DnaJ heat shock protein family (Hsp40) member C13

Overview
NameDnaJ heat shock protein family (Hsp40) member C13
Smed IDSMED30004783
Length (bp)7422
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DnaJ heat shock protein family (Hsp40) member C13 (SMED30004783) t-SNE clustered cells

Violin plots show distribution of expression levels for DnaJ heat shock protein family (Hsp40) member C13 (SMED30004783) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DnaJ heat shock protein family (Hsp40) member C13 (SMED30004783) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DnaJ heat shock protein family (Hsp40) member C13 (SMED30004783) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004783

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30004783SMESG000061705.1 dd_Smed_v4_2579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30004783SMESG000061705.1 dd_Smed_v4_2579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004783SMESG000061705.1 dd_Smed_v4_2579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30004783SMESG000061705.1 dd_Smed_v6_2579_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004783SMESG000061705.1 dd_Smed_v4_2579_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Human
Match: DNAJC13 (DnaJ heat shock protein family (Hsp40) member C13 [Source:HGNC Symbol;Acc:HGNC:30343])

HSP 1 Score: 1326.61 bits (3432), Expect = 0.000e+0
Identity = 692/1426 (48.53%), Postives = 979/1426 (68.65%), Query Frame = 2
Query: 2876 IRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNR-AKLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYF-KNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEA-GLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVE---TAGYLTSFAQNTP 7135
            I++SYEFF++LY RFL   K  MKC+CL A++IVYGRCH+EIGP  D    I +LER T++LERDRL+L L KLI+NK N++ ++D+NGIR+LVDL+T+AH+HV+RA +P QSNVIEAA D + + +   KEW++   +KE+ GP  F E+ +L  +G +    + WAQG+D WR   S+PQ++W    L +GQAV   +++A+  L++L+ +C  +PS+DQ   IIRP+P+ K+ ++    L HI+QLLLTFDP LVEK+A+LL  +  +NP   RLY++GVF+FI+MY GSNVL +A FLK TH  QAF+++E+ K  +I  RSI+G+ILPEAM+C+LEN+  E+F++I+LG++DTPE IW+SEMRR MIEKIA HL +FTPRL SN RA YQY  IPII+YPQLENELFC  YYL+ LCDT+RFPDWPI+ PV LL+D L AWK E+EKKPP MS+ +AYEVL L         Q     +ES IRKAYF+L+ KYHPD+NP+GR+ FEK+N AY+FLC + AK+  GPDP+NI L+LK+QSILF R +++++ +KY+GYPMLI+TI  ET D+ LF KE+PLL    ELA+HTVN SALNAEELRR++G++ LQ AFSRCV ++T +S  SD SV+VCGYI+  +SVAAQFE CR++I E+P I +DL R+LYF K++P++++L   CV+  + D WLQT +F+ G +++LL ++F +DYTLEE G+ +SEE ++QE+ N LA L++ A++RL G + EE       +PEN  +R+ L  MLTPY+ RK+A     + S+  ILK+L SN+E+PYL W+N TR+EL ++LESQQE++IK  +CD  +G+EF +S + KELI+GE+F+R+YNE   F LE P++F   LL ++ S+ +Y+            T +  ++     + +   R  +++ AL AL NVI  NP    + IGHFK++FSL+       +Q+ A+EVV  VTS+++C+ +I  S VL  L+ LL SL S+  L+L+T+  + S T ++KE + +G LIY L + C+S    V+   A L  KM  DKL+G ++R  L++FLP +F+D+M+DNPE  VH+++  HENPELIWN+++R  +ST V E    +F+ Q+ +    W +P+DF V +       L+VGGV+L ++++ P W LR P EF         + + +     +   E LE  T A   L ++   L D++P  G++ KV Q +N  + + P  K+ + + + +S ++LCV  MA++ETI PLM  MK R D +GLA E + R+FQ    EL+AQA+K  LV Y+L LLE  GL N+  P   KA  VKALKAM RS  +G QV  +L  SS+WS FKDQ HDL+++ + Q AGYLTG  V    TAG  TS   N P
Sbjct:  847 IKRSYEFFNELYHRFLLTPKVNMKCLCLQALAIVYGRCHEEIGPFTDTRYIIGMLERCTDKLERDRLILFLNKLILNKKNVKDLMDSNGIRILVDLLTLAHLHVSRATVPLQSNVIEAAPDMKRESE---KEWYFGNADKERSGPYGFHEMQELWTKGMLNAKTRCWAQGMDGWRPLQSIPQLKWC--LLASGQAVLNETDLATLILNMLITMCGYFPSRDQDNAIIRPLPKVKRLLSDSTCLPHIIQLLLTFDPILVEKVAILLYHIMQDNPQLPRLYLSGVFFFIMMYTGSNVLPVARFLKYTHTKQAFKSEET-KGQDIFQRSILGHILPEAMVCYLENYEPEKFSEIFLGEFDTPEAIWSSEMRRLMIEKIAAHLADFTPRLQSNTRALYQYCPIPIINYPQLENELFCNIYYLKQLCDTLRFPDWPIKDPVKLLKDTLDAWKKEVEKKPPMMSIDDAYEVLNLP--------QGQGPHDESKIRKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSAKIVDGPDPENIILILKTQSILFNRHKEDLQPYKYAGYPMLIRTITMETSDDLLFSKESPLLPAATELAFHTVNCSALNAEELRRENGLEVLQEAFSRCVAVLTRASKPSDMSVQVCGYISKCYSVAAQFEECREKITEMPSIIKDLCRVLYFGKSIPRVAALGVECVSSFAVDFWLQTHLFQAGILWYLLGFLFNYDYTLEESGIQKSEETNQQEVANSLAKLSVHALSRLGGYLAEEQA-----TPENPTIRKSLAGMLTPYVARKLA-----VASVTEILKMLNSNTESPYLIWNNSTRAELLEFLESQQENMIKKGDCDKTYGSEFVYSDHAKELIVGEIFVRVYNEVPTFQLEVPKAFAASLLDYIGSQAQYLH-----------TFMAITHAAKVESEQHGDRLPRVEMALEALRNVIKYNPGSESECIGHFKLIFSLLRVHGAGQVQQLALEVVNIVTSNQDCVNNIAESMVLSSLLALLHSLPSSRQLVLETLYALTSSTKIIKEAMAKGALIYLLDMFCNSTHPQVRAQTAELFAKMTADKLIGPKVRITLMKFLPSVFMDAMRDNPEAAVHIFEGTHENPELIWNDNSRDKVSTTVREMMLEHFKNQQDNPEANWKLPEDFAVVFGEAEG-ELAVGGVFLRIFIAQPAWVLRKPREF----LIALLEKLTELLEKNNPHGETLETLTMATVCLFSAQPQLADQVPPLGHLPKVIQAMNHRNNAIP--KSAIRVIHALSENELCVRAMASLETIGPLMNGMKKRADTVGLACEAINRMFQKEQSELVAQALKADLVPYLLKLLEGIGLENLDSPAATKAQIVKALKAMTRSLQYGEQVNEILCRSSVWSAFKDQKHDLFISES-QTAGYLTGPGVAGYLTAGTSTSVMSNLP 2229          

