVHKYAGILSAYGMALADVVQEFQEPNGLEFSDANAQQLKERLDALSKQCQDKLSEQGFKR--IELEPFLHLRYEGTDGALMVAPSTGKQSSDSNPLLAAYGDFHATFLERYRTEFGFVLQNRRIIVDDIRIRGLGKN--ETPPESKVQAAAEAKPPAEANTRLYFDQGAFDSPIYLTKNLLAGHRITGPAVLIDQLSTIVVEPECGIQVTQFGDLIMDVKTGGKHGIN---ADLDPVHLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQETVQYQLRVRGETLKNGDVILANHPSAGGSHLPDLTVITPVFYETHPRPVFFVASRGHHADIGGITPGSMPPHSTSLAQEGAAFKSFLIVENGLFQEQQIIEQLTTPTAAKGAVGTRNLSDNLSDLKAQIAANHKGIQLVAELIGSYGLDVVQAYMSHIQKNAELAVRDMLRQIGRDTLERTGSTVLEAKEFMDDGSPIALKVTIDAEQGSALCDFTGSGVEVWGNCNAPRAITLSALIYCLRCMVGHDVPLNQGCLAPIQVIIPKNSILDPSEGAAVVGGNVQTSQRIVDTVLKAFGVCAASQGCMNNITIGDESWGYYETVAGGAGAGPGWHGAGGVHTHMTNTRITDPEILELRYPMILKRFCLRTDGSGGRGQFHGGEGVERDLLFRKPVTLSVLTERRTLQPYGLAGGESGKSGRNLVVKRD--GRVIALAGKTCIDVEAGDTFAMKTPGGGGYGPIEDFSKSGESLNQETSKRYVERGTVFNYLQCQESA 1294          
BLAST of 5-oxoprolinase vs. Ensembl Zebrafish
Match: oplah (5-oxoprolinase, ATP-hydrolysing [Source:ZFIN;Acc:ZDB-GENE-121214-293])

HSP 1 Score: 1505.35 bits (3896), Expect = 0.000e+0
Identity = 769/1289 (59.66%), Postives = 948/1289 (73.55%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGIISNGRNEEKVIVRTPLNES----------KIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDF------NRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSRTDLKG--KYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKDSTT---ELDSKAQC 3883
            AIDRGGTFTDV+ R    +   LKLLS DP+NY DAP E IRR++E+E G     +Q VD   I WIRMGTTVATNALLER+GE  ALL+T GF+DLL+IG Q+RPN+FDL++ +P++LY  VIEVEERVIL    CQLP        RNE K IV     ES          ++  DL+++   GI+S+AV L HSY +  HE+ +G +A  L F Q+SLSS++MPM++ VPRG+TV ADAYLTP I  Y+  F  GF G      +LFMQSDGGL+PM +F GSRA+LSGPAGGV+GYA T + S + +P++GFDMGGTSTDVSRY G  EH++E+  AGI +Q+PQLDINTVAAGGGSRLFFR   G+F+VGPESAGAHPGP CYRK G LTVTDANL L R+L  +FPKIFGP EN+PL  + + K    +T+E+N F      + S  G     MS+E +A+GFI+VANE+MCRPIR+LTQ KG+DTS+H+LACFGGAGGQHAC+IAR LGM+ VFIH++SG+LSA+GLALADVV E QEPC L Y + +F ++ +RIE L + C E L  +GF+   I IE FL++RY+GTDCALM++           +   F  +F  RY  EFGF + +R I++DDIRVRGSG SGI   R E  +          +    YF++ Y+ T+VYL E L  +  I GPAIIIDKN TI+VEP CV  + E+GD+ I +G  +      TE +T+QLSIFSHRFMSIAEQMGRVLQRT+ISTNIKERLDFSCA+FGPDGGLV+NAPHIPVHLGAMQ TVQ+Q++        GDVILSNHP  GGSHLPDLTVITPVF+ G   P+F++A+RGHHADIGG TPGSMPPHS S+ +EGAVF +F +V   IFQEK V EAL  P++YPGCSG+RN+ DN+SDLRAQVAAN++G  LV ELI  YGL+VVQ+YMG+IQ NAELAVR MLK+       K G  E+ AED MD GT I+LKV I+ ++GSA+FDFTG+G +  GN N P A+  S LIYCLRCMVG D+PLNQGCL P+KVIIP  S L P+++AAVVGGNVLTSQR+VDVIFKAF  CAASQGCMNNV+FG +  GYYET+AGG+GAGPSW+GR GIHTHMTNTRITD EILESRYPVILE+FSL+  +GG G + GGDGV R L+FRS ++LS+LTERR   PYGL  G++G  GLN+L K+D   R +++G K ++ ++PGD+  L TPGGGG+G  D       L SK +C
Sbjct:   11 AIDRGGTFTDVFARLPDGREKVLKLLSHDPQNYKDAPTEGIRRVLEEETGKSFPRDQPVDTSQIGWIRMGTTVATNALLERQGERTALLVTSGFKDLLHIGTQARPNLFDLEVCMPDVLYEEVIEVEERVILRQDSCQLP--------RNEPKRIVTGSTGESLEVWRELDLQRVEQDLRRVQSKGIRSLAVLLLHSYTWAAHEKAVGSLAKRLGFAQVSLSSEVMPMVRAVPRGYTVCADAYLTPKIHLYLTKFTAGFKGGLKGVDVLFMQSDGGLTPMEQFCGSRAVLSGPAGGVVGYAVTCYKSTEKKPVIGFDMGGTSTDVSRYAGQYEHVFEATIAGITLQAPQLDINTVAAGGGSRLFFRS--GMFVVGPESAGAHPGPACYRKGGPLTVTDANLALGRLLPSFFPKIFGPGENEPLSTEETMKHFSKLTQEINHFLSTNQTSNSASGAQLSKMSIEDIAMGFINVANEAMCRPIRALTQAKGHDTSEHVLACFGGAGGQHACAIARALGMKMVFIHKYSGVLSAYGLALADVVEEVQEPCSLQYEAGSFSELDRRIEQLSQRCDEILRKRGFSRSQINIEVFLHLRYEGTDCALMITATDHPSNASSCRTGDFRTAFTKRYLKEFGFTITDRPIMVDDIRVRGSGKSGI---RSEVQAKAGQKSPNPIKMTQCYFEDRYLDTSVYLWEDLSCDHSIQGPAIIIDKNSTILVEPTCVAHLTEDGDVCIAVGMGTQCV-LGTELNTIQLSIFSHRFMSIAEQMGRVLQRTAISTNIKERLDFSCAVFGPDGGLVSNAPHIPVHLGAMQETVQFQIKAAGGSLKEGDVILSNHPCAGGSHLPDLTVITPVFRDGVSAPVFFVASRGHHADIGGITPGSMPPHSTSLQQEGAVFTSFKLVTGGIFQEKAVTEALMAPAQYPGCSGTRNLRDNLSDLRAQVAANQRGCQLVGELITSYGLDVVQAYMGHIQSNAELAVRDMLKDFAHRQREKTGSLEVEAEDQMDDGTLIRLKVQINEEQGSAVFDFTGTGTEVWGNCNAPRAITLSALIYCLRCMVGQDIPLNQGCLAPVKVIIPPGSILQPSQNAAVVGGNVLTSQRVVDVIFKAFQVCAASQGCMNNVSFGCEKSGYYETVAGGAGAGPSWNGRGGIHTHMTNTRITDPEILESRYPVILEQFSLRPDSGGAGLYRGGDGVIRKLRFRSPVVLSVLTERRSTKPYGLHGGKNGAPGLNLLHKTD--GRVLNLGAKTTISLDPGDMFSLFTPGGGGYGRMDELDGDHHLPSKRRC 1283          
BLAST of 5-oxoprolinase vs. Ensembl Zebrafish
Match: oplah (5-oxoprolinase, ATP-hydrolysing [Source:ZFIN;Acc:ZDB-GENE-121214-293])

HSP 1 Score: 1505.35 bits (3896), Expect = 0.000e+0
Identity = 769/1289 (59.66%), Postives = 948/1289 (73.55%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGIISNGRNEEKVIVRTPLNES----------KIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDF------NRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSRTDLKG--KYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKDSTT---ELDSKAQC 3883
            AIDRGGTFTDV+ R    +   LKLLS DP+NY DAP E IRR++E+E G     +Q VD   I WIRMGTTVATNALLER+GE  ALL+T GF+DLL+IG Q+RPN+FDL++ +P++LY  VIEVEERVIL    CQLP        RNE K IV     ES          ++  DL+++   GI+S+AV L HSY +  HE+ +G +A  L F Q+SLSS++MPM++ VPRG+TV ADAYLTP I  Y+  F  GF G      +LFMQSDGGL+PM +F GSRA+LSGPAGGV+GYA T + S + +P++GFDMGGTSTDVSRY G  EH++E+  AGI +Q+PQLDINTVAAGGGSRLFFR   G+F+VGPESAGAHPGP CYRK G LTVTDANL L R+L  +FPKIFGP EN+PL  + + K    +T+E+N F      + S  G     MS+E +A+GFI+VANE+MCRPIR+LTQ KG+DTS+H+LACFGGAGGQHAC+IAR LGM+ VFIH++SG+LSA+GLALADVV E QEPC L Y + +F ++ +RIE L + C E L  +GF+   I IE FL++RY+GTDCALM++           +   F  +F  RY  EFGF + +R I++DDIRVRGSG SGI   R E  +          +    YF++ Y+ T+VYL E L  +  I GPAIIIDKN TI+VEP CV  + E+GD+ I +G  +      TE +T+QLSIFSHRFMSIAEQMGRVLQRT+ISTNIKERLDFSCA+FGPDGGLV+NAPHIPVHLGAMQ TVQ+Q++        GDVILSNHP  GGSHLPDLTVITPVF+ G   P+F++A+RGHHADIGG TPGSMPPHS S+ +EGAVF +F +V   IFQEK V EAL  P++YPGCSG+RN+ DN+SDLRAQVAAN++G  LV ELI  YGL+VVQ+YMG+IQ NAELAVR MLK+       K G  E+ AED MD GT I+LKV I+ ++GSA+FDFTG+G +  GN N P A+  S LIYCLRCMVG D+PLNQGCL P+KVIIP  S L P+++AAVVGGNVLTSQR+VDVIFKAF  CAASQGCMNNV+FG +  GYYET+AGG+GAGPSW+GR GIHTHMTNTRITD EILESRYPVILE+FSL+  +GG G + GGDGV R L+FRS ++LS+LTERR   PYGL  G++G  GLN+L K+D   R +++G K ++ ++PGD+  L TPGGGG+G  D       L SK +C
Sbjct:   11 AIDRGGTFTDVFARLPDGREKVLKLLSHDPQNYKDAPTEGIRRVLEEETGKSFPRDQPVDTSQIGWIRMGTTVATNALLERQGERTALLVTSGFKDLLHIGTQARPNLFDLEVCMPDVLYEEVIEVEERVILRQDSCQLP--------RNEPKRIVTGSTGESLEVWRELDLQRVEQDLRRVQSKGIRSLAVLLLHSYTWAAHEKAVGSLAKRLGFAQVSLSSEVMPMVRAVPRGYTVCADAYLTPKIHLYLTKFTAGFKGGLKGVDVLFMQSDGGLTPMEQFCGSRAVLSGPAGGVVGYAVTCYKSTEKKPVIGFDMGGTSTDVSRYAGQYEHVFEATIAGITLQAPQLDINTVAAGGGSRLFFRS--GMFVVGPESAGAHPGPACYRKGGPLTVTDANLALGRLLPSFFPKIFGPGENEPLSTEETMKHFSKLTQEINHFLSTNQTSNSASGAQLSKMSIEDIAMGFINVANEAMCRPIRALTQAKGHDTSEHVLACFGGAGGQHACAIARALGMKMVFIHKYSGVLSAYGLALADVVEEVQEPCSLQYEAGSFSELDRRIEQLSQRCDEILRKRGFSRSQINIEVFLHLRYEGTDCALMITATDHPSNASSCRTGDFRTAFTKRYLKEFGFTITDRPIMVDDIRVRGSGKSGI---RSEVQAKAGQKSPNPIKMTQCYFEDRYLDTSVYLWEDLSCDHSIQGPAIIIDKNSTILVEPTCVAHLTEDGDVCIAVGMGTQCV-LGTELNTIQLSIFSHRFMSIAEQMGRVLQRTAISTNIKERLDFSCAVFGPDGGLVSNAPHIPVHLGAMQETVQFQIKAAGGSLKEGDVILSNHPCAGGSHLPDLTVITPVFRDGVSAPVFFVASRGHHADIGGITPGSMPPHSTSLQQEGAVFTSFKLVTGGIFQEKAVTEALMAPAQYPGCSGTRNLRDNLSDLRAQVAANQRGCQLVGELITSYGLDVVQAYMGHIQSNAELAVRDMLKDFAHRQREKTGSLEVEAEDQMDDGTLIRLKVQINEEQGSAVFDFTGTGTEVWGNCNAPRAITLSALIYCLRCMVGQDIPLNQGCLAPVKVIIPPGSILQPSQNAAVVGGNVLTSQRVVDVIFKAFQVCAASQGCMNNVSFGCEKSGYYETVAGGAGAGPSWNGRGGIHTHMTNTRITDPEILESRYPVILEQFSLRPDSGGAGLYRGGDGVIRKLRFRSPVVLSVLTERRSTKPYGLHGGKNGAPGLNLLHKTD--GRVLNLGAKTTISLDPGDMFSLFTPGGGGYGRMDELDGDHHLPSKRRC 1283          
BLAST of 5-oxoprolinase vs. Ensembl Zebrafish
Match: oplah (5-oxoprolinase, ATP-hydrolysing [Source:ZFIN;Acc:ZDB-GENE-121214-293])

HSP 1 Score: 1443.71 bits (3736), Expect = 0.000e+0
Identity = 747/1289 (57.95%), Postives = 924/1289 (71.68%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGIISNGRNEEKVIVRTPLNES----------KIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDF------NRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSRTDLKG--KYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKDSTT---ELDSKAQC 3883
            AIDRGGTFTDV+ R    +   LKLLS DP+NY DAP E IRR++E+E G     +Q VD   I WIRMGTTVATNALLER+GE  ALL+T GF+DLL+IG Q+RPN+FDL++ +P++LY  VIEVEERVIL    CQLP        RNE K IV     ES          ++  DL+++   GI+S+AV L HSY +  HE+ +G +A  L F Q+SLSS++MPM++ VPRG+TV ADAYLTP I  Y+  F  GF G      +LFMQSDGGL+PM +F GSRA+LSGPAGGV+GYA T + S + +P++GFDMGGTSTDVSRY G  EH++E+  AGI +Q+PQLDINTVAAGGGSRLFFR   G+F+VGPESAGAHPGP CYRK G LTVTDANL L R+L  +FPKIFGP EN+PL  + + K    +T+E+N F      + S  G     MS+E +A+GFI+VANE+MCRPIR+LTQ KG+DTS+H+LACFGGAGGQHAC+IAR LGM+ VFIH++SG+LSA+GLALADVV E QEPC L Y + +F ++ +RIE L + C E L  +GF+   I IE FL++RY+GTDCALM++           +   F  +F  RY  EFGF + +R I++DDIRVRGSG SGI   R E  +          +    YF++ Y+ T+VYL E L  +  I GPAIIIDKN TI+VEP CV  + E+GD+ I +G  +      TE +T+QLSIFSHRFMSIAEQMGRVLQRT+ISTNIKERLDFSCA+FGPDGGLV+NAPHIPVHLGAMQ TVQ+Q                                  VF+ G   P+F++A+RGHHADIGG TPGSMPPHS S+ +EGAVF +F +V   IFQEK V EAL  P++YPGCSG+RN+ DN+SDLRAQVAAN++G  LV ELI  YGL+VVQ+YMG+IQ NAELAVR MLK+       K G  E+ AED MD GT I+LKV I+ ++GSA+FDFTG+G +  GN N P A+  S LIYCLRCMVG D+PLNQGCL P+KVIIP  S L P+++AAVVGGNVLTSQR+VDVIFKAF  CAASQGCMNNV+FG +  GYYET+AGG+GAGPSW+GR GIHTHMTNTRITD EILESRYPVILE+FSL+  +GG G + GGDGV R L+FRS ++LS+LTERR   PYGL  G++G  GLN+L K+D   R +++G K ++ ++PGD+  L TPGGGG+G  D       L SK +C
Sbjct:   11 AIDRGGTFTDVFARLPDGREKVLKLLSHDPQNYKDAPTEGIRRVLEEETGKSFPRDQPVDTSQIGWIRMGTTVATNALLERQGERTALLVTSGFKDLLHIGTQARPNLFDLEVCMPDVLYEEVIEVEERVILRQDSCQLP--------RNEPKRIVTGSTGESLEVWRELDLQRVEQDLRRVQSKGIRSLAVLLLHSYTWAAHEKAVGSLAKRLGFAQVSLSSEVMPMVRAVPRGYTVCADAYLTPKIHLYLTKFTAGFKGGLKGVDVLFMQSDGGLTPMEQFCGSRAVLSGPAGGVVGYAVTCYKSTEKKPVIGFDMGGTSTDVSRYAGQYEHVFEATIAGITLQAPQLDINTVAAGGGSRLFFRS--GMFVVGPESAGAHPGPACYRKGGPLTVTDANLALGRLLPSFFPKIFGPGENEPLSTEETMKHFSKLTQEINHFLSTNQTSNSASGAQLSKMSIEDIAMGFINVANEAMCRPIRALTQAKGHDTSEHVLACFGGAGGQHACAIARALGMKMVFIHKYSGVLSAYGLALADVVEEVQEPCSLQYEAGSFSELDRRIEQLSQRCDEILRKRGFSRSQINIEVFLHLRYEGTDCALMITATDHPSNASSCRTGDFRTAFTKRYLKEFGFTITDRPIMVDDIRVRGSGKSGI---RSEVQAKAGQKSPNPIKMTQCYFEDRYLDTSVYLWEDLSCDHSIQGPAIIIDKNSTILVEPTCVAHLTEDGDVCIAVGMGTQCV-LGTELNTIQLSIFSHRFMSIAEQMGRVLQRTAISTNIKERLDFSCAVFGPDGGLVSNAPHIPVHLGAMQETVQFQ----------------------------------VFRDGVSAPVFFVASRGHHADIGGITPGSMPPHSTSLQQEGAVFTSFKLVTGGIFQEKAVTEALMAPAQYPGCSGTRNLRDNLSDLRAQVAANQRGCQLVGELITSYGLDVVQAYMGHIQSNAELAVRDMLKDFAHRQREKTGSLEVEAEDQMDDGTLIRLKVQINEEQGSAVFDFTGTGTEVWGNCNAPRAITLSALIYCLRCMVGQDIPLNQGCLAPVKVIIPPGSILQPSQNAAVVGGNVLTSQRVVDVIFKAFQVCAASQGCMNNVSFGCEKSGYYETVAGGAGAGPSWNGRGGIHTHMTNTRITDPEILESRYPVILEQFSLRPDSGGAGLYRGGDGVIRKLRFRSPVVLSVLTERRSTKPYGLHGGKNGAPGLNLLHKTD--GRVLNLGAKTTISLDPGDMFSLFTPGGGGYGRMDELDGDHHLPSKRRC 1249          
BLAST of 5-oxoprolinase vs. Ensembl Xenopus
Match: oplah (5-oxoprolinase, ATP-hydrolysing [Source:NCBI gene;Acc:780345])

HSP 1 Score: 1488.01 bits (3851), Expect = 0.000e+0
Identity = 769/1255 (61.27%), Postives = 937/1255 (74.66%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGIISN--GRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVS--GNSRTDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQR---TEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTP 3823
            AIDRGGTFTDV+ R    K+  +KLLSEDP NY DAP E IRRI+E+E G     +Q +D   IEWIRMGTTVATNALLERKGE  ALLIT+GFR LL+IGNQ+RP IFDL+I++PE+LY  VIEVEERV+L    C LP     +   G   E + V  PLN +++  DL+ +L  GI+S+AV L HSY +  HE +IG++A  L F  +SLSS++MPMI++VPRG+T  ADAYLTPCIK+Y+  F  GF     +  +LFM+SDGGL+PM  F GSRAILSGPAGGV+GYA TT++ D  QP++GFDMGGTSTDVSRY G  EH++E+ TAGI IQ+PQLD+NTVAAGGGS LFFR   G+F+VGPESAGAHPGP CYRK G LTVTDANL L R+L  YFP+IFGP E+QPL  + +    + +  ++N F     G    S+SVE+VA+GFI VANE+MCRPIRSLTQ KG+DTS+H+LACFGGAGGQHAC+IAR LGM+ VFIH++ G+LSAFG+ALADVV E QEPC + Y+  +F  +  RI  L+  CIE L+ QGF+   I  EPFL++RY+ TDCALM S  G           +F  +F  RY+ EFGF + +R I++DDIRVRG+G +GI   R E          + E     YF++G+  T VYLL+ L  +  ++GPAIIIDKN TI+VEPDC   + E GD+ I+IG+      QR   TE DT+QLSIFSHRFMSIAEQMGR+LQRT+ISTNIKERLDFSCALFGPDGGLV+NAPHIPVHLGAMQ TVQ+Q+R L +    GDV+LSNHP  GGSHLPDLTVITPVF+  +  P+F++A+RGHHADIGG TPGSMPPHSK++ +EGAVF +F +V+   FQE+ V EAL  P   PG SG+RN+ DN+SDLRAQVAAN+KG  LV+ELI+ YGL VVQ+YM +IQ NAE+AVR+ML++      S  G  E+ + D+MD G+ IKLKV I+  EG A+FDFTGSGY+  GN N P A+  S LIYCLRCMVG D+PLNQGCL PI+VIIP+ S L+P+ DAAVVGGNVLTSQRIVDVIFKAF  CAASQGCMNNVTFG+   GYYET+AGG+GAGP WHGRSGIHTHMTNTRITD EILE RYPV+L+RF L  GTGG GKF GGDGV R L FR  ++LS+LTERRVF PYGL+ G SG  GLN+L + D  +  I++GGK S+ + PGD   L TP
Sbjct:    8 AIDRGGTFTDVFARCPGGKVRVMKLLSEDPANYQDAPTEGIRRILEEETGCSFPRDQPLDTGRIEWIRMGTTVATNALLERKGERIALLITKGFRHLLHIGNQARPKIFDLEIQMPEVLYEEVIEVEERVVLTQGGCCLPKGEPTAPPVGSTGECLEVWEPLNLNRLEMDLRNVLARGIRSLAVVLMHSYTWSSHEHQIGELARSLGFTHVSLSSEVMPMIRIVPRGYTACADAYLTPCIKRYLHGFCRGFKNQLKDLQVLFMRSDGGLTPMQNFSGSRAILSGPAGGVVGYAITTYHRDHPQPVIGFDMGGTSTDVSRYAGEYEHVFEATTAGISIQAPQLDVNTVAAGGGSMLFFRS--GLFVVGPESAGAHPGPACYRKGGPLTVTDANLCLGRLLPDYFPRIFGPSEDQPLSREDTLHQFQKLAADINQFQAGRPGSA-ASLSVEEVAMGFIRVANEAMCRPIRSLTQAKGHDTSRHVLACFGGAGGQHACAIARSLGMKTVFIHKYGGVLSAFGMALADVVHEAQEPCSMGYSPESFSLLEGRIAALERRCIEALQEQGFHRSQIDTEPFLHLRYERTDCALMCSNRGYPAAQDSCLVGNFKLAFTDRYQKEFGFTIPSRAIVVDDIRVRGTGSTGI---RCETAVQPSGQPARVEAVARCYFEDGHHDTNVYLLQDLAPDHSVTGPAIIIDKNSTILVEPDCTASITEYGDVRISIGSG----RQRGVGTELDTIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQETVQFQIRNLKDDLKEGDVLLSNHPCAGGSHLPDLTVITPVFRVEAPRPVFFVASRGHHADIGGITPGSMPPHSKTLRDEGAVFTSFKLVRGGEFQEEAVTEALMAPGLIPGSSGTRNLHDNLSDLRAQVAANQKGIQLVNELIDVYGLAVVQAYMAHIQANAEVAVRNMLRDFAERWESHKGALEVESVDYMDDGSPIKLKVRINKQEGGALFDFTGSGYEVFGNCNAPRAITLSALIYCLRCMVGQDIPLNQGCLTPIQVIIPKGSILDPSPDAAVVGGNVLTSQRIVDVIFKAFEVCAASQGCMNNVTFGNKTTGYYETVAGGAGAGPHWHGRSGIHTHMTNTRITDPEILEKRYPVVLKRFELSPGTGGAGKFHGGDGVIRELLFREDIVLSVLTERRVFRPYGLQGGCSGAPGLNLLRRKDGTT--INLGGKTSVNVEPGDTFTLHTP 1250          
BLAST of 5-oxoprolinase vs. Ensembl Xenopus
Match: oplah (5-oxoprolinase, ATP-hydrolysing [Source:NCBI gene;Acc:780345])

HSP 1 Score: 1476.46 bits (3821), Expect = 0.000e+0
Identity = 765/1247 (61.35%), Postives = 933/1247 (74.82%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGIISN--GRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVS--GNSRTDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQR---TEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPG 3799
            AIDRGGTFTDV+ R    K+  +KLLSEDP NY DAP E IRRI+E+E G     +Q +D   IEWIRMGTTVATNALLERKGE  ALLIT+GFR LL+IGNQ+RP IFDL+I++PE+LY  VIEVEERV+L    C LP     +   G   E + V  PLN +++  DL+ +L  GI+S+AV L HSY +  HE +IG++A  L F  +SLSS++MPMI++VPRG+T  ADAYLTPCIK+Y+  F  GF     +  +LFM+SDGGL+PM  F GSRAILSGPAGGV+GYA TT++ D  QP++GFDMGGTSTDVSRY G  EH++E+ TAGI IQ+PQLD+NTVAAGGGS LFFR   G+F+VGPESAGAHPGP CYRK G LTVTDANL L R+L  YFP+IFGP E+QPL  + +    + +  ++N F     G    S+SVE+VA+GFI VANE+MCRPIRSLTQ KG+DTS+H+LACFGGAGGQHAC+IAR LGM+ VFIH++ G+LSAFG+ALADVV E QEPC + Y+  +F  +  RI  L+  CIE L+ QGF+   I  EPFL++RY+ TDCALM S  G           +F  +F  RY+ EFGF + +R I++DDIRVRG+G +GI   R E          + E     YF++G+  T VYLL+ L  +  ++GPAIIIDKN TI+VEPDC   + E GD+ I+IG+      QR   TE DT+QLSIFSHRFMSIAEQMGR+LQRT+ISTNIKERLDFSCALFGPDGGLV+NAPHIPVHLGAMQ TVQ+Q+R L +    GDV+LSNHP  GGSHLPDLTVITPVF+  +  P+F++A+RGHHADIGG TPGSMPPHSK++ +EGAVF +F +V+   FQE+ V EAL  P   PG SG+RN+ DN+SDLRAQVAAN+KG  LV+ELI+ YGL VVQ+YM +IQ NAE+AVR+ML++      S  G  E+ + D+MD G+ IKLKV I+  EG A+FDFTGSGY+  GN N P A+  S LIYCLRCMVG D+PLNQGCL PI+VIIP+ S L+P+ DAAVVGGNVLTSQRIVDVIFKAF  CAASQGCMNNVTFG+   GYYET+AGG+GAGP WHGRSGIHTHMTNTRITD EILE RYPV+L+RF L  GTGG GKF GGDGV R L FR  ++LS+LTERRVF PYGL+ G SG  GLN+L + D  +  I++GGK S+ + PG
Sbjct:    8 AIDRGGTFTDVFARCPGGKVRVMKLLSEDPANYQDAPTEGIRRILEEETGCSFPRDQPLDTGRIEWIRMGTTVATNALLERKGERIALLITKGFRHLLHIGNQARPKIFDLEIQMPEVLYEEVIEVEERVVLTQGGCCLPKGEPTAPPVGSTGECLEVWEPLNLNRLEMDLRNVLARGIRSLAVVLMHSYTWSSHEHQIGELARSLGFTHVSLSSEVMPMIRIVPRGYTACADAYLTPCIKRYLHGFCRGFKNQLKDLQVLFMRSDGGLTPMQNFSGSRAILSGPAGGVVGYAITTYHRDHPQPVIGFDMGGTSTDVSRYAGEYEHVFEATTAGISIQAPQLDVNTVAAGGGSMLFFRS--GLFVVGPESAGAHPGPACYRKGGPLTVTDANLCLGRLLPDYFPRIFGPSEDQPLSREDTLHQFQKLAADINQFQAGRPGSA-ASLSVEEVAMGFIRVANEAMCRPIRSLTQAKGHDTSRHVLACFGGAGGQHACAIARSLGMKTVFIHKYGGVLSAFGMALADVVHEAQEPCSMGYSPESFSLLEGRIAALERRCIEALQEQGFHRSQIDTEPFLHLRYERTDCALMCSNRGYPAAQDSCLVGNFKLAFTDRYQKEFGFTIPSRAIVVDDIRVRGTGSTGI---RCETAVQPSGQPARVEAVARCYFEDGHHDTNVYLLQDLAPDHSVTGPAIIIDKNSTILVEPDCTASITEYGDVRISIGSG----RQRGVGTELDTIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQETVQFQIRNLKDDLKEGDVLLSNHPCAGGSHLPDLTVITPVFRVEAPRPVFFVASRGHHADIGGITPGSMPPHSKTLRDEGAVFTSFKLVRGGEFQEEAVTEALMAPGLIPGSSGTRNLHDNLSDLRAQVAANQKGIQLVNELIDVYGLAVVQAYMAHIQANAEVAVRNMLRDFAERWESHKGALEVESVDYMDDGSPIKLKVRINKQEGGALFDFTGSGYEVFGNCNAPRAITLSALIYCLRCMVGQDIPLNQGCLTPIQVIIPKGSILDPSPDAAVVGGNVLTSQRIVDVIFKAFEVCAASQGCMNNVTFGNKTTGYYETVAGGAGAGPHWHGRSGIHTHMTNTRITDPEILEKRYPVVLKRFELSPGTGGAGKFHGGDGVIRELLFREDIVLSVLTERRVFRPYGLQGGCSGAPGLNLLRRKDGTT--INLGGKTSVNVEPG 1242          
BLAST of 5-oxoprolinase vs. Ensembl Xenopus
Match: oplah (5-oxoprolinase, ATP-hydrolysing [Source:NCBI gene;Acc:780345])

HSP 1 Score: 1396.72 bits (3614), Expect = 0.000e+0
Identity = 737/1255 (58.73%), Postives = 902/1255 (71.87%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGIISN--GRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSRTDLKGK--YDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQR---TEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTP 3823
            AIDRGGTFTDV+ R    K+  +KLLSEDP NY DAP E IRRI+E+E G     +Q +D   IEWIRMGTTVATNALLERKGE  ALLIT+GFR LL+IGNQ+RP IFDL+I++PE+LY  VIEVEERV+L    C LP     +   G   E + V  PLN +++  DL+ +L  GI+S+AV L HSY +  HE +IG++A  L F  +SLSS++MPMI++VPRG+T  ADAYLTPCIK+Y+  F  GF     +  +LFM+SDGGL+PM  F GSRAILSGPAGGV+GYA TT++ D  QP++GFDMGGTSTDVSRY G  EH++E+ TAGI IQ+PQLD+NTVAAGGGS LFFR   G+F+VGPESAGAHPGP CYRK G LTVTDANL L R+L  YFP+IFGP E+QPL  + +    + +  ++N F     G    S+SVE+VA+GFI VANE+MCRPIRSLTQ KG+DTS+H+LACFGGAGGQHAC+IAR LGM+ VFIH++ G+LSAFG+ALADVV E QEPC + Y+  +F  +  RI  L+  CIE L+ QGF+   I  EPFL++RY+ TDCALM S       +      +F  +F  RY+ EFGF + +R I++DDIRVRG+G +GI   R E          + E     YF++G+  T VYLL+ L  +  ++GPAIIIDKN TI+VEPDC   + E GD+ I+IG+      QR   TE DT+QLSIFSHRFMSIAEQMGR+LQRT+ISTNIKERLDFSCALFGPDGGLV+NAPHIPVHLGAMQ TVQ+Q+R L +    GDV+LSNHP  GGSHLPDLTVITPVF+  +  P+F++A+RGHHADIGG TPGSMPPHSK++ +EGAVF +F +V+   FQE+ V EAL  P   PG SG+RN+ DN+SDLRAQVAAN+KG  LV+ELI+ YGL VVQ+YM +IQ NAE+AVR+ML++      S  G  E+ + D+MD G+ IKLKV I+  E                                             GCL PI+VIIP+ S L+P+ DAAVVGGNVLTSQRIVDVIFKAF  CAASQGCMNNVTFG+   GYYET+AGG+GAGP WHGRSGIHTHMTNTRITD EILE RYPV+L+RF L  GTGG GKF GGDGV R L FR  ++LS+LTERRVF PYGL+ G SG  GLN+L + D  +  I++GGK S+ + PGD   L TP
Sbjct:    8 AIDRGGTFTDVFARCPGGKVRVMKLLSEDPANYQDAPTEGIRRILEEETGCSFPRDQPLDTGRIEWIRMGTTVATNALLERKGERIALLITKGFRHLLHIGNQARPKIFDLEIQMPEVLYEEVIEVEERVVLTQGGCCLPKGEPTAPPVGSTGECLEVWEPLNLNRLEMDLRNVLARGIRSLAVVLMHSYTWSSHEHQIGELARSLGFTHVSLSSEVMPMIRIVPRGYTACADAYLTPCIKRYLHGFCRGFKNQLKDLQVLFMRSDGGLTPMQNFSGSRAILSGPAGGVVGYAITTYHRDHPQPVIGFDMGGTSTDVSRYAGEYEHVFEATTAGISIQAPQLDVNTVAAGGGSMLFFRS--GLFVVGPESAGAHPGPACYRKGGPLTVTDANLCLGRLLPDYFPRIFGPSEDQPLSREDTLHQFQKLAADINQFQAGRPGSA-ASLSVEEVAMGFIRVANEAMCRPIRSLTQAKGHDTSRHVLACFGGAGGQHACAIARSLGMKTVFIHKYGGVLSAFGMALADVVHEAQEPCSMGYSPESFSLLEGRIAALERRCIEALQEQGFHRSQIDTEPFLHLRYERTDCALMCSNRGYPAAQDSCLVGNFKLAFTDRYQKEFGFTIPSRAIVVDDIRVRGTGSTGI---RCETAVQPSGQPARVEAVARCYFEDGHHDTNVYLLQDLAPDHSVTGPAIIIDKNSTILVEPDCTASITEYGDVRISIGSG----RQRGVGTELDTIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQETVQFQIRNLKDDLKEGDVLLSNHPCAGGSHLPDLTVITPVFRVEAPRPVFFVASRGHHADIGGITPGSMPPHSKTLRDEGAVFTSFKLVRGGEFQEEAVTEALMAPGLIPGSSGTRNLHDNLSDLRAQVAANQKGIQLVNELIDVYGLAVVQAYMAHIQANAEVAVRNMLRDFAERWESHKGALEVESVDYMDDGSPIKLKVRINKQE---------------------------------------------GCLTPIQVIIPKGSILDPSPDAAVVGGNVLTSQRIVDVIFKAFEVCAASQGCMNNVTFGNKTTGYYETVAGGAGAGPHWHGRSGIHTHMTNTRITDPEILEKRYPVVLKRFELSPGTGGAGKFHGGDGVIRELLFREDIVLSVLTERRVFRPYGLQGGCSGAPGLNLLRRKDGTT--INLGGKTSVNVEPGDTFTLHTP 1205          
BLAST of 5-oxoprolinase vs. Ensembl Xenopus
Match: oplah (5-oxoprolinase, ATP-hydrolysing [Source:NCBI gene;Acc:780345])

HSP 1 Score: 1362.44 bits (3525), Expect = 0.000e+0
Identity = 727/1251 (58.11%), Postives = 897/1251 (71.70%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGIISN--GRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVS--GNSRTDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQR---TEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQ----GCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPG 3799
            AIDRGGTFTDV+ R    K+  +KLLSEDP NY DAP E IRRI+E+E G     +Q +D   IEWIRMGTTVATNALLERKGE  ALLIT+GFR LL+IGNQ+RP IFDL+I++PE+LY  VIEVEERV+L    C LP     +   G   E + V  PLN +++  DL+ +L  GI+S+AV L HSY +  HE +IG++A  L F  +SLSS++MPMI++VPRG+T  ADAYLTPCIK+Y+  F  GF    +   +LFM+SDGGL+PM  F GSRAILSGPAGGV+GYA TT++ D  QP++GFDMGGTSTDVSRY G  EH++E+ TAGI IQ+PQLD+NTVAAGGGS LFFR   G+F+VGPESAGAHPGP CYRK G LTVTDANL L R+L  YFP+IFGP E+QPL  + +    + +  ++N F     G    S+SVE+VA+GFI VANE+MCRPIRSLTQ KG+DTS+H+LACFGGAGGQHAC+IAR LGM+ VFIH++ G+LSAFG+ALADVV E QEPC + Y+  +F  +  RI  L+  CIE L+ QGF+   I  EPFL++RY+ TDCALM S  G           +F  +F  RY+ EFGF + +R I++DDIRVRG+G +GI        S       +       YF++G+  T VYLL+ L  +  ++GPAIIIDKN TI+VEPDC   + E GD+ I+IG+      QR   TE DT+QLSIFSHRFMSIAEQMGR+LQRT+ISTNIKERLDFSCALFGPDGGLV+NAPHIPVHLGAMQ TVQ+Q+R L +    GDV+LSNHP  GGSHLPDLTVITPVF+  +  P+F++A+RGHHADIGG TPGSMPPHSK++ +EGAVF +F +V+   FQE+ V EAL  P   PG SG+RN+ DN+SDLRAQVAAN+KG  LV+ELI+ YGL VVQ+YM +IQ NAE+AVR+ML++      S  G  E+ + D+MD G+ IKLKV I+  EG A+FDFTGSGY+  GN N P A+  S LIYCLRCMVG D+PLNQGCL PI+VIIP+ S L+P+ DAAVVGGNVLTSQRIVDVIFKAF  CAASQ    G  +  T GD  +             P+WH R           +     L  RYPV+L+RF L  GTGG GKF GGDGV R L FR  ++LS+LTERRVF PYGL+   +G  GLN+L + D  +  I++GGK S+ + PG
Sbjct:    8 AIDRGGTFTDVFARCPGGKVRVMKLLSEDPANYQDAPTEGIRRILEEETGCSFPRDQPLDTGRIEWIRMGTTVATNALLERKGERIALLITKGFRHLLHIGNQARPKIFDLEIQMPEVLYEEVIEVEERVVLTQGGCCLPKGEPTAPPVGSTGECLEVWEPLNLNRLEMDLRNVLARGIRSLAVVLMHSYTWSSHEHQIGELARSLGFTHVSLSSEVMPMIRIVPRGYTACADAYLTPCIKRYLHGFCRGF---KNQLKVLFMRSDGGLTPMQNFSGSRAILSGPAGGVVGYAITTYHRDHPQPVIGFDMGGTSTDVSRYAGEYEHVFEATTAGISIQAPQLDVNTVAAGGGSMLFFRS--GLFVVGPESAGAHPGPACYRKGGPLTVTDANLCLGRLLPDYFPRIFGPSEDQPLSREDTLHQFQKLAADINQFQAGRPGSA-ASLSVEEVAMGFIRVANEAMCRPIRSLTQAKGHDTSRHVLACFGGAGGQHACAIARSLGMKTVFIHKYGGVLSAFGMALADVVHEAQEPCSMGYSPESFSLLEGRIAALERRCIEALQEQGFHRSQIDTEPFLHLRYERTDCALMCSNRGYPAAQDSCLVGNFKLAFTDRYQKEFGFTIPSRAIVVDDIRVRGTGSTGIRCETAVQPSG------QPARVARCYFEDGHHDTNVYLLQDLAPDHSVTGPAIIIDKNSTILVEPDCTASITEYGDVRISIGSG----RQRGVGTELDTIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQETVQFQIRNLKDDLKEGDVLLSNHPCAGGSHLPDLTVITPVFRVEAPRPVFFVASRGHHADIGGITPGSMPPHSKTLRDEGAVFTSFKLVRGGEFQEEAVTEALMAPGLIPGSSGTRNLHDNLSDLRAQVAANQKGIQLVNELIDVYGLAVVQAYMAHIQANAEVAVRNMLRDFAERWESHKGALEVESVDYMDDGSPIKLKVRINKQEGGALFDFTGSGYEVFGNCNAPRAITLSALIYCLRCMVGQDIPLNQGCLTPIQVIIPKGSILDPSPDAAVVGGNVLTSQRIVDVIFKAFEVCAASQVDIRGGPHRATVGDWMMPMMSCSLCQFYWAPTWHRR----------HVEHFPFLYPRYPVVLKRFELSPGTGGAGKFHGGDGVIRELLFREDIVLSVLTERRVFRPYGLQGKGNGAPGLNLLRRKDGTT--INLGGKTSVNVEPG 1230          
BLAST of 5-oxoprolinase vs. Ensembl Xenopus
Match: oplah (5-oxoprolinase, ATP-hydrolysing [Source:NCBI gene;Acc:780345])