HSP 2 Score: 832.017 bits (2148), Expect = 0.000e+0
Identity = 425/873 (48.68%), Postives = 577/873 (66.09%), Query Frame = 2
Query:   32 MNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTH------MQEIQRKNKEAWRIVEK----KIDNLLMHWRSKIGINMKPMKDKDEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVG 2620
            + +N D  C+  TKH+WRG YKR+ ++G+  ITTY+  TL+VTNQWPY +ICSI P  K  +  +F L  R+   KK + ++FS++ R  +L EA+ +   F E      + N  K  W++   PVILEV      QI+P T+RV+  Y Y++IE    +SD+  GF I   GFSRLH+F +  R+E I++  + A N + I L   KE +  +  L  R GKYS DE ITS AEF+VQK++        PV+R+L LTETCLVERDP TY + TL+PL ++FAL+ D + PQ F IE++ G  R Y ST+RDSLLASLLDG R+SGNRDVCVKM  T +  R+G L +P++EEVES H++ L   P G  F +AVFRFNAN+SYSG+LHAVTQ+GLF+ENKEKLI  A++AL+++EG+    +A+ LE+QF A+RRLVASKAGF AFTQL K RE LG KVV AL+R+N  + HAA+D + AL+ PMH++YD+RQEQLNKAS++SS KFL+NLL+ F+ HV  GTGALVIS +LDFLTF +C PY ET++G+ FD LL++V+  GR +FKLF HPS+AI+KGA L+M+A+I+E D  +   MQ LAL+EGALP+HL  + F  ++DQR L  RQL+R L+ LW   N  A  LLKR+LPPGL+ YL S++  P  + D +  RDN+++A         + E QR   +A + VEK    K+D +LMHWR ++GI  K  ++ ++KPV LRKRR+RIK+  NW +F+Y+F QDHA+ NL+WN KTREE +D LE E+  F  +R+                                        +  A  +SWN+ EF++ Y CL  EIK+G
Sbjct:    4 IRENKDLACFYTTKHSWRGKYKRVFSVGTHAITTYNPNTLEVTNQWPYGDICSISPVGKG-QGTEFNLTFRKGSGKKSETLKFSTEHRTELLTEALRFRTDFSEGKITGRRYNCYKHHWSDSRKPVILEVTPGGFDQINPATNRVLCSYDYRNIEGFVDLSDYQGGFCILYGGFSRLHLFASEQREEIIKSAIDHAGNYIGISLRIRKEPLEFEQYLNLRFGKYSTDESITSLAEFVVQKISPRH---SEPVKRVLALTETCLVERDPATYNIATLKPLGEVFALVCDSENPQLFTIEFIKGQVRKYSSTERDSLLASLLDGVRASGNRDVCVKMTPTHKGQRWGLLSMPVDEEVESLHLRFLATPPNG-NFADAVFRFNANISYSGVLHAVTQDGLFSENKEKLINNAITALLSQEGDVVASNAE-LESQFQAVRRLVASKAGFLAFTQLPKFRERLGVKVVKALKRSNNGIIHAAVDMLCALMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFNSHVDHGTGALVISSLLDFLTFALCAPYSETTEGQQFDMLLEMVASNGRTLFKLFQHPSMAIIKGAGLVMKAIIEEGDKEIATKMQELALSEGALPRHLHTAMFTISSDQRMLTNRQLSRHLVGLWTADNATATNLLKRILPPGLLAYLESSDLVPEKDADRMHVRDNVKIAMDQYGKFNKVPEWQRLAGKAAKEVEKFAKEKVDLVLMHWRDRMGIAQK--ENINQKPVVLRKRRQRIKIEANWDLFYYRFGQDHARSNLIWNFKTREELKDTLESEMRAFNIDRE----------------------------------------LGSANVISWNHHEFEVKYECLAEEIKIG 828          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Human
Match: DNAJC13 (DnaJ heat shock protein family (Hsp40) member C13 [Source:HGNC Symbol;Acc:HGNC:30343])

HSP 1 Score: 672.544 bits (1734), Expect = 0.000e+0
Identity = 333/631 (52.77%), Postives = 446/631 (70.68%), Query Frame = 2
Query:   32 MNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSL 1924
            + +N D  C+  TKH+WRG YKR+ ++G+  ITTY+  TL+VTNQWPY +ICSI P  K  +  +F L  R+   KK + ++FS++ R  +L EA+ +   F E      + N  K  W++   PVILEV      QI+P T+RV+  Y Y++IE    +SD+  GF I   GFSRLH+F +  R+E I++  + A N + I L   KE +  +  L  R GKYS DE ITS AEF+VQK++        PV+R+L LTETCLVERDP TY + TL+PL ++FAL+ D + PQ F IE++ G  R Y ST+RDSLLASLLDG R+SGNRDVCVKM  T +  R+G L +P++EEVES H++ L   P G  F +AVFRFNAN+SYSG+LHAVTQ+GLF+ENKEKLI  A++AL+++EG+    +A+ LE+QF A+RRLVASKAGF AFTQL K RE LG KVV AL+R+N  + HAA+D + AL+ PMH++YD+RQEQLNKAS++SS KFL+NLL+ F+ HV  GTGALVIS +LDFLTF +C PY ET++G+ FD LL++V+  GR +FKLF HPS+AI+KGA L+M+A+I+E D  +   MQ LAL+EGALP+HL  + F  ++DQR L
Sbjct:    4 IRENKDLACFYTTKHSWRGKYKRVFSVGTHAITTYNPNTLEVTNQWPYGDICSISPVGKG-QGTEFNLTFRKGSGKKSETLKFSTEHRTELLTEALRFRTDFSEGKITGRRYNCYKHHWSDSRKPVILEVTPGGFDQINPATNRVLCSYDYRNIEGFVDLSDYQGGFCILYGGFSRLHLFASEQREEIIKSAIDHAGNYIGISLRIRKEPLEFEQYLNLRFGKYSTDESITSLAEFVVQKISPRH---SEPVKRVLALTETCLVERDPATYNIATLKPLGEVFALVCDSENPQLFTIEFIKGQVRKYSSTERDSLLASLLDGVRASGNRDVCVKMTPTHKGQRWGLLSMPVDEEVESLHLRFLATPPNG-NFADAVFRFNANISYSGVLHAVTQDGLFSENKEKLINNAITALLSQEGDVVASNAE-LESQFQAVRRLVASKAGFLAFTQLPKFRERLGVKVVKALKRSNNGIIHAAVDMLCALMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFNSHVDHGTGALVISSLLDFLTFALCAPYSETTEGQQFDMLLEMVASNGRTLFKLFQHPSMAIIKGAGLVMKAIIEEGDKEIATKMQELALSEGALPRHLHTAMFTISSDQRML 628          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Human
Match: DNAJC13 (DnaJ heat shock protein family (Hsp40) member C13 [Source:HGNC Symbol;Acc:HGNC:30343])

HSP 1 Score: 128.257 bits (321), Expect = 6.138e-33
Identity = 58/134 (43.28%), Postives = 92/134 (68.66%), Query Frame = 2
Query: 3134 ANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSK 3535
            +NGIR+LVDL+T+AH+HV+RA +P QSNVIEAA D + + +   KEW++   +KE+ GP  F E+ +L  +G +    + WAQG+D WR   S+PQ++W    L +GQAV   +++A+  L++L+ +C  +PS+
Sbjct:   30 SNGIRILVDLLTLAHLHVSRATVPLQSNVIEAAPDMKRESE---KEWYFGNADKERSGPYGFHEMQELWTKGMLNAKTRCWAQGMDGWRPLQSIPQLKW--CLLASGQAVLNETDLATLILNMLITMCGYFPSR 158          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Human
Match: DNAJC13 (DnaJ heat shock protein family (Hsp40) member C13 [Source:HGNC Symbol;Acc:HGNC:30343])

HSP 1 Score: 82.8037 bits (203), Expect = 4.447e-18
Identity = 45/80 (56.25%), Postives = 54/80 (67.50%), Query Frame = 2
Query: 6854 LVEYVLGLLEA-GLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRS 7090
            LV Y+L LLE  GL N+  P   KA  VKALKAM RS  +G QV  +L  SS+WS FKDQ HDL+++ + Q AGYLTG S
Sbjct:    2 LVPYLLKLLEGIGLENLDSPAATKAQIVKALKAMTRSLQYGEQVNEILCRSSVWSAFKDQKHDLFISES-QTAGYLTGVS 80          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Human
Match: DNAJA4 (DnaJ heat shock protein family (Hsp40) member A4 [Source:HGNC Symbol;Acc:HGNC:14885])

HSP 1 Score: 48.9062 bits (115), Expect = 5.662e-6
Identity = 25/60 (41.67%), Postives = 39/60 (65.00%), Query Frame = 2
Query: 4307 QTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRAKLWSGPDPKNIY 4486
            + S + EE  I+KAY +L++KYHPD+NPD  E+F+ I+ AY+ L       S P  +++Y
Sbjct:   14 KPSASPEE--IKKAYRKLALKYHPDKNPDEGEKFKLISQAYEVL-------SDPKKRDVY 64          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Celegans
Match: rme-8 (Endocytosis protein RME-8; Receptor Mediated Endocytosis [Source:UniProtKB/TrEMBL;Acc:G5ED36])