HSP 1 Score: 1348.57 bits (3489), Expect = 0.000e+0
Identity = 719/1225 (58.69%), Postives = 880/1225 (71.84%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGIISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVS--GNSRTDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQR---TEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQ----GCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNI 3727
            AIDRGGTFTDV+ R    K+  +KLLSEDP NY DAP E IRRI+E+E G     +Q +D   IEWIRMGTTVATNALLERKGE  ALLIT+GFR LL+IGNQ+RP IFDL+I++PE+LY  VIEVEERV+L    C LP       G   E + V  PLN +++  DL+ +L  GI+S+AV L HSY +  HE +IG++A  L F  +SLSS++MPMI++VPRG+T  ADAYLTPCIK+Y+  F  GF     +  +LFM+SDGGL+PM  F GSRAILSGPAGGV+GYA TT++ D  QP++GFDMGGTSTDVSRY G  EH++E+ TAGI IQ+PQLD+NTVAAGGGS LFFR   G+F+VGPESAGAHPGP CYRK G LTVTDANL L R+L  YFP+IFGP E+QPL  + +    + +  ++N F     G    S+SVE+VA+GFI VANE+MCRPIRSLTQ KG+DTS+H+LACFGGAGGQHAC+IAR LGM+ VFIH++ G+LSAFG+ALADVV E QEPC + Y+  +F  +  RI  L+  CIE L+ QGF+   I  EPFL++RY+ TDCALM S  G           +F  +F  RY+ EFGF + +R I++DDIRVRG+G +GI   R E          + E     YF++G+  T VYLL+ L  +  ++GPAIIIDKN TI+VEPDC   + E GD+ I+IG+      QR   TE DT+QLSIFSHRFMSIAEQMGR+LQRT+ISTNIKERLDFSCALFGPDGGLV+NAPHIPVHLGAMQ TVQ+Q+R L +    GDV+LSNHP  GGSHLPDLTVITPV    +  P+F++A+RGHHADIGG TPGSMPPHSK++ +EGAVF +F +V+   FQE+ V EAL  P   PG SG+RN+ DN+SDLRAQVAAN+KG  LV+ELI+ YGL VVQ+YM +IQ NAE+AVR+ML++      S  G  E+ + D+MD G+ IKLKV I+  EG A+FDFTGSGY+  GN N P A+  S LIYCLRCMVG D+PLNQGCL PI+VIIP+ S L+P+ DAAVVGGNVLTSQRIVDVIFKAF  CAASQ    G  +  T GD  +             P+WH R   H             L  RYPV+L+RF L  GTGG GKF GGDGV R L FR  ++LS+LTERRVF PYGL+    G+  LN+
Sbjct:   10 AIDRGGTFTDVFARCPGGKVRVMKLLSEDPANYQDAPTEGIRRILEEETGCSFPRDQPLDTGRIEWIRMGTTVATNALLERKGERIALLITKGFRHLLHIGNQARPKIFDLEIQMPEVLYEEVIEVEERVVLTQGGCCLP------KGSTGECLEVWEPLNLNRLEMDLRNVLARGIRSLAVVLMHSYTWSSHEHQIGELARSLGFTHVSLSSEVMPMIRIVPRGYTACADAYLTPCIKRYLHGFCRGFKNQLKDLQVLFMRSDGGLTPMQNFSGSRAILSGPAGGVVGYAITTYHRDHPQPVIGFDMGGTSTDVSRYAGEYEHVFEATTAGISIQAPQLDVNTVAAGGGSMLFFRS--GLFVVGPESAGAHPGPACYRKGGPLTVTDANLCLGRLLPDYFPRIFGPSEDQPLSREDTLHQFQKLAADINQFQAGRPGSA-ASLSVEEVAMGFIRVANEAMCRPIRSLTQAKGHDTSRHVLACFGGAGGQHACAIARSLGMKTVFIHKYGGVLSAFGMALADVVHEAQEPCSMGYSPESFSLLEGRIAALERRCIEALQEQGFHRSQIDTEPFLHLRYERTDCALMCSNRGYPAAQDSCLVGNFKLAFTDRYQKEFGFTIPSRAIVVDDIRVRGTGSTGI---RCETAVQPSGQPARVEAVARCYFEDGHHDTNVYLLQDLAPDHSVTGPAIIIDKNSTILVEPDCTASITEYGDVRISIGSG----RQRGVGTELDTIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQETVQFQIRNLKDDLKEGDVLLSNHPCAGGSHLPDLTVITPV---SAPRPVFFVASRGHHADIGGITPGSMPPHSKTLRDEGAVFTSFKLVRGGEFQEEAVTEALMAPGLIPGSSGTRNLHDNLSDLRAQVAANQKGIQLVNELIDVYGLAVVQAYMAHIQANAEVAVRNMLRDFAERWESHKGALEVESVDYMDDGSPIKLKVRINKQEGGALFDFTGSGYEVFGNCNAPRAITLSALIYCLRCMVGQDIPLNQGCLTPIQVIIPKGSILDPSPDAAVVGGNVLTSQRIVDVIFKAFEVCAASQVDIRGGPHRATVGDWMMPMMSCSLCQFYWAPTWHRRHSEH----------FPFLYPRYPVVLKRFELSPGTGGAGKFHGGDGVIRELLFREDIVLSVLTERRVFRPYGLQ----GKGKLNV 1201          
BLAST of 5-oxoprolinase vs. Ensembl Mouse
Match: Oplah (5-oxoprolinase (ATP-hydrolysing) [Source:MGI Symbol;Acc:MGI:1922725])

HSP 1 Score: 1436.78 bits (3718), Expect = 0.000e+0
Identity = 754/1290 (58.45%), Postives = 949/1290 (73.57%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLN--PKCQLPVQGIISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSR--TDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKDSTTELDSKAQCNRKISTMKGSVHNYHLQQ 3937
            AIDRGGTFTDV+ +     +  LKLLSEDP NY DAP E IRRI+E+E GV     + +D  +I  IRMGTTVATNALLER+GE  ALL+T GFRDLL+IG Q+RP++FDL + +PE+LY  V+EV+ERV+L    P    PV+G   +      + ++ P++ + +R  L+ LL  GI S+AV L HSY +  HE+++G +A EL F  +SLSS++MPM+++VPRG T  ADAYLTP I++Y+  F+ GF G   N  +LFM+SDGGL+PM  F GSRA+LSGPAGGV+GY+ TT+  +  QP++GFDMGGTSTDVSRY G  EH++E+ TAG+ +Q+PQLDINTVAAGGGSRLFFR   G+F+VGPESAGAHPGP CYRK G +TVTDANLVL R+L   FP IFGP E+QPL  +AS KA++ +  EVN F  S        +S+E+VA+GF+ VANE+MCRPIR+LTQ +G+D S H+LACFGGAGGQHAC+IAR LGM  V IHR SG+LSA GLALADVV E QEPC L Y    F ++ +R+  L+E C++ L++QGF+   I  E FL++RY+GTDCALMVS N    T    +   F  +F+ RY  EFGFI+  R +++DD+RVRG+G SG+ +   E  S + S     E+    YF+ GY  T VYLL +L     + GP +IID N TI+VEP C   V E GD+ I++G  +  S   T+ D +QLSIFSHRFMSIAEQMGR+LQRT+ISTNIKERLDFSCALFGPDGGLV+NAPHIPVHLGAMQ TVQ+Q+++L     PGDV+LSNHP  GGSHLPDLTVITPVF  G   P+FY+A+RGHHADIGG TPGSMPPHS ++ +EGAVF +F +V+  +FQE+ V EALQ P +  GCSG+RN+ DN+SDLRAQVAAN+KG  LV ELI +YGL+VVQ+YMG+IQ NAELAVR ML+  G S  ++    E+SA+D MD G+ I L V I+ ++GSA+FDF+GSG +  GNLN P A+  S LIYCLRC+VG D+PLNQGCL P++VIIP+ S L+P+ +AAVVGGNVLTSQR+VDVI  AFGACAASQGCMNNVT G+  +GYYET+AGG+GAGP WHGRSG+H+HMTNTRITD EILESRYPVIL RF L+ G+GG G+F GGDGV R L FR + +LS+LTERR F PYGL  GE G +GLN+LI+ D   R +++GGK S+ + PGD   L TPGGGG+G+ +                  +GSV+ Y   Q
Sbjct:   11 AIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGIRRILEQERGVLLPRGRPLDTSHIASIRMGTTVATNALLERQGERVALLVTRGFRDLLHIGTQARPDLFDLAVPMPEVLYEEVVEVDERVLLYRGEPGAGSPVKGCTGD-----LLEIQQPVDLAALRGKLEGLLTRGIHSLAVVLMHSYTWAQHEQQVGTLARELGFTHVSLSSEVMPMVRIVPRGHTACADAYLTPTIQRYVQGFRRGFQGQLKNVQVLFMRSDGGLAPMDAFSGSRAVLSGPAGGVVGYSTTTYQLEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDINTVAAGGGSRLFFRS--GLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFGPGEDQPLSPEASRKALEAVAMEVNSFLASGPCPA-SQLSLEEVAMGFVRVANEAMCRPIRALTQARGHDPSAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLLSALGLALADVVHEAQEPCSLSYTPETFAQLDQRLSRLEEQCVDALQAQGFSRSQISTESFLHLRYQGTDCALMVSANQHPATTCSPRAGDFGAAFVERYMREFGFIIPERSVVVDDVRVRGTGRSGLQL---EETSKIQSGPPHVEKVTQCYFEGGYQETPVYLLGELGYGHQLQGPCLIIDNNSTILVEPGCQAEVIETGDIRISVGAEAP-SMIDTKLDPIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQETVQFQIQHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFWPGQSRPVFYVASRGHHADIGGITPGSMPPHSTTLQQEGAVFLSFKLVQGGVFQEEAVTEALQAPGKISGCSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQANAELAVRDMLRAFGTSRQARGLPLEVSAKDHMDDGSPICLHVQINLNQGSAVFDFSGSGSEVFGNLNAPRAITLSALIYCLRCLVGRDIPLNQGCLAPVQVIIPKGSILDPSPEAAVVGGNVLTSQRVVDVILGAFGACAASQGCMNNVTLGNARMGYYETVAGGAGAGPGWHGRSGVHSHMTNTRITDPEILESRYPVILRRFELRPGSGGRGRFRGGDGVVRELVFREEALLSVLTERRAFQPYGLHGGEPGTRGLNLLIRKD--GRTVNLGGKTSVTVYPGDAFCLHTPGGGGYGDPEDPAPPPGSPPLYPAFPE-RGSVYEYRRAQ 1285          
BLAST of 5-oxoprolinase vs. Ensembl Mouse
Match: Oplah (5-oxoprolinase (ATP-hydrolysing) [Source:MGI Symbol;Acc:MGI:1922725])

HSP 1 Score: 1436.78 bits (3718), Expect = 0.000e+0
Identity = 754/1290 (58.45%), Postives = 949/1290 (73.57%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLN--PKCQLPVQGIISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSR--TDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKDSTTELDSKAQCNRKISTMKGSVHNYHLQQ 3937
            AIDRGGTFTDV+ +     +  LKLLSEDP NY DAP E IRRI+E+E GV     + +D  +I  IRMGTTVATNALLER+GE  ALL+T GFRDLL+IG Q+RP++FDL + +PE+LY  V+EV+ERV+L    P    PV+G   +      + ++ P++ + +R  L+ LL  GI S+AV L HSY +  HE+++G +A EL F  +SLSS++MPM+++VPRG T  ADAYLTP I++Y+  F+ GF G   N  +LFM+SDGGL+PM  F GSRA+LSGPAGGV+GY+ TT+  +  QP++GFDMGGTSTDVSRY G  EH++E+ TAG+ +Q+PQLDINTVAAGGGSRLFFR   G+F+VGPESAGAHPGP CYRK G +TVTDANLVL R+L   FP IFGP E+QPL  +AS KA++ +  EVN F  S        +S+E+VA+GF+ VANE+MCRPIR+LTQ +G+D S H+LACFGGAGGQHAC+IAR LGM  V IHR SG+LSA GLALADVV E QEPC L Y    F ++ +R+  L+E C++ L++QGF+   I  E FL++RY+GTDCALMVS N    T    +   F  +F+ RY  EFGFI+  R +++DD+RVRG+G SG+ +   E  S + S     E+    YF+ GY  T VYLL +L     + GP +IID N TI+VEP C   V E GD+ I++G  +  S   T+ D +QLSIFSHRFMSIAEQMGR+LQRT+ISTNIKERLDFSCALFGPDGGLV+NAPHIPVHLGAMQ TVQ+Q+++L     PGDV+LSNHP  GGSHLPDLTVITPVF  G   P+FY+A+RGHHADIGG TPGSMPPHS ++ +EGAVF +F +V+  +FQE+ V EALQ P +  GCSG+RN+ DN+SDLRAQVAAN+KG  LV ELI +YGL+VVQ+YMG+IQ NAELAVR ML+  G S  ++    E+SA+D MD G+ I L V I+ ++GSA+FDF+GSG +  GNLN P A+  S LIYCLRC+VG D+PLNQGCL P++VIIP+ S L+P+ +AAVVGGNVLTSQR+VDVI  AFGACAASQGCMNNVT G+  +GYYET+AGG+GAGP WHGRSG+H+HMTNTRITD EILESRYPVIL RF L+ G+GG G+F GGDGV R L FR + +LS+LTERR F PYGL  GE G +GLN+LI+ D   R +++GGK S+ + PGD   L TPGGGG+G+ +                  +GSV+ Y   Q
Sbjct:   11 AIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGIRRILEQERGVLLPRGRPLDTSHIASIRMGTTVATNALLERQGERVALLVTRGFRDLLHIGTQARPDLFDLAVPMPEVLYEEVVEVDERVLLYRGEPGAGSPVKGCTGD-----LLEIQQPVDLAALRGKLEGLLTRGIHSLAVVLMHSYTWAQHEQQVGTLARELGFTHVSLSSEVMPMVRIVPRGHTACADAYLTPTIQRYVQGFRRGFQGQLKNVQVLFMRSDGGLAPMDAFSGSRAVLSGPAGGVVGYSTTTYQLEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDINTVAAGGGSRLFFRS--GLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFGPGEDQPLSPEASRKALEAVAMEVNSFLASGPCPA-SQLSLEEVAMGFVRVANEAMCRPIRALTQARGHDPSAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLLSALGLALADVVHEAQEPCSLSYTPETFAQLDQRLSRLEEQCVDALQAQGFSRSQISTESFLHLRYQGTDCALMVSANQHPATTCSPRAGDFGAAFVERYMREFGFIIPERSVVVDDVRVRGTGRSGLQL---EETSKIQSGPPHVEKVTQCYFEGGYQETPVYLLGELGYGHQLQGPCLIIDNNSTILVEPGCQAEVIETGDIRISVGAEAP-SMIDTKLDPIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQETVQFQIQHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFWPGQSRPVFYVASRGHHADIGGITPGSMPPHSTTLQQEGAVFLSFKLVQGGVFQEEAVTEALQAPGKISGCSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQANAELAVRDMLRAFGTSRQARGLPLEVSAKDHMDDGSPICLHVQINLNQGSAVFDFSGSGSEVFGNLNAPRAITLSALIYCLRCLVGRDIPLNQGCLAPVQVIIPKGSILDPSPEAAVVGGNVLTSQRVVDVILGAFGACAASQGCMNNVTLGNARMGYYETVAGGAGAGPGWHGRSGVHSHMTNTRITDPEILESRYPVILRRFELRPGSGGRGRFRGGDGVVRELVFREEALLSVLTERRAFQPYGLHGGEPGTRGLNLLIRKD--GRTVNLGGKTSVTVYPGDAFCLHTPGGGGYGDPEDPAPPPGSPPLYPAFPE-RGSVYEYRRAQ 1285          
BLAST of 5-oxoprolinase vs. Ensembl Mouse
Match: Oplah (5-oxoprolinase (ATP-hydrolysing) [Source:MGI Symbol;Acc:MGI:1922725])

HSP 1 Score: 933.324 bits (2411), Expect = 0.000e+0
Identity = 489/854 (57.26%), Postives = 620/854 (72.60%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLN--PKCQLPVQGIISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSR--TDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLAN 2629
            AIDRGGTFTDV+ +     +  LKLLSEDP NY DAP E IRRI+E+E GV     + +D  +I  IRMGTTVATNALLER+GE  ALL+T GFRDLL+IG Q+RP++FDL + +PE+LY  V+EV+ERV+L    P    PV+G   +      + ++ P++ + +R  L+ LL  GI S+AV L HSY +  HE+++G +A EL F  +SLSS++MPM+++VPRG T  ADAYLTP I++Y+  F+ GF G   N  +LFM+SDGGL+PM  F GSRA+LSGPAGGV+GY+ TT+  +  QP++GFDMGGTSTDVSRY G  EH++E+ TAG+ +Q+PQLDINTVAAGGGSRLFFR   G+F+VGPESAGAHPGP CYRK G +TVTDANLVL R+L   FP IFGP E+QPL  +AS KA++ +  EVN F  S        +S+E+VA+GF+ VANE+MCRPIR+LTQ +G+D S H+LACFGGAGGQHAC+IAR LGM  V IHR SG+LSA GLALADVV E QEPC L Y    F ++ +R+  L+E C++ L++QGF+   I  E FL++RY+GTDCALMVS N    T    +   F  +F+ RY  EFGFI+  R +++DD+RVRG+G SG+ +   E  S + S     E+    YF+ GY  T VYLL +L     + GP +IID N TI+VEP C   V E GD+ I++G  +  S   T+ D +QLSIFSHRFMSIAEQMGR+LQRT+ISTNIKERLDFSCALFGPDGGLV+NAPHIPVHLGAMQ TVQ+Q+++L     PGDV+LSNHP  GGSHLPDLTVITPVF  G   P+FY+A+
Sbjct:   11 AIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGIRRILEQERGVLLPRGRPLDTSHIASIRMGTTVATNALLERQGERVALLVTRGFRDLLHIGTQARPDLFDLAVPMPEVLYEEVVEVDERVLLYRGEPGAGSPVKGCTGD-----LLEIQQPVDLAALRGKLEGLLTRGIHSLAVVLMHSYTWAQHEQQVGTLARELGFTHVSLSSEVMPMVRIVPRGHTACADAYLTPTIQRYVQGFRRGFQGQLKNVQVLFMRSDGGLAPMDAFSGSRAVLSGPAGGVVGYSTTTYQLEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDINTVAAGGGSRLFFRS--GLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFGPGEDQPLSPEASRKALEAVAMEVNSFLASGPCPA-SQLSLEEVAMGFVRVANEAMCRPIRALTQARGHDPSAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLLSALGLALADVVHEAQEPCSLSYTPETFAQLDQRLSRLEEQCVDALQAQGFSRSQISTESFLHLRYQGTDCALMVSANQHPATTCSPRAGDFGAAFVERYMREFGFIIPERSVVVDDVRVRGTGRSGLQL---EETSKIQSGPPHVEKVTQCYFEGGYQETPVYLLGELGYGHQLQGPCLIIDNNSTILVEPGCQAEVIETGDIRISVGAEAP-SMIDTKLDPIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQETVQFQIQHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFWPGQSRPVFYVAS 852          
BLAST of 5-oxoprolinase vs. Ensembl Mouse
Match: Oplah (5-oxoprolinase (ATP-hydrolysing) [Source:MGI Symbol;Acc:MGI:1922725])