HSP 1 Score: 999.194 bits (2582), Expect = 0.000e+0
Identity = 567/1430 (39.65%), Postives = 861/1430 (60.21%), Query Frame = 2
Query: 2876 IRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWS-------NSKLYTGQAVF-----TFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRAKLWSG-PDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQK-ETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKS-NVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPD--DFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEAGLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLT 7114
            I    EFF+++Y RFL   K +MKC+CL AM+I Y R H  IG   D + F+ +L++  N LERD L+LLL KL +NK+N+  +I +N + +LVDL  +AH+HV RA +  Q+NVIEA+  A+   +   +EW+Y +K+ +Q+GPLSF+++  L+ E TI    ++WA G+D+W S A+VPQ RW+        +++ TG+  F      F++++   L  ++ +C  +PS+D    ++RPMP  KKQ+T+PVLL  +VQLLLT++P +V+++ALLL +V  +NP+  RLY++GVFYFILMY GSNVL IA FL  THM QAFR+     E     +S++  +LPEA   +LE +  E++A+++LG++D PE IWN+ MRR +IE+IA H+ +F+ RL SN RA YQ+  IP+I YP+L  ELFC  YYLRHLC+  RFPDW IR P+  LR  L  W NE+EKKP +MSV  A E+L +    +L++++    ++ + IR+ Y++L+ KYHPD+NP+GRE FE+IN AY+ L +     SG PD   I L L++QSI++ R  +E+  +KY+GY  LIKTI  E +DE LF K    LL    ELA +T+  SALNAE+LRR +G++AL  AF RCV ++T SS   D +VRVC ++   F+ AA FEACRQR+ E+P I   L RLL F NLP+LS+   +C+  ++ D  LQ  +F+ G ++ L+P++F FDYTL+EGGV  SE+++KQ + N LA  +  A+  LAG    EN      +P+N  V+  L A+LTPYI R +      L +  ++LK L SN E PY+ WDN TR+E+ +++E  + S   TSE    +GAEF+ S+++ ELI+G++FIR+YNEQ  F L  P+   IDLL ++K     +  +     ++   +          N   L    K+   + AL N++  NP + I LIG+F +L + +  R  P +Q AA++V+    +++EC+ D+   NV   L  LL         +LD +  + S   + KE++  G L+Y L +LC +N     ++ AA LL K+  DKL G R    +++FLP IF DS++D+P T + ++D+  ENPELIWNE TR+ +  ++  +    +E+  KD   KW+     D    Y   IN  L VGGV++ LYV +PG+ +R+P  F  +L  K  +++ + +         L+L T A   L+  H    D+LP +GY+ +    +   +TS    ++ +LI  ++S ++ C   ++ +  I  +M +MK +   +  +   L  L +  T EL  Q +   +V Y+L +L++ +  V +    +A  V ALK+       G ++  +L+ S +W+QFKDQ HDL+L      A  +TG     AGYLT
Sbjct:  853 IHNPLEFFNNVYHRFLLSTKVDMKCLCLRAMAITYSRHHMTIGAFQDSKYFVEMLQKCINPLERDHLVLLLSKLALNKDNVRELIISNILPLLVDLCVLAHLHVQRAKVQNQTNVIEAS--AEQMAEGGSEEWYYHDKDAKQVGPLSFEKMKSLYTEKTIFEKSQIWAAGMDKWMSLAAVPQFRWTVCQQKDQPNEINTGKGPFQATVMNFTDLSVLCLDTILQMCEFFPSRDSHDCVVRPMPSVKKQLTEPVLLYQLVQLLLTYEPQIVQRVALLLYLVMQDNPFLPRLYLSGVFYFILMYNGSNVLPIARFLHYTHMKQAFRSTLPQFEGQ--RQSVLATLLPEAATFYLEQYGPEKYAEVFLGEFDNPEIIWNTAMRRHLIERIAVHVADFSHRLTSNVRALYQFCPIPLIDYPELAQELFCHVYYLRHLCNKQRFPDWEIRDPIPFLRCCLATWYNELEKKPATMSVDLAREILSV----DLTNEE---HRKPAFIRRQYYKLAAKYHPDKNPEGREMFERINAAYELLSSETANNSGMPDSHRIVLCLQAQSIIYSRYSQELSEYKYAGYSQLIKTIDLEAKDEALFIKGGGDLLSAAIELANYTLISSALNAEQLRRDNGLEALVTAFDRCVPMVTMSSLPDDMAVRVCIHVCDCFATAATFEACRQRLMEMPSIFGALTRLLQFSNLPRLSTAAAQCIRAMAVDTLLQFQLFQTGVLWQLVPHLFHFDYTLDEGGVQHSEDSNKQSLANSLARSSCEALAALAGF--REN------TPDNDGVQASLRALLTPYICRCM-----KLETNDMVLKTLNSNMENPYMIWDNGTRAEVLEFVERHRTSNEPTSEL---YGAEFELSVHKNELIVGDIFIRIYNEQPTFALHEPKKVAIDLLDYIKKHSAELTGAPKPKAISDDLIEIDWGNGSQANGNSLDTETKVLMTMTALANLVSANPGVEILLIGNFPLLITYLRCRKHPKLQIAALQVILLAAANKECVTDLATCNVTTTLFTLLRDQPKMIARVLDVLIALSSNGQIGKEMLEHGGLMYILSILCLTNSDQGQRLQAAELLAKLQADKLTGPRWTRFIIKFLPEIFADSLRDSPNTALQMFDSSSENPELIWNEVTRQKVKGIIDTEVGKLYEQHIKDPTVKWNTTSLADKSCAYGDSINGELVVGGVFVRLYVENPGFNVRHPKLFSTELIEKVLELMSRPT-------PELDLVTKAFVELVRHHPNTADQLPSQGYLPQFCTAMCLQNTSAS--RSAILILQELSENQFCCDALSQLPCIDGIMKSMKNQPSLMRESAHALKCLMKRNTGELAQQMLSCGMVPYLLQVLDSSMNGVSNGAAARAEIVDALKSAILDLKVGQKIAEILDKSPVWAQFKDQRHDLFLPEARTQA--ITGGPTGVAGYLT 2244          

HSP 2 Score: 657.522 bits (1695), Expect = 0.000e+0
Identity = 354/875 (40.46%), Postives = 526/875 (60.11%), Query Frame = 2
Query:   35 NKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEP----DSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEIS-AQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTHMQEIQRKNK-EAWRI-VEKKIDNLLMHWRSKIGINMKPMKDKDEK------PVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVG 2620
            ++N D  CY VTKH+W+G YKR+ ++G+L ITTY+  TL++TNQW Y +  S++P     S + K +++ + +R  G  K  DMRFSSD+  +IL   + +S  F +K    L V + K  W+++ +PV L  N+ C+ QID N   VV  Y YK+I  + K+SD   GFV+      R H+F ++N +E ++ +   A + + I +  AKE ++++  +  R+G  S+DE +TS+AEF + K+       + PV+R+LCL+ETC++ERD  TY +I   PL  I  L+R  ++PQ+FI+EY +G  R Y++ +RD +LASLLDG R+SGN +V V   + +R LR  P    ++E+ ESQ MK +   P G+   + + RFNANV YSGL  + + EG F+ENK K+I  A+ A++     +++       EAQ   LRRL ASK+GFQAFT++N +RE LG  VV  L   +E++ H+ ++ + AL+ PMH+ Y++R EQLNK S+MSS KF++NLLD+  LHV R TG LVI+ ML+FLTF++C PY ET+ G+ FD++LKLVS RGR  F+LF  PS+ IVKGA ++M+A+I+EAD    +SMQ LAL+EGA   HL  S  +   D R +  +QL+  L+SLW+  N  A +LL R LP GL+ Y+ S E  P++  D L  R+N + A    ++   K K +  R+  E  ++  + HW  +  +N  P +  DEK      PV LRKRR R++   NW++F YQF +DH++ +L+WN KTREEFR A++ E               I+EK   P  +                             ++WN+ EF+I Y  L  EIK+G
Sbjct:    6 SENRDIACYLVTKHSWKGKYKRVFSIGTLAITTYNPNTLEITNQWLYEDFLSVKPLRNGGSNDSKQDEYKIHVRNRG--KNNDMRFSSDYTTDILTHCLQFSTKFADKNFEPLTVTAFKQSWSDRRIPVTLRANASCLEQID-NRGVVVQSYPYKNIRSIGKVSDCPGGFVVDVGEHRRRHMFASSNNEELVKEIRRLASDNIGIIVPIAKEQLTLEDFMRTRLGLCSRDEELTSYAEFKISKITRRN---EMPVRRLLCLSETCIIERDLATYAVICATPLKHIVCLVRSEKDPQQFIVEYENGDGRAYVAAERDLILASLLDGIRASGNNEVFVCGHRFERNLRVIPFSTNLDEDSESQCMKHIIAPPPGLRRCDLIRRFNANVPYSGLRFSKSHEGFFSENKGKVIVNAIEAVLMENYTKDDKEYKHKTEAQLQCLRRLFASKSGFQAFTEVNGVREKLGSLVVRVLSWKSESIDHSTVEALCALMYPMHDQYELRIEQLNKQSLMSSPKFVENLLDLIVLHVDRSTGWLVIASMLNFLTFSVCSPYSETTAGDTFDHILKLVSLRGRSFFRLFQCPSMTIVKGAGMVMRAIIEEADVETSKSMQMLALSEGAFLTHLFMSLLSTGKDLRVMTNKQLSGHLISLWIADNQQANDLLIRCLPRGLLNYMESDEKVPVNEKDLLIVRNNFDAASNETKQNAMKEKFDQLRVTAEAGLERFVQHWDLEQKLNFLPKRVIDEKQQQRQQPVVLRKRRNRVRPNVNWKLFAYQFSKDHSQADLIWNEKTREEFRHAMDTETRAL-----------ISEKEQAPTGL----------------------------PIAWNHTEFQIRYPSLLEEIKIG 835          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Celegans
Match: rme-8 (Endocytosis protein RME-8; Receptor Mediated Endocytosis [Source:UniProtKB/TrEMBL;Acc:G5ED36])