HSP 1 Score: 147.132 bits (370), Expect = 6.091e-39
Identity = 71/116 (61.21%), Postives = 87/116 (75.00%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVP 427
            AIDRGGTFTDV+ +     +  LKLLSEDP NY DAP E IRRI+E+E GV     + +D  +I  IRMGTTVATNALLER+GE  ALL+T GFRDLL+IG Q+RP++FDL + +P
Sbjct:  107 AIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGIRRILEQERGVLLPRGRPLDTSHIASIRMGTTVATNALLERQGERVALLVTRGFRDLLHIGTQARPDLFDLAVPMP 222          
BLAST of 5-oxoprolinase vs. Ensembl Mouse
Match: Oplah (5-oxoprolinase (ATP-hydrolysing) [Source:MGI Symbol;Acc:MGI:1922725])

HSP 1 Score: 60.4622 bits (145), Expect = 4.047e-11
Identity = 28/43 (65.12%), Postives = 31/43 (72.09%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRR 208
            AIDRGGTFTDV+ +     +  LKLLSEDP NY DAP E IRR
Sbjct:   11 AIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGIRR 53          
BLAST of 5-oxoprolinase vs. UniProt/SwissProt
Match: sp|O14841|OPLA_HUMAN (5-oxoprolinase OS=Homo sapiens OX=9606 GN=OPLAH PE=1 SV=3)

HSP 1 Score: 1465.67 bits (3793), Expect = 0.000e+0
Identity = 742/1259 (58.94%), Postives = 937/1259 (74.42%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGIISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSR--TDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKD 3850
            AIDRGGTFTDV+ +     +  LKLLSEDP NY DAP E IRRI+E+E G+    +Q +D  +I  IRMGTTVATNALLERKGE  ALL+T GFRDLL+IG Q+R ++FDL + +PE+LY  V+EV+ERV+L   +      G    GR  + + V+ P++   +R  L+ LL  GI+S+AV L HSY +  HE+++G +A EL F  +SLSS+ MPM+++VPRG T  ADAYLTP I++Y+  F  GF G   +  +LFM+SDGGL+PM  F GS A+LSGPAGGV+GY+ TT+  +  QP++GFDMGGTSTDVSRY G  EH++E+ TAG+ +Q+PQLDINTVAAGGGSRLFFR   G+F+VGPESAGAHPGP CYRK G +TVTDANLVL R+L   FP IFGP ENQPL  +AS KA++ +  EVN F  +        +S+E+VA+GF+ VANE+MCRPIR+LTQ +G+D S H+LACFGGAGGQHAC+IAR LGM  V IHR SG+LSA GLALADVV E QEPC LLY    F+++ +R+  L+E C++ L++QGF    I  E FL++RY+GTDCALMVS +    T    +   F  +F+ RY  EFGF++  R +++DD+RVRG+G SG+   R E      +   + ++    YF+ GY  T VYLL +L     + GP +IID N TI+VEP C   V + GD+ I++G +        + D +QLSIFSHRFMSIAEQMGR+LQRT+ISTNIKERLDFSCALFGPDGGLV+NAPHIPVHLGAMQ TVQ+Q+++L     PGDV+LSNHP  GGSHLPDLTVITPVF  G   P+FY+A+RGHHADIGG TPGSMPPHS  + +EGAVF +F +V+  +FQE+ V EAL+ P + P CSG+RN+ DN+SDLRAQVAAN+KG  LV ELI +YGL+VVQ+YMG+IQ NAELAVR ML+  G S  ++    E+S+ED MD G+ I+L+V I   +GSA+FDF+G+G +  GNLN P AV  S LIYCLRC+VG D+PLNQGCL P++V+IP  S L+P+ +AAVVGGNVLTSQR+VDVI  AFGACAASQGCMNNVT G+  +GYYET+AGG+GAGPSWHGRSG+H+HMTNTRITD EILESRYPVIL RF L+RG+GG G+F GGDGV R L FR + +LS+LTERR F PYGL  GE G +GLN+LI+  K  R +++GGK S+ + PGDV  L TPGGGG+G+ +
Sbjct:   11 AIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGIRRILEQEAGMLLPRDQPLDSSHIASIRMGTTVATNALLERKGERVALLVTRGFRDLLHIGTQARGDLFDLAVPMPEVLYEEVLEVDERVVLHRGEAG---TGTPVKGRTGDLLEVQQPVDLGALRGKLEGLLSRGIRSLAVVLMHSYTWAQHEQQVGVLARELGFTHVSLSSEAMPMVRIVPRGHTACADAYLTPAIQRYVQGFCRGFQGQLKDVQVLFMRSDGGLAPMDTFSGSSAVLSGPAGGVVGYSATTYQQEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDINTVAAGGGSRLFFRS--GLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFGPGENQPLSPEASRKALEAVATEVNSFLTNGPCPA-SPLSLEEVAMGFVRVANEAMCRPIRALTQARGHDPSAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLLSALGLALADVVHEAQEPCSLLYAPETFVQLDQRLSRLEEQCVDALQAQGFPRSQISTESFLHLRYQGTDCALMVSAHQHPATARSPRAGDFGAAFVERYMREFGFVIPERPVVVDDVRVRGTGRSGL---RLEDAPKAQTGPPRVDKMTQCYFEGGYQETPVYLLAELGYGHKLHGPCLIIDSNSTILVEPGCQAEVTKTGDICISVG-AEVPGTVGPQLDPIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQETVQFQIQHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFWPGQTRPVFYVASRGHHADIGGITPGSMPPHSTMLQQEGAVFLSFKLVQGGVFQEEAVTEALRAPGKVPNCSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQANAELAVRDMLRAFGTSRQARGLPLEVSSEDHMDDGSPIRLRVQISLSQGSAVFDFSGTGPEVFGNLNAPRAVTLSALIYCLRCLVGRDIPLNQGCLAPVRVVIPRGSILDPSPEAAVVGGNVLTSQRVVDVILGAFGACAASQGCMNNVTLGNAHMGYYETVAGGAGAGPSWHGRSGVHSHMTNTRITDPEILESRYPVILRRFELRRGSGGRGRFRGGDGVTRELLFREEALLSVLTERRAFRPYGLHGGEPGARGLNLLIR--KNGRTVNLGGKTSVTVYPGDVFCLHTPGGGGYGDPE 1257          
BLAST of 5-oxoprolinase vs. UniProt/SwissProt
Match: sp|P97608|OPLA_RAT (5-oxoprolinase OS=Rattus norvegicus OX=10116 GN=Oplah PE=1 SV=2)

HSP 1 Score: 1451.8 bits (3757), Expect = 0.000e+0
Identity = 745/1259 (59.17%), Postives = 938/1259 (74.50%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGIISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSR--TDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKD 3850
            AIDRGGTFTDV+ +     +  LKLLSEDP NY DAP E IRRI+E+E GV     + +D   I  IRMGTTVATNALLER+GE  ALL+T GFRDLL+IG Q+RP++FDL + +PE+LY  V+EV+ERV+L   +   P  G    GR  + + ++ P++   +R  L+ LL  GI S+AV L HSY +  HE+++G +A EL F  +SLSS++MPM+++VPRG T  ADAYLTP I++Y+  F+ GF G   N  +LFM+SDGGL+PM  F GSRA+LSGPAGGV+GY+ TT++ +  QP++GFDMGGTSTDVSRY G  EH++E+ TAG+ +Q+PQLDINTVAAGGGSRLFFR   G+F+VGPESAGAHPGP CYRK G +TVTDANLVL R+L   FP IFGP E+QPL  +AS KA++ +  EVN F  +        +S+E+VA+GF+ VANE+MCRPIR+LTQ +G+D S H+LACFGGAGGQHAC+IAR LGM  V IHR SG+LSA GLALADVV E QEPC L Y    F ++ +R+  L+E C++ L+ QGF    I  E FL++RY+GTDCALMVS +    T    +   F  +F+ RY  EFGFI+  R +++DD+RVRG+G SG+ +   E    + +     E+    YF+ GY  T VYLL +L     + GP +IID N TI+VEP C   V + GD+ I++G +   S   T  D +QLSIFSHRFMSIAEQMGR+LQRT+ISTNIKERLDFSCALFGPDGGLV+NAPHIPVHLGAMQ TVQ+Q+++L     PGDV+LSNHP  GGSHLPDLTVITPVF  G   P+FY+A+RGHHADIGG TPGSMPPHS ++ +EGAVF +F +V+  +FQE+ V EAL+ P +  GCSG+RN+ DN+SDLRAQVAAN+KG  LV ELI +YGL+VVQ+YMG+IQ NAELAVR ML+  G S  ++    E+SAED MD G+ I L+V I+  +GSA+FDFTGSG +  GNLN P A+  S LIYCLRC+VG D+PLNQGCL P++VIIP+ S L+P+ +AAVVGGNVLTSQR+VDVI  AFGAC+ASQGCMNNVT G+  +GYYET+AGG+GAGP WHGRSG+H+HMTNTRITD EILESRYPVIL RF L+ G+GG G+F GGDGV R L FR + +LS+LTERR F PYGL  GE G +GLN+LI+ D   R +++GGK S+ + PGDV  L TPGGGG+G+ +
Sbjct:   11 AIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGIRRILEQEEGVLLPRGRPLDTSRIASIRMGTTVATNALLERQGERVALLVTRGFRDLLHIGTQARPDLFDLAVPMPEVLYEEVLEVDERVVLYRGE---PGAGSPVKGRTGDLLEIQQPVDLEALRGKLEGLLSRGIHSLAVVLMHSYTWAQHEQQVGTLARELGFTHVSLSSEVMPMVRIVPRGHTACADAYLTPTIQRYVQGFRRGFQGQLKNVQVLFMRSDGGLAPMDAFSGSRAVLSGPAGGVVGYSATTYHLEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDINTVAAGGGSRLFFRS--GLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFGPGEDQPLSPEASRKALEAVAMEVNSFLTNGPCPA-SQLSLEEVAMGFVRVANEAMCRPIRALTQARGHDPSAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLLSALGLALADVVHEAQEPCSLSYTPETFAQLDQRLSRLEEQCVDALQVQGFPRSQISTESFLHLRYQGTDCALMVSAHQHPATACSPRAGDFGAAFVERYMREFGFIIPERPVVVDDVRVRGTGRSGLQL---EDTPKIQTGPPHVEKVTQCYFEGGYQETPVYLLGELGYGHQLQGPCLIIDNNSTILVEPGCQAEVTDTGDIRISVG-AEGPSMADTRLDPIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQETVQFQIQHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFWPGQTRPVFYVASRGHHADIGGITPGSMPPHSTTLQQEGAVFLSFKLVQGGVFQEEAVTEALRAPGKISGCSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQANAELAVRDMLRAFGTSRQARGLPLEVSAEDHMDDGSPICLRVQINLSQGSAVFDFTGSGSEVFGNLNAPRAITLSALIYCLRCLVGRDIPLNQGCLAPVRVIIPKGSILDPSPEAAVVGGNVLTSQRVVDVILGAFGACSASQGCMNNVTLGNARMGYYETVAGGAGAGPGWHGRSGVHSHMTNTRITDPEILESRYPVILRRFELRPGSGGRGRFRGGDGVVRELVFREEALLSVLTERRAFQPYGLHGGEPGARGLNLLIRKD--GRTVNLGGKTSVTVYPGDVFCLHTPGGGGYGDPE 1257          
BLAST of 5-oxoprolinase vs. UniProt/SwissProt
Match: sp|Q8K010|OPLA_MOUSE (5-oxoprolinase OS=Mus musculus OX=10090 GN=Oplah PE=1 SV=1)

HSP 1 Score: 1436.78 bits (3718), Expect = 0.000e+0
Identity = 754/1290 (58.45%), Postives = 949/1290 (73.57%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLN--PKCQLPVQGIISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSR--TDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKDSTTELDSKAQCNRKISTMKGSVHNYHLQQ 3937
            AIDRGGTFTDV+ +     +  LKLLSEDP NY DAP E IRRI+E+E GV     + +D  +I  IRMGTTVATNALLER+GE  ALL+T GFRDLL+IG Q+RP++FDL + +PE+LY  V+EV+ERV+L    P    PV+G   +      + ++ P++ + +R  L+ LL  GI S+AV L HSY +  HE+++G +A EL F  +SLSS++MPM+++VPRG T  ADAYLTP I++Y+  F+ GF G   N  +LFM+SDGGL+PM  F GSRA+LSGPAGGV+GY+ TT+  +  QP++GFDMGGTSTDVSRY G  EH++E+ TAG+ +Q+PQLDINTVAAGGGSRLFFR   G+F+VGPESAGAHPGP CYRK G +TVTDANLVL R+L   FP IFGP E+QPL  +AS KA++ +  EVN F  S        +S+E+VA+GF+ VANE+MCRPIR+LTQ +G+D S H+LACFGGAGGQHAC+IAR LGM  V IHR SG+LSA GLALADVV E QEPC L Y    F ++ +R+  L+E C++ L++QGF+   I  E FL++RY+GTDCALMVS N    T    +   F  +F+ RY  EFGFI+  R +++DD+RVRG+G SG+ +   E  S + S     E+    YF+ GY  T VYLL +L     + GP +IID N TI+VEP C   V E GD+ I++G  +  S   T+ D +QLSIFSHRFMSIAEQMGR+LQRT+ISTNIKERLDFSCALFGPDGGLV+NAPHIPVHLGAMQ TVQ+Q+++L     PGDV+LSNHP  GGSHLPDLTVITPVF  G   P+FY+A+RGHHADIGG TPGSMPPHS ++ +EGAVF +F +V+  +FQE+ V EALQ P +  GCSG+RN+ DN+SDLRAQVAAN+KG  LV ELI +YGL+VVQ+YMG+IQ NAELAVR ML+  G S  ++    E+SA+D MD G+ I L V I+ ++GSA+FDF+GSG +  GNLN P A+  S LIYCLRC+VG D+PLNQGCL P++VIIP+ S L+P+ +AAVVGGNVLTSQR+VDVI  AFGACAASQGCMNNVT G+  +GYYET+AGG+GAGP WHGRSG+H+HMTNTRITD EILESRYPVIL RF L+ G+GG G+F GGDGV R L FR + +LS+LTERR F PYGL  GE G +GLN+LI+ D   R +++GGK S+ + PGD   L TPGGGG+G+ +                  +GSV+ Y   Q
Sbjct:   11 AIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGIRRILEQERGVLLPRGRPLDTSHIASIRMGTTVATNALLERQGERVALLVTRGFRDLLHIGTQARPDLFDLAVPMPEVLYEEVVEVDERVLLYRGEPGAGSPVKGCTGD-----LLEIQQPVDLAALRGKLEGLLTRGIHSLAVVLMHSYTWAQHEQQVGTLARELGFTHVSLSSEVMPMVRIVPRGHTACADAYLTPTIQRYVQGFRRGFQGQLKNVQVLFMRSDGGLAPMDAFSGSRAVLSGPAGGVVGYSTTTYQLEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDINTVAAGGGSRLFFRS--GLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFGPGEDQPLSPEASRKALEAVAMEVNSFLASGPCPA-SQLSLEEVAMGFVRVANEAMCRPIRALTQARGHDPSAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLLSALGLALADVVHEAQEPCSLSYTPETFAQLDQRLSRLEEQCVDALQAQGFSRSQISTESFLHLRYQGTDCALMVSANQHPATTCSPRAGDFGAAFVERYMREFGFIIPERSVVVDDVRVRGTGRSGLQL---EETSKIQSGPPHVEKVTQCYFEGGYQETPVYLLGELGYGHQLQGPCLIIDNNSTILVEPGCQAEVIETGDIRISVGAEAP-SMIDTKLDPIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQETVQFQIQHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFWPGQSRPVFYVASRGHHADIGGITPGSMPPHSTTLQQEGAVFLSFKLVQGGVFQEEAVTEALQAPGKISGCSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQANAELAVRDMLRAFGTSRQARGLPLEVSAKDHMDDGSPICLHVQINLNQGSAVFDFSGSGSEVFGNLNAPRAITLSALIYCLRCLVGRDIPLNQGCLAPVQVIIPKGSILDPSPEAAVVGGNVLTSQRVVDVILGAFGACAASQGCMNNVTLGNARMGYYETVAGGAGAGPGWHGRSGVHSHMTNTRITDPEILESRYPVILRRFELRPGSGGRGRFRGGDGVVRELVFREEALLSVLTERRAFQPYGLHGGEPGTRGLNLLIRKD--GRTVNLGGKTSVTVYPGDAFCLHTPGGGGYGDPEDPAPPPGSPPLYPAFPE-RGSVYEYRRAQ 1285          
BLAST of 5-oxoprolinase vs. UniProt/SwissProt
Match: sp|Q75WB5|OPLA_BOVIN (5-oxoprolinase OS=Bos taurus OX=9913 GN=OPLAH PE=1 SV=1)