HSP 1 Score: 992.26 bits (2564), Expect = 0.000e+0
Identity = 567/1438 (39.43%), Postives = 861/1438 (59.87%), Query Frame = 2
Query: 2876 IRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWS-------NSKLYTGQAVF-----TFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRAKLWSG-PDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQK-ETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNP--------EINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKS-NVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPD--DFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEAGLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLT 7114
            I    EFF+++Y RFL   K +MKC+CL AM+I Y R H  IG   D + F+ +L++  N LERD L+LLL KL +NK+N+  +I +N + +LVDL  +AH+HV RA +  Q+NVIEA+  A+   +   +EW+Y +K+ +Q+GPLSF+++  L+ E TI    ++WA G+D+W S A+VPQ RW+        +++ TG+  F      F++++   L  ++ +C  +PS+D    ++RPMP  KKQ+T+PVLL  +VQLLLT++P +V+++ALLL +V  +NP+  RLY++GVFYFILMY GSNVL IA FL  THM QAFR+     E     +S++  +LPEA   +LE +  E++A+++LG++D PE IWN+ MRR +IE+IA H+ +F+ RL SN RA YQ+  IP+I YP+L  ELFC  YYLRHLC+  RFPDW IR P+  LR  L  W NE+EKKP +MSV  A E+L +    +L++++    ++ + IR+ Y++L+ KYHPD+NP+GRE FE+IN AY+ L +     SG PD   I L L++QSI++ R  +E+  +KY+GY  LIKTI  E +DE LF K    LL    ELA +T+  SALNAE+LRR +G++AL  AF RCV ++T SS   D +VRVC ++   F+ AA FEACRQR+ E+P I   L RLL F NLP+LS+   +C+  ++ D  LQ  +F+ G ++ L+P++F FDYTL+EGGV  SE+++KQ + N LA  +  A+  LAG    EN      +P+N  V+  L A+LTPYI R +      L +  ++LK L SN E PY+ WDN TR+E+ +++E  + S   TSE    +GAEF+ S+++ ELI+G++FIR+YNEQ  F L  P+   IDLL ++K     +  +     ++   +          N   L    K+   + AL N++  NP         + I LIG+F +L + +  R  P +Q AA++V+    +++EC+ D+   NV   L  LL         +LD +  + S   + KE++  G L+Y L +LC +N     ++ AA LL K+  DKL G R    +++FLP IF DS++D+P T + ++D+  ENPELIWNE TR+ +  ++  +    +E+  KD   KW+     D    Y   IN  L VGGV++ LYV +PG+ +R+P  F  +L  K  +++ + +         L+L T A   L+  H    D+LP +GY+ +    +   +TS    ++ +LI  ++S ++ C   ++ +  I  +M +MK +   +  +   L  L +  T EL  Q +   +V Y+L +L++ +  V +    +A  V ALK+       G ++  +L+ S +W+QFKDQ HDL+L      A  +TG     AGYLT
Sbjct:  853 IHNPLEFFNNVYHRFLLSTKVDMKCLCLRAMAITYSRHHMTIGAFQDSKYFVEMLQKCINPLERDHLVLLLSKLALNKDNVRELIISNILPLLVDLCVLAHLHVQRAKVQNQTNVIEAS--AEQMAEGGSEEWYYHDKDAKQVGPLSFEKMKSLYTEKTIFEKSQIWAAGMDKWMSLAAVPQFRWTVCQQKDQPNEINTGKGPFQATVMNFTDLSVLCLDTILQMCEFFPSRDSHDCVVRPMPSVKKQLTEPVLLYQLVQLLLTYEPQIVQRVALLLYLVMQDNPFLPRLYLSGVFYFILMYNGSNVLPIARFLHYTHMKQAFRSTLPQFEGQ--RQSVLATLLPEAATFYLEQYGPEKYAEVFLGEFDNPEIIWNTAMRRHLIERIAVHVADFSHRLTSNVRALYQFCPIPLIDYPELAQELFCHVYYLRHLCNKQRFPDWEIRDPIPFLRCCLATWYNELEKKPATMSVDLAREILSV----DLTNEE---HRKPAFIRRQYYKLAAKYHPDKNPEGREMFERINAAYELLSSETANNSGMPDSHRIVLCLQAQSIIYSRYSQELSEYKYAGYSQLIKTIDLEAKDEALFIKGGGDLLSAAIELANYTLISSALNAEQLRRDNGLEALVTAFDRCVPMVTMSSLPDDMAVRVCIHVCDCFATAATFEACRQRLMEMPSIFGALTRLLQFSNLPRLSTAAAQCIRAMAVDTLLQFQLFQTGVLWQLVPHLFHFDYTLDEGGVQHSEDSNKQSLANSLARSSCEALAALAGF--REN------TPDNDGVQASLRALLTPYICRCM-----KLETNDMVLKTLNSNMENPYMIWDNGTRAEVLEFVERHRTSNEPTSEL---YGAEFELSVHKNELIVGDIFIRIYNEQPTFALHEPKKVAIDLLDYIKKHSAELTGAPKPKAISDDLIEIDWGNGSQANGNSLDTETKVLMTMTALANLVSANPGALFANKKGVEILLIGNFPLLITYLRCRKHPKLQIAALQVILLAAANKECVTDLATCNVTTTLFTLLRDQPKMIARVLDVLIALSSNGQIGKEMLEHGGLMYILSILCLTNSDQGQRLQAAELLAKLQADKLTGPRWTRFIIKFLPEIFADSLRDSPNTALQMFDSSSENPELIWNEVTRQKVKGIIDTEVGKLYEQHIKDPTVKWNTTSLADKSCAYGDSINGELVVGGVFVRLYVENPGFNVRHPKLFSTELIEKVLELMSRPT-------PELDLVTKAFVELVRHHPNTADQLPSQGYLPQFCTAMCLQNTSAS--RSAILILQELSENQFCCDALSQLPCIDGIMKSMKNQPSLMRESAHALKCLMKRNTGELAQQMLSCGMVPYLLQVLDSSMNGVSNGAAARAEIVDALKSAILDLKVGQKIAEILDKSPVWAQFKDQRHDLFLPEARTQA--ITGGPTGVAGYLT 2252          