HSP 1 Score: 1419.45 bits (3673), Expect = 0.000e+0
Identity = 733/1251 (58.59%), Postives = 924/1251 (73.86%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLN--PKCQLPVQGIISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSR--TDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQT 3820
            AIDRGGTFTDV+ +     +  LKLLSEDP NY DAP E IRRI+E+E GV    ++ +D   I  IRMGTTVATNALLE++GE  ALL+T GFRDLL++  Q+R  +FDL + +PE LY  V+EV+ERV+L    P    PV+G   +      + V+ P++   +R  L+ LL  GI+S+AV L HSY +  HE+++G +A EL F  +SLSS+ MPM+++VPRG T  ADAYLTP I++Y+  F+ GF G   +  +LFM+SDGGL+PM  F GSRA+LSGPAGGV+GY+ TT+  +  QP++GFDMGGTSTDVSRY G  EH++E+ TAG+ +Q+PQLDINTVAAGGGSRLFFR   G+F+VGPESAGAHPGP CYRK G +TVTDANLVL R+L   FP IFGP E+QPL  +AS KA++ +  EVN F  +        +S+E+VA+GF+ VANE+MCRPIR+LTQ +G+D S H+LACFGGAGGQHAC+IAR LGM  V IHR SG+LSA GLALADVV E QEPC L Y    F ++ +R+  L+E C+E L +QGF    I  E FL++RY+GTDCALMVS +    +    +   F  +F+ RY  EFGFI+  R +++DD+RVRG+G S +   R E +    S   + ++    YF+ GY  T VYLL +L     + GP +IID N TI+VEP C   V E GD+ I++G +   S   T+ D + L+IFSHRFMSIAEQMGR+LQRT+ISTNIKERLDFSCALFGPDGGLV+N PHIPVHLGAMQ TVQ+Q++ L     PGDV+LSNHP  GGSHLPDLTVITPVF  G   P+FY+A+RGHHADIGG TPGSMPPHS S+ +EGAVF +F +V   +FQE+ V EAL+ P + PGCSG+RN+ DN+SDLRAQVAAN+KG  LV ELI +YGL+VVQ+YMG+IQ NAELAVR ML+  G +  ++    E+SAED MD G+ I+L+V I+  +GSA+FDF+GSG +  GNLN P A+  S LIYCLRC+VG D+PLNQGCL P++V+IP+ S L+P+ DAAVVGGNVLTSQR+VDVI  AFGACAASQGCMNNVT G+  +GYYET+AGG+GAGP WHGRSG+H+HMTNTRITD EILESRYPVIL RF L+ G+GG G+F GGDG+ R L FR + +LS+LTERR F PYGL  GE G +GLN+LI+ D   R +++GGK S+ + PGDV  L T
Sbjct:   11 AIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYVDAPTEGIRRILEQEGGVLLPRDRPLDTSRIASIRMGTTVATNALLEQQGERVALLVTRGFRDLLHVCTQARAXLFDLAVPMPETLYEEVLEVDERVVLYRGXPGAGTPVKGCTGD-----LLEVQQPVDLGGLRWKLEGLLSRGIRSLAVVLMHSYTWAQHEQQVGALARELGFTHVSLSSEAMPMVRIVPRGHTACADAYLTPTIQRYVQGFRRGFQGQLKDVQVLFMRSDGGLAPMDSFSGSRAVLSGPAGGVVGYSATTYRVEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDINTVAAGGGSRLFFRS--GLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFGPGEDQPLSPEASRKALEAVATEVNSFLTNGPCPA-SPLSLEEVAMGFVRVANEAMCRPIRALTQARGHDPSAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLLSALGLALADVVHEAQEPCSLPYAPETFAQLDQRLGRLEEQCVEALRAQGFPRSQISTESFLHLRYQGTDCALMVSAHQHPASARSPRAGDFGAAFVERYMREFGFIIPERPVVVDDVRVRGTGSSSL---RLEDVPKAHSGPPRVDKMTQCYFEGGYQETPVYLLGELGCGHKLQGPCLIIDSNSTILVEPGCQAEVTETGDIRISVG-AETASVVGTQLDPIHLTIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNVPHIPVHLGAMQETVQFQIQQLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFWPGQTRPVFYVASRGHHADIGGITPGSMPPHSTSLQQEGAVFLSFKLVHGGVFQEEAVTEALRAPGKIPGCSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQANAELAVRDMLRAFGTARQARGLPLEVSAEDHMDDGSPIRLRVQINMSQGSAVFDFSGSGPEVFGNLNAPRAITLSALIYCLRCLVGRDIPLNQGCLAPVRVVIPKGSILDPSPDAAVVGGNVLTSQRVVDVILGAFGACAASQGCMNNVTLGNAHMGYYETVAGGAGAGPGWHGRSGVHSHMTNTRITDPEILESRYPVILRRFELRLGSGGRGRFRGGDGIIRELLFREEALLSVLTERRAFQPYGLMGGEPGARGLNLLIRKD--GRTVNLGGKTSVPVYPGDVFCLHT 1247          
BLAST of 5-oxoprolinase vs. UniProt/SwissProt
Match: sp|Q54NW6|OPLA_DICDI (5-oxoprolinase OS=Dictyostelium discoideum OX=44689 GN=oplah PE=3 SV=2)

HSP 1 Score: 1294.26 bits (3348), Expect = 0.000e+0
Identity = 696/1281 (54.33%), Postives = 903/1281 (70.49%), Query Frame = 2
Query:   83 IDRGGTFTDVWYRTSCNKIGTL-KLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERV-ILLNPKC----QLPVQGIISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTF------------NSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSRTDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVR----GSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDN-GYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGV-NEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKDS 3853
            IDRGGTFTD++          + KLLS DPENY+DAP E IRRI+E+  G    S + VD   I+ IRMGTTV TNALLERKGE   L+ ++GFRDLL IGNQSRP IF+L I  PE++Y++V+E++ERV I+ N +     +L     +  G   + + V    N  KI+++L K    GIKSIAV   HSY +  HE  +G+IA E+ F+ ISLS Q+MPMIK VPRG T   DAYLTP I+ YI +F +GF     +  I FM SDGGL P+  F G R+ILSGPAGGV+GY+KTT             N  K QPI+GFDMGGTSTDVSRY G L+H++E+  +G+ IQ+PQLDI+TVAAGGGSRLFF+   G+FLVGPES GAHPGP+CY+K G L +TDANL+L R+L +YFP IFGP +N+PLD +A+ KA K++T+E+N F ++    +   M+ +QVA GFI VANE+MCRPIR++T+ KG+D S+H+LACFGGAGGQH+CSIA+ LGM +VFIHRFSGILSA+GL LAD+V + QEPC L+YN  N     K++  L+EN  ++L ++GF E  I  E FLN+R+ GTD A+M+      D + +       F S YK EFGF++  RD++IDDIRVR    GS L+ + I+      D     LK E     YF++ G I T +YLL+ L     I GPAIIID   TIVVEP+C   +    G+++I IG   + +   TE D + LS+FSHRFMSIAEQMG+++ RTSISTNIKERLDFSCALF PDGGLVANAP IP+H+G+MQ  V+YQ+  L + +  G+V+LSNHPQ GGSHLPDLTV+TPV+ KG    +F++A+RGHHADIGG TPGSMPP SKSI EEGA   +  IVK+  FQE+ V +  +          SRN+SDNISDL+AQ+AAN KG  L+ ELIN YGL+VV +YM +IQ NAELAVR ML +I IS   K  +  L + D+MD G+KI+LK++ID ++ SAIFD++GSG +  GN N P+++  S  IY LR MV  ++PLNQGCL PI  +IP  S LNP+ D+AVVGGNVLTSQR+ DVI  AFGACA SQGCMNN+TFGD+ +GYYETIAGG+GAGP+++G + + +HMTNTRITD+EI+E RYPVI++ FS++ G+GG GKF GGDGV R ++F     +S+L+ERR   P GL  GE+ E+GLN+++K++   + I++G K S+ I   + + + TPGGGGFG KDS
Sbjct:   14 IDRGGTFTDIYAEFPYEPYYIVEKLLSVDPENYSDAPREGIRRILERIQG-KSISKENVDTYAIKSIRMGTTVGTNALLERKGEKVLLVTSKGFRDLLQIGNQSRPKIFELNITKPELIYNSVVELDERVQIVTNDQVLNDIKLESPNSLKKGTTGDYIKVLEIPNRDKIKSELLKYFVKGIKSIAVVFIHSYTFHDHELLVGEIAKEIGFEHISLSHQLMPMIKAVPRGLTSCVDAYLTPLIELYIKNFTKGFDSNIGDVDISFMMSDGGLCPVDSFRGFRSILSGPAGGVVGYSKTTSTVIESHKNNNGNNEIKQQPIIGFDMGGTSTDVSRYNGTLDHVFETEISGLTIQAPQLDIHTVAAGGGSRLFFKS--GLFLVGPESVGAHPGPVCYKKNGQLAITDANLLLGRLLPEYFPPIFGPNQNEPLDLEATKKAFKELTDEINQFQQN---NNLPLMTEDQVAFGFIRVANEAMCRPIRNITEAKGFDCSQHVLACFGGAGGQHSCSIAQNLGMPKVFIHRFSGILSAYGLGLADLVIDTQEPCSLIYNKENKSTFEKQLNQLKENAKQQLLNKGFPEEEIFCEGFLNLRFSGTDTAMMIKTPDNHDYEAE-------FKSNYKREFGFLILGRDLLIDDIRVRVHARGSDLNSLRIN------DSTGEPLKPETIQKCYFESVGRIDTPIYLLKSLCGGDSIDGPAIIIDNTTTIVVEPNCKANILKPSGNIEILIGGGKSKT-VTTELDPIMLSVFSHRFMSIAEQMGKIIIRTSISTNIKERLDFSCALFSPDGGLVANAPAIPIHVGSMQNAVKYQVETLGSNWKEGEVVLSNHPQAGGSHLPDLTVMTPVYHKGE--IVFFVASRGHHADIGGITPGSMPPFSKSISEEGAAIMSLKIVKDGHFQEEAVRKTFEK---------SRNLSDNISDLKAQIAANHKGIQLMQELINHYGLDVVHAYMYHIQKNAELAVRDMLYDISISNNLK-PLDTLISTDYMDDGSKIELKLTIDREKKSAIFDWSGSGVEVYGNTNAPTSITLSATIYSLRAMVKSEIPLNQGCLAPILTVIPPGSILNPSFDSAVVGGNVLTSQRLTDVILSAFGACANSQGCMNNLTFGDETLGYYETIAGGTGAGPNFNGFTAVQSHMTNTRITDVEIMEKRYPVIVKEFSVRYGSGGDGKFKGGDGVVREIQFLKNFTVSILSERRSLQPRGLMGGENAERGLNLVLKNN--GKYINIGSKNSINIERNESIIIFTPGGGGFGQKDS 1260          
BLAST of 5-oxoprolinase vs. TrEMBL
Match: A0A0B6ZGC5 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF60590 PE=4 SV=1)

HSP 1 Score: 1582 bits (4095), Expect = 0.000e+0
Identity = 810/1303 (62.16%), Postives = 996/1303 (76.44%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGIISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGED---FKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSRTDLKGKYDH--FVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLD----SNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGN-KDSTTELDSKAQCNRKISTMK----GSVHNYHLQQFSA 3946
            AIDRGGTFTDVW R    ++  +KLLSEDP NYNDAP EAIRRI+++E       +  +D   IEWIRMGTTVATNALLERKGEP ALLIT+GF+DLL+IGNQSRPNIFDL+I  P+ LY  V+EVEERV+L    CQ+  Q     G   E +    PLN  ++R DLQK+LD GI+SIAV L HSYI+P HEE +GK+A E+ F  +SLSS++M M ++VPRG+T  ADAYLTPCIK+YI+ F+EG  G    + +LFM+SDGGL+PM  F+GS AILSGPAGGV+GYA+TTF+ +   P++GFDMGGTSTDVSR+ G  EH++ES TAG+ IQ+PQLDINTVAAGGGS LFFR   G+F+VGPESAGAHPGP+CY K G LT+TDANL L R+L +YFP IFG  E+ PLD D++ KA + +T EVN+F  S + ED   F  M+ E+V LGFI VANE+MCRPIR+LTQ KGYDTS+HILACFGGAGGQHAC++AR LGM+ VFIHR++GILSA+G+ALADVV E QEPC L Y+  NF +I  RI  L+E C  EL  QGF+  +I+ +PFL++RY GTDCALM         +G   H  F  SFI+RYK+EFGFIL++R I +DDIRVRG G       + E  SD+     S     E+ V  +F+ G + T VYLLE L     ++GPAIIID N TI+VEP+C   ++++GD+ I +G S+N     T+ DT+QLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCA+FGPDGGLVANAPHIPVHLGAMQ TVQYQM+ L + F  GDVILSNHP+ GGSHLPDLTVITPVF +G   P+F++A+RGHHADIGG TPGSMPPHS SI++EGAVFK+F +V+    +EKE+I+A   P++YPG SG+RN+ DN+SDL+AQVAAN++G  L++ELI+EYGLEVVQ+YM YIQ+NAELAVR MLKEI   T ++ G ++L AEDFMD GTKI L V I+  EG+AIFDFTG+G+Q  GN N P A+  S +IY +RCMVGHDVPLNQGCL PIKVI+P+ S ++P+E AAVVGGNVLTSQRIVDV+FKAFG CAASQGCMNNVTFGD+ +GYYET+AGG+GAGP+WHGRSG+HTHMTNTRITD EI+E RYPVIL+ F L  GTGG+G F GGDGV R L FR  + LSLLTERRVFAPYGLE GE G+ G N++  +D   R +D+GGK S+ ++ GD+  L+TPGGGG+G+ K    +++  +   RK+   K    GS+ +Y L Q SA
Sbjct:   10 AIDRGGTFTDVWARCPDGRVRVMKLLSEDPANYNDAPKEAIRRIIQQETN--NHGSSSIDTNIIEWIRMGTTVATNALLERKGEPMALLITKGFQDLLHIGNQSRPNIFDLEIVSPDNLYEKVVEVEERVVLRQDDCQIHKQSGAVKGTTGEMLYTWKPLNVVQLRYDLQKILDDGIRSIAVVLMHSYIFPDHEEAVGKLAQEMGFTNVSLSSKVMSMARVVPRGYTACADAYLTPCIKRYIEGFREGLQG----AKVLFMRSDGGLTPMENFMGSHAILSGPAGGVVGYAETTFDHETKIPVIGFDMGGTSTDVSRFAGEFEHVFESTTAGVTIQAPQLDINTVAAGGGSMLFFRS--GMFVVGPESAGAHPGPVCYMKGGPLTITDANLCLGRLLPEYFPHIFGKTEDMPLDKDSTLKAFQKLTLEVNEFLLS-QAEDKNKFVKMTEEEVGLGFIRVANETMCRPIRALTQAKGYDTSRHILACFGGAGGQHACAVARSLGMQEVFIHRYAGILSAYGMALADVVYEAQEPCALTYSPENFHQIDARIAALEEECQVELIKQGFDRKHIEKQPFLHLRYAGTDCALMCLAQLPAH-EGTTAHGDFYTSFITRYKTEFGFILKDRQIYVDDIRVRGVG-------KSEASSDVKIPVASGAPIKEKTVRCHFEEGTLNTDVYLLENLCAGHHMTGPAIIIDNNSTILVEPNCEAEISKQGDVRIKVG-SANKKVVGTDLDTIQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCAMFGPDGGLVANAPHIPVHLGAMQETVQYQMKTLRDNFKDGDVILSNHPEAGGSHLPDLTVITPVFSQGQTRPVFFVASRGHHADIGGITPGSMPPHSTSIFQEGAVFKSFKLVEGGELREKELIQAFNDPAKYPGSSGTRNLHDNLSDLKAQVAANQRGIKLITELIHEYGLEVVQAYMKYIQENAELAVRDMLKEIARKTKARTGYTKLYAEDFMDHGTKICLHVDINETEGTAIFDFTGTGFQVHGNTNAPRAITLSAIIYSVRCMVGHDVPLNQGCLAPIKVIMPKGSIIDPSEQAAVVGGNVLTSQRIVDVVFKAFGVCAASQGCMNNVTFGDEQIGYYETVAGGAGAGPTWHGRSGVHTHMTNTRITDPEIIEKRYPVILQCFKLNPGTGGLGHFCGGDGVVRELLFRRPLTLSLLTERRVFAPYGLEGGEPGQSGRNLIFYAD--GRVVDLGGKNSVTVSAGDIYHLETPGGGGYGSLKAEGDQIEPPSNKRRKVGQQKVLQSGSLFSYKLLQESA 1292          
BLAST of 5-oxoprolinase vs. TrEMBL
Match: A0A2T7NJY7 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_19641 PE=4 SV=1)

HSP 1 Score: 1574.68 bits (4076), Expect = 0.000e+0
Identity = 787/1301 (60.49%), Postives = 978/1301 (75.17%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGIISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNS--RTDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKDSTTELDSKAQCNRKIS----------TMKGSVHNYHLQQFSA 3946
            AIDRGGTFTDVW +    K+  LKLLS+DP NY+DAP E IRRI+++E GVP    + +  + + WIRMGTTVATNALLERKGE  AL+IT+GF+DLL IGNQ+RPNIFDL I  PE LY  V+EVEER+++    C+L  +  +      EK+ V  P+NE+K+R+DLQ +   GI+ +AV L H+YIYP HE  + +IA E+ F Q+SLSS +MPM+++VPRG+T  ADAYLTPCIKKY+ SF  GF      + +LFM+SDGGL+P+  F G++AILSGPAGGV+GYA TT++    QP++GFDMGGTSTDVSRY G  EH++E+ TAG+ IQ+PQLDINTVAAGGGS L FR   G+F+VGPESAGAHPGP CYRK G LT+TDANLVL R+L ++FP IFG  EN+PLD++AS+KA   +T+EVN F  + +  + K MSV  VA+GFI VANE+MCRPIR+LTQ KGYDT++H+LACFGGAGGQHAC+IAR LGMR+VFIHR++ ILSA+G+ALADVV E QEPC L Y + NF  I    + L   CI+ L  QGF+  +I+ E FL+MRY GTDCALMVS N    T    ++  F+  F+ RY++EFGF L++R I +DD+RVRG G S   ++   +  D        E+ V VYF+N YI T VY+L+KL     I GPAII+DKN TIVVEP+C   + + GD+ I +G SS +    T  D VQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQ TVQYQ+R L N    GDVILSNHPQ GGSHLPDLTVITPVF  G   P+FY+A+RGHHADIGG TPGSMPPHS SI++EGAVFK+F +VK  +FQE+ V E  + P   PGCSGSRN+ DN+SDL AQVAAN+KG  LV ELI+EY L V+Q+YM YIQ+NAE+AVR MLKEI   T +  G + LSA DF+D G+ I L+V ID  +G+A+FDF  +G++  GN N P AV+ S LIYCLR MVGHD+PLNQGCLKP+ V+IP+ S L+P+E AAVVGGNVLTSQRIVDVI +AFG+CAASQGCMNN+TFGD+++GYYET+AGG+GAGPSWHG SG+HTHMTNTRITD EI+E RYPVIL+ F L RG+GG G F GGDGV R + FR  + LS+LTERRVF+PYGL+ G++G KG N++   D   R + +G K+S+ ++PGD+  L+TPGGGG+G  D++++  S+ Q   + +            +GSVH Y L Q SA
Sbjct:   16 AIDRGGTFTDVWAKCPSGKVRVLKLLSDDPSNYSDAPLEGIRRILQEETGVPYPPGEHLSTQNLGWIRMGTTVATNALLERKGERTALVITQGFQDLLQIGNQARPNIFDLAIRKPEELYEDVVEVEERLVMCREDCRLNGRHPVVIATTGEKLEVWQPVNETKLRSDLQNVYTKGIRCLAVVLMHAYIYPEHELTVSRIAKEIGFTQVSLSSHVMPMVRMVPRGYTACADAYLTPCIKKYVSSFSSGFKESLKGTHVLFMRSDGGLTPVHVFTGAQAILSGPAGGVVGYALTTYSELDGQPVIGFDMGGTSTDVSRYAGSYEHVFETTTAGVTIQAPQLDINTVAAGGGSILSFRA--GLFVVGPESAGAHPGPACYRKGGPLTITDANLVLGRLLPEFFPCIFGENENEPLDYEASWKAFTALTDEVNAFVTTQETCNSK-MSVGDVAMGFIQVANEAMCRPIRALTQAKGYDTAQHVLACFGGAGGQHACAIARTLGMRQVFIHRYASILSAYGMALADVVHEAQEPCALAYEAGNFRDIDAIADRLIGQCIQRLSQQGFSRDDIKTEVFLHMRYHGTDCALMVSANDLPATLASSRHGDFLARFLMRYRTEFGFTLQDRHIFVDDVRVRGVGKSTAPVN---FPIDEAKEKPIEEKRVQVYFENAYIATPVYMLDKLRAGHTIEGPAIILDKNSTIVVEPNCDARITKHGDISITVG-SSEMKIVGTNLDAVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQETVQYQIRTLGNDILDGDVILSNHPQAGGSHLPDLTVITPVFYSGVSKPVFYVASRGHHADIGGITPGSMPPHSTSIHQEGAVFKSFKLVKEGVFQEEAVTEVFRAPGLIPGCSGSRNLQDNLSDLHAQVAANQKGITLVKELISEYSLPVIQAYMAYIQENAEVAVREMLKEIAQKTKACTGTTTLSAHDFLDDGSLIALQVHIDELQGTAVFDFANTGFEVYGNCNAPRAVVLSALIYCLRSMVGHDIPLNQGCLKPVNVLIPKGSLLDPSEQAAVVGGNVLTSQRIVDVILRAFGSCAASQGCMNNITFGDENMGYYETVAGGAGAGPSWHGCSGVHTHMTNTRITDPEIIERRYPVILKCFHLNRGSGGKGVFHGGDGVIREILFRKPLTLSVLTERRVFSPYGLQGGKNGRKGRNLMFYKD--GRIVSIGAKMSVAVSPGDIFHLETPGGGGYG--DASSKQASQHQVGEEANFDMLDSFPKFPERGSVHQYRLSQESA 1305          
BLAST of 5-oxoprolinase vs. TrEMBL
Match: A0A2J7QAU6 (5-oxoprolinase OS=Cryptotermes secundus OX=105785 GN=B7P43_G15608 PE=4 SV=1)