HSP 2 Score: 657.522 bits (1695), Expect = 0.000e+0
Identity = 354/875 (40.46%), Postives = 526/875 (60.11%), Query Frame = 2
Query:   35 NKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEP----DSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEIS-AQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTHMQEIQRKNK-EAWRI-VEKKIDNLLMHWRSKIGINMKPMKDKDEK------PVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVG 2620
            ++N D  CY VTKH+W+G YKR+ ++G+L ITTY+  TL++TNQW Y +  S++P     S + K +++ + +R  G  K  DMRFSSD+  +IL   + +S  F +K    L V + K  W+++ +PV L  N+ C+ QID N   VV  Y YK+I  + K+SD   GFV+      R H+F ++N +E ++ +   A + + I +  AKE ++++  +  R+G  S+DE +TS+AEF + K+       + PV+R+LCL+ETC++ERD  TY +I   PL  I  L+R  ++PQ+FI+EY +G  R Y++ +RD +LASLLDG R+SGN +V V   + +R LR  P    ++E+ ESQ MK +   P G+   + + RFNANV YSGL  + + EG F+ENK K+I  A+ A++     +++       EAQ   LRRL ASK+GFQAFT++N +RE LG  VV  L   +E++ H+ ++ + AL+ PMH+ Y++R EQLNK S+MSS KF++NLLD+  LHV R TG LVI+ ML+FLTF++C PY ET+ G+ FD++LKLVS RGR  F+LF  PS+ IVKGA ++M+A+I+EAD    +SMQ LAL+EGA   HL  S  +   D R +  +QL+  L+SLW+  N  A +LL R LP GL+ Y+ S E  P++  D L  R+N + A    ++   K K +  R+  E  ++  + HW  +  +N  P +  DEK      PV LRKRR R++   NW++F YQF +DH++ +L+WN KTREEFR A++ E               I+EK   P  +                             ++WN+ EF+I Y  L  EIK+G
Sbjct:    6 SENRDIACYLVTKHSWKGKYKRVFSIGTLAITTYNPNTLEITNQWLYEDFLSVKPLRNGGSNDSKQDEYKIHVRNRG--KNNDMRFSSDYTTDILTHCLQFSTKFADKNFEPLTVTAFKQSWSDRRIPVTLRANASCLEQID-NRGVVVQSYPYKNIRSIGKVSDCPGGFVVDVGEHRRRHMFASSNNEELVKEIRRLASDNIGIIVPIAKEQLTLEDFMRTRLGLCSRDEELTSYAEFKISKITRRN---EMPVRRLLCLSETCIIERDLATYAVICATPLKHIVCLVRSEKDPQQFIVEYENGDGRAYVAAERDLILASLLDGIRASGNNEVFVCGHRFERNLRVIPFSTNLDEDSESQCMKHIIAPPPGLRRCDLIRRFNANVPYSGLRFSKSHEGFFSENKGKVIVNAIEAVLMENYTKDDKEYKHKTEAQLQCLRRLFASKSGFQAFTEVNGVREKLGSLVVRVLSWKSESIDHSTVEALCALMYPMHDQYELRIEQLNKQSLMSSPKFVENLLDLIVLHVDRSTGWLVIASMLNFLTFSVCSPYSETTAGDTFDHILKLVSLRGRSFFRLFQCPSMTIVKGAGMVMRAIIEEADVETSKSMQMLALSEGAFLTHLFMSLLSTGKDLRVMTNKQLSGHLISLWIADNQQANDLLIRCLPRGLLNYMESDEKVPVNEKDLLIVRNNFDAASNETKQNAMKEKFDQLRVTAEAGLERFVQHWDLEQKLNFLPKRVIDEKQQQRQQPVVLRKRRNRVRPNVNWKLFAYQFSKDHSQADLIWNEKTREEFRHAMDTETRAL-----------ISEKEQAPTGL----------------------------PIAWNHTEFQIRYPSLLEEIKIG 835          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Celegans
Match: dnj-12 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:O45502])

HSP 1 Score: 51.9878 bits (123), Expect = 3.924e-6
Identity = 19/39 (48.72%), Postives = 32/39 (82.05%), Query Frame = 2
Query: 4337 IRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRAK 4453
            ++KAY ++++K+HPD+NPDG EQF++I+ AY+ L +  K
Sbjct:   22 LKKAYRKMALKFHPDKNPDGAEQFKQISQAYEVLSDEKK 60          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Celegans
Match: dnj-12 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:O45502])

HSP 1 Score: 51.9878 bits (123), Expect = 3.924e-6
Identity = 19/39 (48.72%), Postives = 32/39 (82.05%), Query Frame = 2
Query: 4337 IRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRAK 4453
            ++KAY ++++K+HPD+NPDG EQF++I+ AY+ L +  K
Sbjct:   22 LKKAYRKMALKFHPDKNPDGAEQFKQISQAYEVLSDEKK 60          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Fly
Match: Rme-8 (gene:FBgn0015477 transcript:FBtr0339370)