HSP 1 Score: 1546.95 bits (4004), Expect = 0.000e+0
Identity = 780/1305 (59.77%), Postives = 977/1305 (74.87%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNP-KCQLPV--QGIISNGRNE-----EKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGF----IGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDF-NRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGN--SRTDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFG--NKDSTTELDSKAQCNRKISTMKGSVHNYHLQQFS 3943
            AIDRGGTFTD++ R    K+  +KLLS DP NY DAP E IRRI+E+E G+   +N  +D +YI+WIRMGTTVATNALLERKGE  ALLI +GFRDLL+IGNQ+RP IFDL+I  P++LY  V+EV+ RV+   P +C L     G  SN R+      EK++V   LNE  +R DL  L + GI SIAV LAHSY+YP HEE +G++A ++ F  +SLS Q+MPM+++VPRGFT  ADAYLTP I KYI+ F  GF    +G++    +LFMQSDGGL+ M  F GS AILSGPAGGV+GYA TT+  +   P++GFDMGGTSTDVSR+ G  EH++ES TAG+ IQ+PQLD+NTVAAGGGS LFFR   G+F+VGPESAGAHPGP+CYRK G LTVTDANL L R+L +YFPKIFGP EN+PLD  A+ +A   +TEE+N+F +    G+   +M+ E VA+GFIHVANE+MCRPIR+LTQ KGYDT+ H+LACFGGAGGQHACSIAR LGM  VF+H+++GILSA+G+ALADVV E QEPC  +Y   +FL + +R+  L++ C  ELE QGF   +I  E +L++RY+GTDCALM + N  S+++   K+  F  +F+ RY+ EFGF ++ R I++DDIRVRG G S +        ++      + ++ VDVYF++GY   +VY+L  L     I GPAII+D   T++VEPDC   +   GD+ I IG S  L    TE D + LSIFSHRFMSIAEQMGRVLQRT+ISTNIKERLDFSCALFGPDGGLV+NAPHIPVHLG+MQ  VQYQMR L   F  GDVIL+NHP  GGSHLPDLTVITPVF K    P+F++A+RGHHADIGG TPGSMPPHSKS+ EEGA FK+F++VK  +F E E+++AL+ P   PG SG+RN+ DN+SDL+AQ+AAN KG  LV ELI+ YGL+VVQ+YM +IQ NAE+AVR ML+EIG     + GVSEL AEDF+D G+ I+LK+SID  +G+A+ DF+G+GY+  GN N P A+  S LIYCLRCMVGHDVPLNQGCL P++V IP+ S L+P++ AAVVGGNVLTSQRIVDV+ KAF  CAASQGCMNNVTFG++  GYYET+AGG+GAGPSWHG SGIHTHMTNTRITD EILE RYPVIL  FSL+  +GG G++ GGDGV R L FR  +MLS+LTERRVF PYG++ G  GE+GLN+++KSD   R I +G K ++   PGD+ +L TPGGGG+G  N  ++ E D+ +Q  + +S  +GSV+ YH  Q S
Sbjct:   11 AIDRGGTFTDIYARCPGGKVRVMKLLSVDPANYPDAPREGIRRILEEETGIQMPANHPIDGRYIDWIRMGTTVATNALLERKGERMALLINKGFRDLLFIGNQARPKIFDLEILTPDVLYEEVMEVDCRVVPALPGQCLLMGLGHGEWSNWRHATGTTGEKLLVCQELNEDTLRKDLIVLKEKGINSIAVVLAHSYMYPEHEEAVGRVARQVGFNHVSLSHQVMPMVRIVPRGFTACADAYLTPHIHKYINGFSGGFKDNLVGVN----VLFMQSDGGLTCMDTFSGSHAILSGPAGGVVGYAVTTYKKETDLPVIGFDMGGTSTDVSRFAGDYEHVFESTTAGVTIQAPQLDVNTVAAGGGSMLFFRS--GLFVVGPESAGAHPGPVCYRKGGPLTVTDANLCLGRLLPEYFPKIFGPSENEPLDKAATIEAFYKLTEEINNFLSTQPDGKTKPAMTAEDVAMGFIHVANEAMCRPIRALTQAKGYDTNHHVLACFGGAGGQHACSIARALGMGTVFVHKYAGILSAYGMALADVVHEAQEPCAKVYEPESFLYLDERLTVLEKQCEVELEKQGFKPEHIHTEAYLHLRYEGTDCALMCTANPSSKSETACKHGDFQKTFLQRYQREFGFTIQGRVIVVDDIRVRGIGKSLVQTDSPVPAAE---GPPRVDKEVDVYFESGYHHASVYILGDLHAGHEIPGPAIIMDNLSTVLVEPDCTAFITSRGDIKIVIG-SGELRRIGTELDAIHLSIFSHRFMSIAEQMGRVLQRTTISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGSMQEAVQYQMRSLEGGFQEGDVILTNHPAAGGSHLPDLTVITPVFYKSERKPVFFVASRGHHADIGGITPGSMPPHSKSLTEEGASFKSFYLVKQGLFNEAELVQALKAPGMVPGSSGTRNLQDNLSDLKAQIAANHKGISLVLELIDAYGLDVVQAYMRHIQTNAEVAVRDMLREIGTKVHQRSGVSELEAEDFLDDGSPIRLKISIDIQQGTAVCDFSGTGYELWGNCNAPRAITLSALIYCLRCMVGHDVPLNQGCLNPVRVTIPKGSLLHPSDTAAVVGGNVLTSQRIVDVVLKAFEVCAASQGCMNNVTFGEEKWGYYETVAGGAGAGPSWHGHSGIHTHMTNTRITDAEILERRYPVILRHFSLRPNSGGSGRYRGGDGVVRELLFRRHIMLSVLTERRVFHPYGMKGGSPGERGLNLIMKSD--GRIISLGSKTAIATEPGDIFRLLTPGGGGYGCPNVMTSAEEDT-SQKKQPLSIERGSVYEYHRAQES 1302          
BLAST of 5-oxoprolinase vs. TrEMBL
Match: A0A3P9A6I8 (5-oxoprolinase, ATP-hydrolysing OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 1546.56 bits (4003), Expect = 0.000e+0
Identity = 779/1306 (59.65%), Postives = 978/1306 (74.89%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGIISNGRNEEK---VIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFI-GLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFN------RSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVS-----GNSRTDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKS-EEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKDSTTELD-SKAQCNRKIS---TMKGSVHNYHLQQ 3937
            AIDRGGTFTDV+ R    +   LKLLS DP+NY DAP E IRR++E+E G+     Q VD   I WIRMGTTVATNALLER+GE  ALL+T+GF+DLL+IG Q+RP +FDL++ VPE+LY  VIEV+ERV+L    CQLP        R E +   + V   ++  ++  DL+ +L  GI S+AV L HSY +  HE+ +G +A +L F Q+SLSS++MPM+++VPRG+TV ADAYLTP I++Y++ F  GF  GL D S +LFMQSDGGL+PM +F GSRA+LSGPAGGV+GYA T+++  + +P++GFDMGGTSTDVSRY G  EH++E+ TAG+ +Q+PQLDINTVAAGGGSRLFFR   G+F+VGPESAGAHPGP CYRK G LTVTDANL L R+L  +FP+IFGP E+QPL  D + K  + +T+E+NDF+      R L       MSVE+VA+GFI VANE+MCRPIR+LTQ KG+DTS+H+LACFGGAGGQHAC+IAR LGM+ VFIH++SG+LSA+GLALADVV E QEPC L Y   +F ++ +R+E L + C E L  +GF+  +I  E FL++RY+ TDCALMV+     GNS++   G    F  +F  RY+ EFGF + +R I++DDIRVRGSG SGI  S       LD     + E     YF++GY+ T+VYL E LP +  ISGPAIIIDKN TI+VEP CV  + E GD+ I++G+  +     TE +TVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCA+FGPDGGLV+NAPHIPVHLGAMQ TVQYQ++ + +    GDVILSNHP  GGSHLPDLTVITPVF++G   P+F++A+RGHHADIGG TPGSMPPHS S+ +EGAVF +F +V   +FQE+ V EAL  P++YP CSG+RN+ DN+SDLRAQVAAN++G  LV ELI+ YGL VVQ+YMG+IQ NAELAVR MLK+       K G  ++ AEDFMD GT I+L+V ++  EGSA+FDFTG+G +  GN N P A+  S LIYCLRCMVG D+PLNQGCL PI+VIIP+ S L P++DAAVVGGNVLTSQR+VDVIF+AF  CAASQGCMNNVTFG +  GYYET+AGG+GAGP W+GRSG+H+HMTNTRITD EILE RYPV+LE+FSL+  +GG GK  GGDGV R L FR+K++LS+LTERR   PYGL  GESG  GLN+L ++D   R +++G K ++ + PGDV  L TPGGGG+G KD     + +  +  R+ S   + +GSV  Y + Q
Sbjct:    9 AIDRGGTFTDVFARLPDGREKVLKLLSHDPQNYQDAPTEGIRRVLEEETGLAFPREQPVDTSLIGWIRMGTTVATNALLERRGERTALLVTKGFKDLLHIGTQARPKLFDLEVAVPEVLYEEVIEVDERVVLRQDGCQLP--------RKEPRPGPLEVWREVDMQRVEEDLRGVLSRGITSLAVLLLHSYTWSDHEKAVGSLARKLGFTQVSLSSEVMPMVRVVPRGYTVCADAYLTPKIRQYLEGFTSGFRDGLKDVS-VLFMQSDGGLTPMEQFCGSRAVLSGPAGGVVGYAVTSYDPAQKKPVIGFDMGGTSTDVSRYAGQFEHVFEAATAGVTLQAPQLDINTVAAGGGSRLFFRS--GMFVVGPESAGAHPGPACYRKGGPLTVTDANLALGRLLPAFFPRIFGPGEDQPLSSDDTMKCFRQLTQEINDFHSTTDGSRDLADGSEPEMSVEEVAMGFIRVANEAMCRPIRALTQAKGHDTSQHVLACFGGAGGQHACAIARALGMKTVFIHKYSGVLSAYGLALADVVEEVQEPCSLQYCPGSFSELDRRVEQLTQRCTETLRGRGFSGSDITTEVFLHLRYQKTDCALMVTAAGYPGNSQSCRSGD---FCSAFTERYRKEFGFTISDRPIMVDDIRVRGSGKSGIK-SVTHTKRGLDVPKATTVETTTKCYFEDGYLETSVYLCEDLPCDHSISGPAIIIDKNSTILVEPSCVAQLTEGGDVSISVGSDPHCL-LGTELNTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCAVFGPDGGLVSNAPHIPVHLGAMQETVQYQIKSIGSTIEEGDVILSNHPCAGGSHLPDLTVITPVFRRGVSGPVFFVASRGHHADIGGITPGSMPPHSTSLQQEGAVFTSFKLVTAGVFQEEAVTEALMAPAQYPDCSGTRNLHDNLSDLRAQVAANQRGSALVGELIDSYGLAVVQAYMGHIQSNAELAVRDMLKDFARRRRQKTGSLDVEAEDFMDDGTPIRLRVQVNEKEGSAVFDFTGTGTEVWGNCNAPRAITFSALIYCLRCMVGQDIPLNQGCLAPIRVIIPDGSILQPSQDAAVVGGNVLTSQRVVDVIFRAFEVCAASQGCMNNVTFGSEGSGYYETVAGGAGAGPEWNGRSGVHSHMTNTRITDPEILEKRYPVVLEQFSLRPNSGGAGKHRGGDGVIRKLLFRNKVVLSILTERRSTRPYGLHGGESGASGLNLLHRAD--GRVLNLGAKTTVNLEPGDVFCLYTPGGGGYGEKDERAAGNGAPVKKRRRFSETFSERGSVFEYRMAQ 1296          
BLAST of 5-oxoprolinase vs. TrEMBL
Match: A0A1W5BMF9 (5-oxoprolinase isoform X1 OS=Ciona intestinalis OX=7719 GN=LOC100176159 PE=4 SV=1)

HSP 1 Score: 1544.64 bits (3998), Expect = 0.000e+0
Identity = 792/1300 (60.92%), Postives = 973/1300 (74.85%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGIISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSRTDLK-GKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRK---EYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGIST----FSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKDSTTELDSKAQCNRKIS------TMKGSVHNYHLQQ 3937
            AIDRGGTFTD++ +    K   +KLLS DP NY DAP E IRRI+E+E+G P  S+Q VD  +I++IRMGTTVATNALLERKGE  AL+IT+GFRDLL+IGNQSRP IFDL+I+VP +LY  ++EVEER+IL   KC L +   +  G  +E++     LNE K+RNDL  +L+ GIKSIAVAL HSY    HE K+G+IA EL F Q+SLSS++M M+KLVPRGFT   DAYLTP IKKY+  F+ GF     N  +LFM+SDGGL+P+ KF GSRA+LSGPAGGV+GY+ T++     QP++GFDMGGTSTDVSRY G  EHI+ES +AG+ IQ+PQLDINTVAAGGGS LFFR   G+F+VGP+SAGAHPGP CYRK G LTVTDANL L R+  +YFPKIFG  EN  LD  A+ +A   +TEEVN F  S   +  +++SVEQVA+GFI VANESMCRPIR+LTQ KG+DTS H+L+CFGGAGGQHAC+IAR LGM +VFIH++SGILSA+G+ALADVV E QE     +N  N   I  RI++L   C ++L+SQGF+   I  E +LN+RY  TDCALM S ++       KY  F+ +F SRY +EFGF +  R I +DDIRVRG G SGI +++    ++   L     K E  V  YF++GY  T+VYL E+L       GPAIIIDKN TI+VEPDC   + E GD+ I +G S  L++  TE D++QLSIFSHRFMSIAEQMGR+LQRT+ISTNIKERLDFSCALFGPDGGLV+NAPHIPVHLGAMQ  VQYQM++L +    GD ILSNHP  GGSHLPDLTVITPVF  G + PIF+LANRGHHADIGG+TPGSMPPHS SI +EGAVFK+F +V++  FQEKEV EAL  P +  GCSG+RN+ DN++DLRAQVAAN++G  LV+ELI  YGL VVQ+YMG+IQ NAE+AVR +L+ +  ST         +  LSAEDF+D G+KIKL++ ID+++GSA+FDF+G+      NLN P A+  S +IYCLRCMVG+DVPLNQGCL P+ + IP+ S L+P E AAVVGGNVLTSQRIVDVI KAF  CAASQGCMNN+TFGD++VGYYET+AGG+GAGP+WHGRSG+HTHMTNTRITD EILE RYPVIL+ F L  GTGG G++ GGDGV R + FR  ++LS+LTERRVF PYGLE G+ G+ G N+L + + P  KI +GGK  +E+N GDV +L+TPGGGGFG++ S  E   K    RK+         +GSV  Y  QQ
Sbjct:   10 AIDRGGTFTDIYAKCPNGKSRVMKLLSVDPGNYPDAPREGIRRILEEELGTPMPSSQPVDTSHIDYIRMGTTVATNALLERKGERMALVITQGFRDLLHIGNQSRPKIFDLQIKVPNVLYEDIVEVEERIILHQDKCCLDISSDVVIGSTKERLYKWKKLNEEKLRNDLTAILNKGIKSIAVALMHSYTCADHELKVGEIATELGFTQVSLSSKVMSMVKLVPRGFTACVDAYLTPSIKKYLAGFQSGFDENLKNVQLLFMKSDGGLTPVDKFNGSRALLSGPAGGVVGYSMTSYED---QPVIGFDMGGTSTDVSRYNGQYEHIFESTSAGVTIQAPQLDINTVAAGGGSMLFFRS--GLFVVGPQSAGAHPGPTCYRKGGPLTVTDANLCLGRLQPQYFPKIFGKSENLGLDISATKEAFILLTEEVNQFMSS-SNKLHEALSVEQVAMGFICVANESMCRPIRALTQAKGHDTSGHVLSCFGGAGGQHACAIARSLGMSKVFIHKYSGILSAYGMALADVVHETQESAACQFNKENLPWIDGRIDSLSHQCCQQLKSQGFSSQQICTEVYLNLRYDRTDCALMCSPSTTIGKNVSKYGDFLETFTSRYHTEFGFTIPGRTIFVDDIRVRGVGKSGISVTQSVGMDHGRKLRVKAPKCETVVQCYFEDGYQDTSVYLFEQLSHGHHFQGPAIIIDKNSTILVEPDCSAEITENGDITIKVG-SGKLNKVGTELDSIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDGGLVSNAPHIPVHLGAMQEAVQYQMKHLGDNIKEGDCILSNHPLAGGSHLPDLTVITPVFALGHKNPIFFLANRGHHADIGGTTPGSMPPHSTSIKQEGAVFKSFKLVRDGKFQEKEVTEALMEPGKEEGCSGTRNLHDNLADLRAQVAANQRGIHLVNELIEAYGLPVVQAYMGHIQSNAEVAVRDLLRVVARSTKVSDLELPDMVSLSAEDFLDDGSKIKLRIDIDSEKGSAVFDFSGTSPMVLNNLNAPKAITLSAIIYCLRCMVGYDVPLNQGCLAPVDIRIPKWSILDPEEHAAVVGGNVLTSQRIVDVIMKAFKTCAASQGCMNNITFGDNEVGYYETVAGGAGAGPTWHGRSGVHTHMTNTRITDPEILERRYPVILQNFKLNPGTGGRGEYVGGDGVVREMLFRKNLVLSVLTERRVFPPYGLEGGDPGKVGCNLLYRHNGP--KISLGGKNFVEVNAGDVFRLETPGGGGFGSEPSNDESPRK---RRKLKDDVQTFVERGSVFEYSQQQ 1297          
BLAST of 5-oxoprolinase vs. Ensembl Cavefish
Match: oplah (5-oxoprolinase, ATP-hydrolysing [Source:NCBI gene;Acc:103042964])

HSP 1 Score: 1498.8 bits (3879), Expect = 0.000e+0
Identity = 763/1262 (60.46%), Postives = 945/1262 (74.88%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQ--GIISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKS-------MSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMV--SGNSRTDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGID---ISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTP 3823
            AIDRGGTFTDV+ R    +   LKLLS DP+NY DAP E IRR++E+E G      Q VD   I WIRMGTTVATNALLER+GE  ALL+T GF+DLL+IG Q+RPN+FDL++ +P++LY  VIEV+ERV+L    CQL  +    I  G   E + V   L+  ++  DL+ +L  GI S+AV L HSYI+P HE+ +G +A  L F Q+SLSS++MPMI+ VPRG+TV ADAYLTP I +Y+  F  GF G   +  +LFMQSDGGL+PM +F GSRA+LSGPAGGV+GYA T+++S + +P++GFDMGGTSTDVSRY G  EH++E+ TAG+ +Q+PQLDINTVAAGGGSRLFFR   G+F+VGPESAGAHPGP CYRK G LTVTDANL L R+L  +FP IFGP EN+PL  + + K  + +T+++N F  S + E   S       MS+E+VA+GFI VANE+MCRPIR+LTQ KG+DTS+H+LACFGGAGGQHAC+IAR LGM+ VFIH++SG+LSA+GLALADVV E QEPC L Y  + + ++ +RI+ L + C   L+ +GF+   I  E FL+MRY+GTDCALMV  SG        +   F  SF  RY  EFGF + +R I++DDIRVRGSG SGI    I++K + S       K  +    YF+ GY+ T+VY+ + L     I GPAIIIDKN TI+VEP C   + E GDM + +G  S+     TE +TVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCA+FGPDGGLV+NAPHIPVHLGAMQ TVQYQ++ + +    GDVILSNHP  GGSHLPDLTVITPVFQ+G   P+F++A+RGHHADIGG TPGSMPPHS S+ +EGAVF +F +V   +FQEK V +AL  P++YPGCSG+RN+ DN+SDLRAQVAAN++G  LV ELI+ YGL VVQ+YMGYIQ NAELAVR MLKE       + G  E+ AED MD GT I+LKV I+ +EGSA+FDF+G+G +  GN N P A+  S LIYCLRCMVG ++PLNQGCL PIKVIIP  S L P++ AAVVGGNVLTSQR+VDVIF+AF ACAASQGCMNNV+FG +  GYYET+AGG+GAGP W+GRSG+H+HMTNTRITD EILE RYPV+L++FSL+ G+GG G+F GGDGV R L FRSKM+LS+LTERR   PYGL  GESG  GLN+L ++D   R +++G K ++ + PGDV  L TP
Sbjct:   11 AIDRGGTFTDVFARLPDGRERVLKLLSHDPQNYKDAPTEGIRRVLEQETGRSFPREQPVDSSLIGWIRMGTTVATNALLERQGERTALLVTRGFKDLLHIGTQARPNLFDLRVCMPDVLYEEVIEVDERVVLRQDGCQLSREEPKRIVTGSTGESLEVWQELDLHRVERDLKAVLSRGITSLAVLLLHSYIWPAHEKAVGSLAWRLGFTQVSLSSEVMPMIRAVPRGYTVCADAYLTPKIHQYLSGFTSGFKGGLKDVDVLFMQSDGGLTPMEQFSGSRAVLSGPAGGVVGYAVTSYSSTEKKPVIGFDMGGTSTDVSRYAGQYEHVFEATTAGVTLQAPQLDINTVAAGGGSRLFFRS--GMFVVGPESAGAHPGPACYRKGGPLTVTDANLALGRLLPDFFPHIFGPGENEPLSTEETMKGFQQLTQDINHFLSSSQSEHGASQKKGKSEMSLEEVAMGFIRVANEAMCRPIRALTQAKGHDTSQHVLACFGGAGGQHACAIARALGMKTVFIHKYSGVLSAYGLALADVVEEAQEPCSLQYKEDCYSELDRRIQELTQRCQNTLQQRGFSCSQISTEVFLHMRYEGTDCALMVNASGYPGHAQSCQAGDFRTSFTKRYLKEFGFTIADRPIVVDDIRVRGSGKSGIKSVTIAKKGHDSS------KPTKVTKCYFEEGYLDTSVYMWDDLTCGYSIEGPAIIIDKNSTILVEPGCSAQLTESGDMCVAVGTDSHCV-LGTELNTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCAVFGPDGGLVSNAPHIPVHLGAMQETVQYQLKAIGSSLKEGDVILSNHPCAGGSHLPDLTVITPVFQRGVSRPVFFVASRGHHADIGGITPGSMPPHSTSLQQEGAVFTSFKLVTEGVFQEKAVTDALMAPAQYPGCSGTRNLHDNLSDLRAQVAANQRGSQLVGELIDCYGLAVVQAYMGYIQSNAELAVRDMLKEFARRRRQQTGSLEVEAEDQMDDGTPIRLKVQINEEEGSAVFDFSGTGTEVWGNCNAPRAITLSALIYCLRCMVGQEIPLNQGCLNPIKVIIPPGSILQPSQSAAVVGGNVLTSQRVVDVIFRAFEACAASQGCMNNVSFGSEKSGYYETVAGGAGAGPGWNGRSGVHSHMTNTRITDPEILEKRYPVVLQQFSLRPGSGGAGRFQGGDGVIRKLLFRSKMILSVLTERRSTRPYGLHGGESGAAGLNLLYRAD--GRVLNLGAKTTVSLEPGDVFCLHTP 1261          
BLAST of 5-oxoprolinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001311.1 (pep scaffold:Pmarinus_7.0:GL479305:213649:244651:1 gene:ENSPMAG00000001177.1 transcript:ENSPMAT00000001311.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1273.07 bits (3293), Expect = 0.000e+0
Identity = 679/1205 (56.35%), Postives = 856/1205 (71.04%), Query Frame = 2
Query:  254 VDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGIISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKS----MSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVS--GNSRTDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKE--IGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGN 3844
            +D   +EWIRMGTTVATNALLERKGE  ALLIT GFRDLL+IGNQ+RP IFDL+I +PE+LY  VIEVEERV+L   KCQLP   +   G   EK+ V   ++ + +   L ++L  GI S+AV L HSY +  HE  +G++A  + F+ +SLSS IMPM+++VPRG+T  ADAYLTPCI+KY+  F  GF     +  +LFMQSDGGL+PM +F GSRAILSGPAGGV+GYA TT  +DKCQP++GFDMGGTSTDVSR+ G  EH++E+ TAG+ IQ+PQLDINTVAAGGGS LFFR   G+F+VGPESAGAHPGP CY+K G LTVTDANL L R+L ++FPKIFGP E +PL    ++ A   +T  VNDF  +      ++    MSVE+VA+GFI VANE+MCRPIR+LTQ KG+DTS+H+LACFGGAGGQHAC+I R LGM  VFIH++SGILSA+G+ALADVV E QEP  L+Y    F ++ +RI  L + C++EL SQGF    I  E FL+MRY+ TDCA+M S  G    +    Y  F+ +F  RYK EFGF +  R +++DD+RVRG G SGI +   E  +  +   L+  +    YF+ GY+ T VYLLE+L     I GPAIIID N T ++       V E GD+ + +G +S  +      D VQLSIFSHRFMSIA   G V Q +   +        +C   G   GL  +      H+G+  G V+ Q+R L +    GDVILSNHP  GGSHLPDLTVITPVF+ G + P+F++A+RGHHADIGG TPGSMPP+S ++ +EGAVF +F +VK+ IFQE+ V EAL  PS  PG SG+RN+ DN+SDLRAQVAAN +G  LV +L++ YGL  VQ+YM +IQ+NAE+AVR MLKE  +G+      G   + AED MD GT I+L V I+  +GSA+FDFTG+G +  GN N P A+  S LIYCLR MVG D+PLNQGCL P++V+IPE S L+P+  AAVVGGNVLTSQRIVDVIF+AF  CAASQGCMNN+TFGD++VGYYET+AGG+GAGP W GRSG+HTHMTNTRITD EILE RYPV+L++F+L  GTGG G+ +GGDGV R L FR  ++LS+LTERR F PYGL  G  G  G N  I+++    ++++  K S+ + PGD   LQTPGGGGFG 
Sbjct:    9 LDTAAVEWIRMGTTVATNALLERKGERMALLITRGFRDLLHIGNQARPKIFDLEIRMPEVLYEEVIEVEERVVLQQQKCQLPGNMVGGAGSTGEKLEVWKEVDLADLEEKLSRVLARGISSLAVVLMHSYTWAGHERSVGELARRMGFRHVSLSSDIMPMVRVVPRGYTACADAYLTPCIQKYLCGFTAGFRNELQDVRVLFMQSDGGLTPMGRFNGSRAILSGPAGGVVGYAVTTSTADKCQPVIGFDMGGTSTDVSRFAGSYEHVFETTTAGVTIQAPQLDINTVAAGGGSILFFRA--GMFVVGPESAGAHPGPTCYKKGGPLTVTDANLCLGRLLPEFFPKIFGPDETEPLGKKETWTAFAKMTAGVNDFLAAQASGSSQAPPDNMSVEEVAMGFIRVANEAMCRPIRALTQAKGHDTSQHVLACFGGAGGQHACAIVRALGMSTVFIHKYSGILSAYGMALADVVHECQEPSALVYGPPAFRRLEERITALDQRCVQELRSQGFARSQIHTEVFLHMRYERTDCAIMCSACGFPGNEASCSYGDFLEAFTQRYKLEFGFTIPGRAVVVDDVRVRGVGKSGIHM-EPELPASKEPPPLR--KVTRCYFEEGYLDTGVYLLEELMSQQSIPGPAIIIDNNSTNILSFFVTASVTEHGDVRVAVGRASPCTVG-PRLDAVQLSIFSHRFMSIA---GGVTQGSRAGS-----CGVTCGRAGVIWGLAGDTFG---HMGSF-GVVRGQIRNLGDDIKEGDVILSNHPCAGGSHLPDLTVITPVFRAGVDRPVFFVASRGHHADIGGITPGSMPPNSTTLQQEGAVFISFKLVKDGIFQEEAVTEALVAPSLVPGSSGTRNLQDNLSDLRAQVAANTRGIALVGQLMDAYGLATVQAYMQHIQNNAEVAVRQMLKEFALGLLAPGNEGPLRVEAEDHMDDGTPIRLSVEINPADGSAVFDFTGTGPEVKGNCNAPRAITLSALIYCLRSMVGQDIPLNQGCLFPVRVVIPEGSILSPSLGAAVVGGNVLTSQRIVDVIFRAFSVCAASQGCMNNITFGDEEVGYYETVAGGAGAGPHWSGRSGVHTHMTNTRITDPEILEKRYPVVLQKFALNAGTGGKGRHSGGDGVTRELLFRRPLLLSVLTERRSFEPYGLNGGAPGATGRNWFIRAN--GERLELEAKSSVSVQPGDTFCLQTPGGGGFGK 1193          
BLAST of 5-oxoprolinase vs. Ensembl Yeast
Match: OXP1 (5-oxoprolinase; enzyme is ATP-dependent and functions as a dimer; similar to mouse Oplah gene; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001698])

HSP 1 Score: 1119.76 bits (2895), Expect = 0.000e+0
Identity = 634/1317 (48.14%), Postives = 851/1317 (64.62%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGT--------LKLLSEDPENYNDAPFEAIRRIVE----KEV--GVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLN-----------PKCQLPVQGIISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYG-GHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVN-DFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCD-LLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSRTDLKGKYD---HFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSD---LDSNHLKSEEFVD-------VYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGV-NEEGDMDINIGNSSNLSEQRTEYDT--VQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEA-LQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFG---------DDDV---GYYETIAGGSGAGPS------WHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFG 3841
            AID+GGTFTD         IGT        +KLLS DP+NY DAP E IRR++E    K +  G+P      +D   +  +RMGTT+ATN  LER GE CA + T+GF+D L IG+Q+RP+IF+L I+    LY TV+E++ERV L +           P  Q   +GI+     E   +++ P +ES +R+ L+ L  SGIKSIA+A  HSY +P HE  +G IA E+ F  +SLSS++ PMIK +PR  +  ADAYLTP IKKY++S   G    +D + I FMQSDGGL    KF G ++ILSGPAGGVIGY+ T ++ +   P++GFDMGGTSTDVSRYG G LEH++E+VTAGI IQSPQLDI+TVAAGG S L ++  +G+F VGP+SA A PGP  YRK G LT+TDANL L R++ ++FPKIFGP E++ LD + +    +++T+ +N D N +L        ++E+VA GFI VANE M RP+R++T+ KG+  S+H L  FGGAGGQHA ++A  LG+  V IHR+S ILSA+G+ LADV+ E QEPC  +L      LK+ KR   L +N I+ L SQ F+  +I +E +LN+RY+GT+ +LM+          KYD   +F   F   +K EFGF  +++ IIIDDIR+R  G SG+   RKE   D   ++ +H K  +           YFDN ++ TAV+ ++ LP    I GPAI+ D   T ++ P+    + N    + IN   +  LS+   E D   + LSIFSHRFM IA QMG  L++TS+STN+KERLDFSCALF   G LVANAPH+PVHLG+M   +  Q +    K  PGDV+++NHP  GG+HLPD+TVITP F    E  IFY+A+R HHADIGG  PGS+PP+SK +YEEG    +  +VK  IFQE+ + +  ++ P +YPGCSGSR  SDNISDL+AQVAAN KG  L+  L  EY L  +  YM  IQ NA  +++ ML ++       +G ++ S ED +D G+ IKL+V I  ++   IF+F G+  Q  GNLN P A+ +S ++YCLRC+VG D+PLNQGCLKP+ + IP  S L+P   AAVVGGNVLTSQR+ DVI K F   A SQG  NN TFG         D  +   GYYETI GGSGAG        W+G   +HT+MTNTR+TD E+ E RYPV+L+ FS++RG+GG GK+TGG+GV R ++FR  +  S+L+ERRV  P+G++ G+ G +G N+ ++    +  I+VGGK ++   PGD   ++TPGGGGFG
Sbjct:    9 AIDKGGTFTDC-----VGNIGTGKQEHDTVIKLLSVDPKNYPDAPLEGIRRLLEVLEHKTIPRGIP------LDISNVRSLRMGTTLATNCALERNGERCAFITTKGFKDSLLIGDQTRPDIFNLNIKKVVPLYDTVVEIDERVTLEDFSEDPYFTKSSPNEQ---EGILEGNSGEMVRVIKKP-DESSVRSILKVLYASGIKSIAIAFLHSYTFPDHERIVGNIAREIGFSHVSLSSEVSPMIKFLPRAHSSVADAYLTPVIKKYLNSISAGLSHAED-THIQFMQSDGGLVDGGKFSGLKSILSGPAGGVIGYSSTCYDKNNNIPLIGFDMGGTSTDVSRYGDGRLEHVFETVTAGIIIQSPQLDIHTVAAGGSSILSWK--NGLFRVGPDSAAADPGPAAYRKGGPLTITDANLFLGRLVPEFFPKIFGPNEDESLDLETTTLKFRELTDVINKDLNSNL--------TMEEVAYGFIKVANECMARPVRAITEAKGHVVSQHRLVSFGGAGGQHAIAVADSLGIDTVLIHRYSSILSAYGIFLADVIEENQEPCSFILGEPETILKVKKRFLELSKNSIKNLLSQSFSREDIVLERYLNLRYEGTETSLMI--------LQKYDDQWNFREWFSEAHKKEFGFSFDDKRIIIDDIRIRAIGKSGV---RKEKTVDEQLIEISHFKKADVSKDASFTQKAYFDNKWVDTAVFKIDDLPAGTIIEGPAILADGTQTNIILPNSQATILNSHIFIKINQKAAKTLSKSGYELDIDPILLSIFSHRFMDIALQMGTQLRKTSVSTNVKERLDFSCALFDSKGNLVANAPHVPVHLGSMSTCISAQAKLWEGKLKPGDVLITNHPDIGGTHLPDITVITPSFSSTGEL-IFYVASRAHHADIGGILPGSVPPNSKELYEEGTAIYSELVVKEGIFQEELIYKLFVEDPGKYPGCSGSRRFSDNISDLKAQVAANTKGIQLIGSLTKEYDLATILKYMAAIQTNASESIKKMLAKM----VEHFGTTKFSGEDRLDDGSLIKLQVIIRPEKEEYIFNFDGTSPQVYGNLNAPEAITNSAILYCLRCLVGEDIPLNQGCLKPLTIKIPAGSLLSPRSGAAVVGGNVLTSQRVTDVILKTFNVMADSQGDCNNFTFGTGGNSGNKTDKQIKGFGYYETICGGSGAGADSWRGSGWNGSDAVHTNMTNTRMTDTEVFERRYPVLLKEFSIRRGSGGKGKYTGGNGVVRDVQFRKAVTASILSERRVIGPHGIKGGQDGSRGENLWVRHSTGAL-INVGGKNTIYAQPGDRFIIKTPGGGGFG 1282          
BLAST of 5-oxoprolinase vs. Ensembl Medaka
Match: oplah (5-oxoprolinase, ATP-hydrolysing [Source:NCBI gene;Acc:101169497])

HSP 1 Score: 1509.2 bits (3906), Expect = 0.000e+0
Identity = 770/1306 (58.96%), Postives = 962/1306 (73.66%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGI--ISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDF----------------NRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVS--GNSRTDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKDSTTELDSKAQCNRKISTMKGSVHNYHLQQ 3937
            AIDRGGTFTDV+ R    +   LKLLS DP+NY DAP E IRR++E+E G     +Q VD   I WIRMGTTVATNALLER+GE  ALL+T+GF+DLL+IG Q+RP +FDL++ +P++LY  VIEV+ERV+L    C LP++    +  G   + + V   L+  ++  DL+ +L  GI S+AV L HSY +  HE+ +G +A  L F Q+SLSS+IMPM++ VPRG+TV ADAYLTP I +Y+  F  GF G   +  +LFMQSDGGL+PM +F GSRA+LSGPAGGV+GYA T++N  + +P++GFDMGGTSTDVSRY G  EH++E+ TAG+ +Q+PQLDINTVAAGGGSRLFFR   G+F+VGPESAGAHPGP CYRK G LTVTDANL L R+L  +FPKIFGP E++PL  + + + +  +TEE+N F                  SL       MSVE+VA+GFI VANE+MCRPIR+LTQ KG+DTS+H+LACFGGAGGQHAC+IAR LGM+ VFIH++SGILSA+GLALADVV E QEPC L Y   +F ++ +R+E L + C + L ++GF    I  E FL++RY+GTDCALMV+  G        +   F  +F  RY  EFGF + +R I++DDIRVRG G SGI   +  Y   +    LK+      YF+ GY  T+VYL E+LP    I GPAIIIDKN TI+VEP C   + E GD+ + +G+  +     TE +TVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCA+FGPDGGLV+NAPHIPVHLGAMQ TVQYQ+R   NK   GDVILSNHP  GGSHLPDLTVITPVF+ G   P+F++A+RGHHADIGG TPGSMPPHS S+ +EGAVF +F +V   +FQE+ V EAL  P++YPGCSG+RN+ DN+SDLRAQVAAN++G  LV ELI+ YGL VVQ+YMGYIQ NAELAVR ML++       + G  E+ AEDFMD GT I+L+V I+ +EGSA+FDFTG+G +  GN N P A+  S LIYCLRCMVG D+PLNQGCL PI VIIP  S L P+++AAVVGGNVLTSQR+VDVIFKAF  C+ASQGCMNN++FG + VGYYET+AGG+GAGPSW+GRSG+H+HMTNTRITD EILE RYPVILE+FSL+ G+GG GK  GGDGV R L FR  ++LS+LTERR   PYGL+ GE+G  GLN+L ++D   R +++GGK S+ + PGD+  L TPGGGG+G  D+ ++  SK +   +    +GSV  Y + Q
Sbjct:   91 AIDRGGTFTDVFARLPDGRERVLKLLSRDPQNYKDAPTEGIRRVLEEETGQTFPRSQPVDTSLIGWIRMGTTVATNALLEREGERTALLVTKGFKDLLHIGTQARPKLFDLEVAMPDVLYEEVIEVDERVVLRQDDCALPMKETRRVVKGSTGDSLEVWGELDLEQVEKDLKGVLSRGISSLAVLLLHSYTWSDHEKAVGSLARRLGFTQVSLSSEIMPMVRAVPRGYTVCADAYLTPKIHQYLKGFTAGFKGGLKDVDVLFMQSDGGLTPMEQFCGSRAVLSGPAGGVVGYAITSYNQIEKKPVIGFDMGGTSTDVSRYAGQYEHVFEATTAGVTLQAPQLDINTVAAGGGSRLFFRS--GMFVVGPESAGAHPGPTCYRKGGPLTVTDANLALGRLLPSFFPKIFGPGEDEPLSLEETMEHLHHMTEEINLFLASNQSQADANGDTNSRNSLLENSQPKMSVEEVAMGFIRVANEAMCRPIRALTQAKGHDTSQHVLACFGGAGGQHACAIARSLGMKTVFIHKYSGILSAYGLALADVVEEVQEPCSLQYVQESFSELDRRMEQLSKRCHDTLCARGFKSDQITTEVFLHLRYEGTDCALMVTNAGYPSNAQSCRSGDFRSAFTKRYLKEFGFTIPDRPIMVDDIRVRGCGKSGI---KSVYEPKMGQRQLKAVTKTKCYFEGGYRDTSVYLWEELPLGQSIQGPAIIIDKNSTILVEPCCEAHLTEGGDVCMTVGSDPHCI-LGTELNTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCAVFGPDGGLVSNAPHIPVHLGAMQETVQYQIRAQGNKLREGDVILSNHPCAGGSHLPDLTVITPVFRTGVSGPVFFVASRGHHADIGGITPGSMPPHSNSLQQEGAVFVSFKLVTGGVFQEEAVTEALMAPAQYPGCSGTRNLHDNLSDLRAQVAANQRGSQLVGELIDTYGLAVVQAYMGYIQSNAELAVRDMLRDFARRWKQQTGALEVEAEDFMDDGTPIRLRVQINEEEGSAVFDFTGTGTEVWGNCNAPRAITLSALIYCLRCMVGQDIPLNQGCLAPISVIIPPGSILQPSQNAAVVGGNVLTSQRVVDVIFKAFEVCSASQGCMNNISFGSEKVGYYETVAGGAGAGPSWNGRSGVHSHMTNTRITDPEILEKRYPVILEQFSLRPGSGGAGKCRGGDGVIRKLLFRKPVVLSVLTERRATRPYGLKGGEAGAAGLNLLHRND--GRVLNLGGKTSVSLQPGDMFCLYTPGGGGYGTDDANSKPQSKRRRLNESFPERGSVFEYRMAQ 1388          
BLAST of 5-oxoprolinase vs. Planmine SMEST
Match: SMESG000025866.1 (SMESG000025866.1)

HSP 1 Score: 2591.99 bits (6717), Expect = 0.000e+0
Identity = 1281/1289 (99.38%), Postives = 1285/1289 (99.69%), Query Frame = 2
Query:   80 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGIISNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSRTDLKGKYDHFVWSFISRYKSEFGFILENRXXXXXXXRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRXXXXXXXXXXXXXVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKDSTTELDSKAQCNRKISTMKGSVHNYHLQQFSA 3946
            AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGIISNGRNEEKVIV+TPLNE KIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLG+RRVFIHRFSGILSAFGLALADVVCERQEPC LLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSRTDLKGKYDHFV SFISRYKSEFGFILENRDIIIDDIRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFF+VKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGI+TFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRGTGGMGKFTGGDGVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKDSTTELDSK QCNRKISTMKGSVHNYHLQQFSA
Sbjct:    6 AIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIVEKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFRDLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGIISNGRNEEKVIVQTPLNEIKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEEKIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSFKEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTFNSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTVAAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSRILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMSVEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSIARKLGIRRVFIHRFSGILSAFGLALADVVCERQEPCGLLYNSNNFLKIIKRIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSRTDLKGKYDHFVCSFISRYKSEFGFILENRDIIIDDIRVRGSGLSGIDISRKEYLSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKNCTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMSIAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQGTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPIFYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFLVKNSIFQEKEVIEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLEVVQSYMGYIQDNAELAVRSMLKEIGIATFSKYGVSELSAEDFMDTGTKIKLKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDVPLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGACAASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITDLEILESRYPVILERFSLKRGTGGMGKFTGGDGVERWLKFRSKMMLSLLTERRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKLQTPGGGGFGNKDSTTELDSKPQCNRKISTMKGSVHNYHLQQFSA 1294          
The following BLAST results are available for this feature:
BLAST of 5-oxoprolinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
OPLAH0.000e+058.945-oxoprolinase, ATP-hydrolysing [Source:HGNC Symbo... [more]
OPLAH2.890e-4561.365-oxoprolinase, ATP-hydrolysing [Source:HGNC Symbo... [more]
back to top
BLAST of 5-oxoprolinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Y38F2AR.120.000e+056.09pep chromosome:WBcel235:IV:2399515:2412410:-1 gene... [more]
Y38F2AR.120.000e+057.11pep chromosome:WBcel235:IV:2399515:2409831:-1 gene... [more]
Y38F2AR.120.000e+059.24pep chromosome:WBcel235:IV:2399515:2403143:-1 gene... [more]
back to top
BLAST of 5-oxoprolinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG47520.000e+056.54gene:FBgn0034733 transcript:FBtr0071832[more]
back to top
BLAST of 5-oxoprolinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
oplah0.000e+059.665-oxoprolinase, ATP-hydrolysing [Source:ZFIN;Acc:Z... [more]
oplah0.000e+059.665-oxoprolinase, ATP-hydrolysing [Source:ZFIN;Acc:Z... [more]
oplah0.000e+057.955-oxoprolinase, ATP-hydrolysing [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of 5-oxoprolinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oplah0.000e+061.275-oxoprolinase, ATP-hydrolysing [Source:NCBI gene;... [more]
oplah0.000e+061.355-oxoprolinase, ATP-hydrolysing [Source:NCBI gene;... [more]
oplah0.000e+058.735-oxoprolinase, ATP-hydrolysing [Source:NCBI gene;... [more]
oplah0.000e+058.115-oxoprolinase, ATP-hydrolysing [Source:NCBI gene;... [more]
oplah0.000e+058.695-oxoprolinase, ATP-hydrolysing [Source:NCBI gene;... [more]
back to top
BLAST of 5-oxoprolinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Oplah0.000e+058.455-oxoprolinase (ATP-hydrolysing) [Source:MGI Symbo... [more]
Oplah0.000e+058.455-oxoprolinase (ATP-hydrolysing) [Source:MGI Symbo... [more]
Oplah0.000e+057.265-oxoprolinase (ATP-hydrolysing) [Source:MGI Symbo... [more]
Oplah6.091e-3961.215-oxoprolinase (ATP-hydrolysing) [Source:MGI Symbo... [more]
Oplah4.047e-1165.125-oxoprolinase (ATP-hydrolysing) [Source:MGI Symbo... [more]
back to top
BLAST of 5-oxoprolinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O14841|OPLA_HUMAN0.000e+058.945-oxoprolinase OS=Homo sapiens OX=9606 GN=OPLAH PE... [more]
sp|P97608|OPLA_RAT0.000e+059.175-oxoprolinase OS=Rattus norvegicus OX=10116 GN=Op... [more]
sp|Q8K010|OPLA_MOUSE0.000e+058.455-oxoprolinase OS=Mus musculus OX=10090 GN=Oplah P... [more]
sp|Q75WB5|OPLA_BOVIN0.000e+058.595-oxoprolinase OS=Bos taurus OX=9913 GN=OPLAH PE=1... [more]
sp|Q54NW6|OPLA_DICDI0.000e+054.335-oxoprolinase OS=Dictyostelium discoideum OX=4468... [more]
back to top
BLAST of 5-oxoprolinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B6ZGC50.000e+062.16Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A2T7NJY70.000e+060.49Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2J7QAU60.000e+059.775-oxoprolinase OS=Cryptotermes secundus OX=105785 ... [more]
A0A3P9A6I80.000e+059.655-oxoprolinase, ATP-hydrolysing OS=Esox lucius OX=... [more]
A0A1W5BMF90.000e+060.925-oxoprolinase isoform X1 OS=Ciona intestinalis OX... [more]
back to top
BLAST of 5-oxoprolinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oplah0.000e+060.465-oxoprolinase, ATP-hydrolysing [Source:NCBI gene;... [more]
back to top
BLAST of 5-oxoprolinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001311.10.000e+056.35pep scaffold:Pmarinus_7.0:GL479305:213649:244651:1... [more]
back to top
BLAST of 5-oxoprolinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
OXP10.000e+048.145-oxoprolinase; enzyme is ATP-dependent and functi... [more]
back to top
BLAST of 5-oxoprolinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 5-oxoprolinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oplah0.000e+058.965-oxoprolinase, ATP-hydrolysing [Source:NCBI gene;... [more]
back to top
BLAST of 5-oxoprolinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000025866.10.000e+099.38SMESG000025866.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004785 ID=SMED30004785|Name=5-oxoprolinase|organism=Schmidtea mediterranea sexual|type=transcript|length=3999bp
GTCAAACTTGATTAAAGTTTATTTTGAATATTAAATTATTTTACTCATTA
AATTATCTTTATTGATGAAGTTGCAAATTGCAATCGATAGAGGCGGTACA
TTTACAGATGTTTGGTACAGAACGTCTTGCAATAAAATAGGAACACTGAA
ATTACTAAGTGAAGATCCTGAAAATTATAATGATGCCCCGTTTGAAGCTA
TCAGACGAATTGTGGAAAAGGAAGTTGGAGTTCCACAGCAGTCTAATCAA
AAAGTCGATTTCAAATACATTGAGTGGATTCGCATGGGTACAACTGTCGC
TACAAATGCTTTGCTGGAACGCAAAGGAGAACCGTGCGCTCTGTTAATTA
CTGAAGGTTTCAGAGATTTACTATATATTGGTAATCAATCTAGGCCAAAT
ATTTTTGATTTGAAAATTGAAGTACCAGAAATGTTGTATTCGACGGTTAT
TGAAGTTGAAGAGCGCGTTATTCTTTTAAATCCTAAATGTCAACTACCTG
TTCAAGGAATCATATCAAACGGAAGAAACGAAGAAAAAGTTATTGTTCGA
ACTCCTCTCAATGAAAGTAAAATTCGAAATGATCTTCAAAAGTTGCTCGA
TTCTGGAATCAAATCCATAGCTGTAGCATTAGCGCATTCATACATTTATC
CATTTCACGAAGAAAAGATAGGGAAAATAGCAGCAGAGTTAAAATTTAAA
CAAATATCCTTATCATCACAGATTATGCCCATGATAAAGTTAGTGCCGAG
AGGTTTCACGGTTACTGCAGACGCCTATTTGACACCATGTATAAAAAAAT
ATATAGATAGTTTTAAAGAGGGTTTCATTGGACTGGATGATAATTCTCCA
ATATTGTTCATGCAATCAGACGGCGGATTATCACCAATGAGCAAATTCCT
GGGTTCAAGAGCTATTTTATCTGGTCCGGCCGGCGGAGTTATTGGATACG
CTAAAACAACTTTCAACTCAGATAAATGCCAGCCAATTGTTGGATTTGAT
ATGGGAGGAACATCGACAGATGTTAGTCGATACGGAGGTCATTTAGAACA
TATATATGAATCAGTAACCGCAGGAATTCCTATACAATCCCCCCAGTTGG
ATATAAACACTGTAGCGGCTGGTGGAGGAAGTCGGTTGTTCTTTAGGAAA
TCCGATGGAATATTTTTAGTTGGACCGGAATCGGCAGGTGCTCATCCTGG
ACCAATTTGCTATAGGAAATGTGGTTATTTGACTGTCACTGATGCAAACT
TAGTCCTCAGCCGGATACTCTGTAAATATTTTCCGAAAATATTTGGTCCT
AAAGAAAACCAGCCACTCGATTTTGATGCATCCTATAAGGCCATGAAGGA
TATTACCGAAGAGGTCAATGATTTCAATAGAAGTCTCAAAGGTGAAGATT
TCAAATCGATGTCAGTGGAACAAGTGGCACTGGGATTCATTCACGTTGCA
AATGAGAGTATGTGTAGACCGATACGATCGCTTACTCAAGGCAAGGGTTA
TGACACTTCAAAACATATATTGGCATGTTTTGGAGGAGCTGGTGGACAAC
ATGCTTGCTCGATTGCTCGAAAGTTGGGAATGCGTAGAGTTTTCATACAT
AGATTTAGTGGAATATTATCAGCATTTGGCTTGGCTTTAGCTGACGTTGT
TTGTGAACGTCAAGAACCTTGTGATTTGCTTTATAACTCGAATAACTTTT
TAAAAATTATTAAAAGAATTGAAAACCTACAGGAAAACTGCATCGAGGAA
TTGGAATCTCAGGGATTTAATGAACATAACATCCAGATTGAACCTTTTTT
AAATATGCGCTACAAAGGTACAGACTGTGCCTTGATGGTGAGTGGCAACT
CTCGTACCGATTTGAAAGGCAAATATGACCATTTTGTTTGGTCGTTTATT
AGTAGATATAAATCCGAGTTTGGATTCATTTTAGAAAATCGCGACATAAT
AATTGATGATATTCGAGTTAGGGGGTCAGGCTTATCAGGAATAGATATCA
GCAGAAAGGAATATTTATCTGATCTAGACTCAAATCATTTGAAAAGTGAA
GAATTCGTTGATGTTTACTTTGACAATGGCTACATAACCACAGCGGTTTA
CCTTTTAGAAAAGCTCCCTAAAAACTTATTTATTTCTGGGCCAGCAATTA
TAATTGACAAGAACTGTACGATTGTTGTGGAACCGGATTGTGTATTTGGT
GTCAATGAAGAAGGAGACATGGATATCAATATTGGTAATAGTTCCAATCT
TTCAGAACAACGAACCGAATATGATACAGTCCAATTAAGTATTTTCTCAC
ATCGTTTTATGAGTATAGCTGAACAAATGGGCCGGGTGTTACAACGAACA
TCAATATCGACAAATATTAAGGAACGTTTGGATTTTTCATGTGCTTTATT
CGGACCTGATGGAGGACTAGTGGCTAATGCTCCTCATATTCCTGTGCATT
TGGGTGCTATGCAAGGAACTGTTCAGTATCAAATGAGATATTTGAATAAT
AAGTTTTCACCCGGTGATGTCATTTTAAGTAACCATCCTCAAACCGGTGG
AAGCCATTTGCCGGATTTAACTGTAATTACACCAGTATTTCAAAAAGGCT
CCGAGTATCCGATATTTTATCTCGCAAATCGAGGTCATCACGCCGACATT
GGGGGCTCAACACCAGGTTCTATGCCGCCTCATTCGAAAAGTATTTATGA
AGAAGGTGCTGTCTTTAAAACTTTCTTTATAGTAAAAAATAGCATTTTTC
AAGAAAAAGAGGTTATTGAAGCTCTTCAATATCCATCGAGATATCCTGGA
TGTAGCGGGTCCAGGAACATATCTGATAATATCAGTGATCTAAGAGCCCA
AGTTGCGGCTAATGAAAAGGGTCGCTTTCTAGTTTCAGAGTTAATCAATG
AATATGGACTTGAGGTTGTCCAGTCCTATATGGGATATATTCAGGATAAT
GCAGAACTTGCTGTTAGAAGCATGCTCAAAGAAATTGGTATATCGACATT
CTCAAAATATGGAGTTAGCGAATTGTCTGCGGAAGATTTCATGGATACAG
GAACAAAAATCAAATTGAAAGTATCGATAGATAATGATGAAGGAAGTGCA
ATATTTGATTTCACAGGATCAGGATATCAAACAACTGGTAACCTGAATAC
CCCCTCAGCGGTTATTCACTCGTGTTTAATATACTGTTTGCGGTGCATGG
TAGGACACGACGTCCCACTGAACCAAGGATGTCTCAAACCAATTAAAGTA
ATAATTCCTGAAGATAGCTTTTTAAATCCAACCGAAGATGCTGCTGTAGT
TGGTGGTAACGTGCTAACTTCTCAAAGAATAGTCGATGTTATTTTTAAGG
CTTTCGGAGCATGTGCAGCATCCCAAGGTTGTATGAATAACGTCACTTTC
GGCGACGATGATGTTGGCTATTATGAAACAATAGCAGGTGGGTCTGGAGC
TGGACCTTCATGGCATGGTCGAAGTGGTATCCATACGCACATGACAAATA
CTCGAATTACTGATTTGGAAATTCTCGAAAGTCGCTATCCTGTAATTCTC
GAGAGGTTTTCATTGAAACGTGGCACTGGCGGCATGGGTAAATTTACCGG
TGGCGATGGAGTTGAACGATGGTTGAAATTCCGAAGTAAAATGATGTTAA
GTTTGTTAACAGAAAGGCGAGTTTTTGCTCCGTATGGATTAGAAAATGGT
GAATCCGGTGAAAAAGGCTTAAATATATTAATCAAATCTGATAAACCTTC
AAGAAAAATTGACGTTGGAGGGAAGGTATCGTTAGAAATTAATCCAGGCG
ATGTGTTAAAGCTTCAAACTCCAGGAGGAGGAGGTTTCGGAAATAAAGAT
TCTACAACAGAATTAGATTCAAAAGCTCAATGTAATAGAAAAATTTCCAC
AATGAAAGGAAGTGTTCATAACTACCATTTGCAACAGTTTTCTGCTTAAG
GTTCTTTTGAATACAGATATTTTTTGATTAAAAAAAAAGATCGGAAGAG
back to top

protein sequence of SMED30004785-orf-1

>SMED30004785-orf-1 ID=SMED30004785-orf-1|Name=SMED30004785-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1295bp
MKLQIAIDRGGTFTDVWYRTSCNKIGTLKLLSEDPENYNDAPFEAIRRIV
EKEVGVPQQSNQKVDFKYIEWIRMGTTVATNALLERKGEPCALLITEGFR
DLLYIGNQSRPNIFDLKIEVPEMLYSTVIEVEERVILLNPKCQLPVQGII
SNGRNEEKVIVRTPLNESKIRNDLQKLLDSGIKSIAVALAHSYIYPFHEE
KIGKIAAELKFKQISLSSQIMPMIKLVPRGFTVTADAYLTPCIKKYIDSF
KEGFIGLDDNSPILFMQSDGGLSPMSKFLGSRAILSGPAGGVIGYAKTTF
NSDKCQPIVGFDMGGTSTDVSRYGGHLEHIYESVTAGIPIQSPQLDINTV
AAGGGSRLFFRKSDGIFLVGPESAGAHPGPICYRKCGYLTVTDANLVLSR
ILCKYFPKIFGPKENQPLDFDASYKAMKDITEEVNDFNRSLKGEDFKSMS
VEQVALGFIHVANESMCRPIRSLTQGKGYDTSKHILACFGGAGGQHACSI
ARKLGMRRVFIHRFSGILSAFGLALADVVCERQEPCDLLYNSNNFLKIIK
RIENLQENCIEELESQGFNEHNIQIEPFLNMRYKGTDCALMVSGNSRTDL
KGKYDHFVWSFISRYKSEFGFILENRDIIIDDIRVRGSGLSGIDISRKEY
LSDLDSNHLKSEEFVDVYFDNGYITTAVYLLEKLPKNLFISGPAIIIDKN
CTIVVEPDCVFGVNEEGDMDINIGNSSNLSEQRTEYDTVQLSIFSHRFMS
IAEQMGRVLQRTSISTNIKERLDFSCALFGPDGGLVANAPHIPVHLGAMQ
GTVQYQMRYLNNKFSPGDVILSNHPQTGGSHLPDLTVITPVFQKGSEYPI
FYLANRGHHADIGGSTPGSMPPHSKSIYEEGAVFKTFFIVKNSIFQEKEV
IEALQYPSRYPGCSGSRNISDNISDLRAQVAANEKGRFLVSELINEYGLE
VVQSYMGYIQDNAELAVRSMLKEIGISTFSKYGVSELSAEDFMDTGTKIK
LKVSIDNDEGSAIFDFTGSGYQTTGNLNTPSAVIHSCLIYCLRCMVGHDV
PLNQGCLKPIKVIIPEDSFLNPTEDAAVVGGNVLTSQRIVDVIFKAFGAC
AASQGCMNNVTFGDDDVGYYETIAGGSGAGPSWHGRSGIHTHMTNTRITD
LEILESRYPVILERFSLKRGTGGMGKFTGGDGVERWLKFRSKMMLSLLTE
RRVFAPYGLENGESGEKGLNILIKSDKPSRKIDVGGKVSLEINPGDVLKL
QTPGGGGFGNKDSTTELDSKAQCNRKISTMKGSVHNYHLQQFSA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004170WWE-dom
IPR008040Hydant_A_N
IPR002821Hydantoinase_A
IPR003692Hydantoinase_B
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0003824catalytic activity
GO:00171685-oxoprolinase (ATP-hydrolyzing) activity
GO:0000166nucleotide binding
GO:0005524ATP binding
Vocabulary: biological process
TermDefinition
GO:0006749glutathione metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003692Hydantoinase B/oxoprolinasePFAMPF02538Hydantoinase_Bcoord: 737..1260
e-value: 1.0E-210
score: 700.6
IPR002821Hydantoinase A/oxoprolinasePFAMPF01968Hydantoinase_Acoord: 229..530
e-value: 2.9E-96
score: 322.2
IPR008040Hydantoinaseoxoprolinase, N-terminalPFAMPF05378Hydant_A_Ncoord: 5..208
e-value: 3.2E-55
score: 186.6
NoneNo IPR availablePANTHERPTHR11365:SF25-OXOPROLINASEcoord: 2..1261
NoneNo IPR availablePANTHERPTHR113655-OXOPROLINASE RELATEDcoord: 2..1261