HSP 1 Score: 696.812 bits (1797), Expect = 0.000e+0
Identity = 383/883 (43.37%), Postives = 548/883 (62.06%), Query Frame = 2
Query:   17 MLNPCMNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQ---QTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQ--EEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNV--DYLFERDNMELAQTHMQEIQRKNKEAWRIVEKKIDNLLMHWRSKIGINMKPMKDK-----DEKPVCLRKRRKRIKVLD---NWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVG 2620
            ML P   +NVD  C+ VTKH+W+G YKR++++G+ GI+TY+ + L +TN+W YS+I +  P       + FV+ +++  DKK   ++ SS++R +IL+  + Y   F +K +   + ++ K+ W+   +P +LEV    + Q+DP T+ V++ Y YKDIE +  ISD+  G V+A  GFSRLH+F A N  E ++ +A+ +   + I     K  I+++     R GK+S D+  TS  EF V K+ T R+ PD PV+RILCLTE  L+ERDP+TY + TLRPL D+FAL+RD    QRF IEY +G+ R Y + DRDSLLA++LD  RSSGN+DV V++  T R  R+ PL   ++EE E+  M+++    Q P      E + RFNANV +SGL ++VTQ+ LFAENK+KLI  AL AL  +E +    ++S  +LEA FHAL RL+ASK G+ AFT L   RE +G KVV ALRR + AVT++AID IN+L+  ++ ++D++QEQLNK+SI+SS  FL+ LL+M++ HV  G+GALV+S MLDF+TF +C PY ET+DG+ FD LL+LV++RGR ++KLF HPSLAIVKGA L+++A+I+E +  V + MQ LAL E AL +HLL + +  +ND      RQL+R L+ LW+T +  A EL KR+ P GL+ +L S E  P S+V  D L  RDN++ A      IQ  NK    ++EK +   + HW    G+N+   +D        +PV LR RR++ K  D   N   FFY F +DH+ PNL+WN KTREE R  LE E+  F  +RD    +                                         V+WNY EF++ Y+CL +EIK+G
Sbjct:    1 MLPP--KENVDLECFLVTKHSWKGRYKRILSIGTAGISTYNPDKLDLTNRWSYSDIVAAAPSKTTNIPHDFVITIKK--DKKLDTIKLSSEYRNDILSSILKYYKEFADKPKNAQRFSAYKYHWSGISLPTVLEVTPCSLDQLDPTTNDVLASYMYKDIEGIIGISDYEGGIVMAYGGFSRLHLFKALNHHEIVQNIAQRSAQFLGIETKILKSQITLEQFERQRFGKFSGDQFQTSSTEFSVHKI-TPRH-PD-PVKRILCLTEVTLLERDPQTYSVCTLRPLTDVFALVRDKDNLQRFSIEYKNGIVRNYSTNDRDSLLATVLDAVRSSGNQDVHVRIGNTPRGKRYVPLNSSVDEETEANLMRLVINNFQNPSKR--YEILERFNANVPHSGLNYSVTQDSLFAENKDKLILSALQALAQKELDSPTAQLSNLELEAIFHALTRLLASKVGYAAFTNLPGFREIIGTKVVAALRRKDLAVTYSAIDMINSLMHSVNSDHDLKQEQLNKSSILSSKSFLETLLNMWTTHVSHGSGALVLSAMLDFMTFALCVPYSETTDGKQFDTLLELVADRGRYLYKLFQHPSLAIVKGAGLVLRAIIEEGELQVAQQMQALALDEAALCRHLLVALYTPSNDPTQTTQRQLSRHLIGLWLTDSEEAMELFKRIFPAGLLTFLESEETVPESDVEEDKLNFRDNLKFA------IQHSNKTRKNVIEKHLQG-IKHW----GMNLIEKQDGAAQALKNRPVVLRNRRQKKKTSDVVVNLPFFFYSFAKDHSLPNLIWNHKTREELRMCLENELRQFLNDRDLAGQM----------------------------------------IVAWNYQEFEVAYQCLADEIKIG 823          

HSP 2 Score: 682.945 bits (1761), Expect = 0.000e+0
Identity = 348/768 (45.31%), Postives = 518/768 (67.45%), Query Frame = 2
Query: 2876 IRQSYEFFHDLYRRFL---QYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQ-EKN---KEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLG-GIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRAKLWS--GPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLSCDIW-LQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAG 5146
            ++   E F+ LYRR L   + +  +M    L A++ VY R H EIG  ND    + L +R  +   RD L+ L+  L++ K+N   +I  + ++ LVDLIT+AH+H  RA +  ++NVIEA  +  + ++   K+W+Y  EK+    E+ GP+++ EL +L  +G I P  + WA G+D WRS   +PQ++W    +  G  ++  +E++SK L IL+     +PS+ Q G  ++ P P+  +++++ + L H+VQ+ LT DP L+E++A LL  + ++NP   ++Y+TGVFYF+LMY GSN+L I  FLK+THM Q FR++E++ +S I+ RSI+G +LPEAM+CFLEN+ +E+FA+I+LG++DTPE IW+SEMRR +IEKIA H+ +FTPRL  +  A Y YLAIP+ISYPQLENELFC  YYLRHLCDT +FP+WPI  PV LL+  L AW+ E+EKKPP M++++AY+ L +   +    D       ES+IRK+Y++L+  YHPD+NP+GRE FEK+N AY+FLC+R  +WS  GPDP NI L+L++QSILF+R    +  +KY+GYP LIKTI  ET D++LF KE  LL   +EL YHTV+ SALNAEELRR++GI+AL  A++RCV+I+   S       +V   +T  F VA  FE C+Q+I ++PQ+  D+ R++YFK+     +L    V  L+ + + LQ  +  NG ++ LL ++F++DYTL+E GV  S+++++Q++ N LA +A+L    LAG
Sbjct:  841 VKDPIELFNALYRRVLCRQRVNDDQMTVFSLQALAKVYRRYHAEIGKFNDMSYILQLSDRCLSPSMRDALINLISCLVLEKSNSRALI--DHVQCLVDLITLAHLHKGRAQLNTKTNVIEAGPNMGTYEE---KDWYYNIEKDGQKPERQGPITYSELKELWQKGLITPKTRCWAIGMDGWRSLQQIPQLKWC--LIAKGTPLYDETELSSKILDILIKCTSFFPSRTQNGVAVLIPGPKLSRKLSEFICLPHVVQVCLTHDPGLLERVATLLYQIMEDNPEMPKVYLTGVFYFMLMYTGSNILPITRFLKMTHMKQGFRSEETS-QSGIMHRSILGQLLPEAMVCFLENYSAEKFAEIFLGEFDTPEVIWSSEMRRLLIEKIAAHIADFTPRLRGHTMARYPYLAIPVISYPQLENELFCHIYYLRHLCDTQKFPNWPISDPVQLLKHTLDAWRKEVEKKPPQMTIQQAYQDLGIDLTKTPKPD-------ESMIRKSYYKLAQMYHPDKNPNGREIFEKVNQAYEFLCSR-NVWSSGGPDPNNIVLILRTQSILFERYPDVLRPYKYAGYPQLIKTIRLETRDDELFSKEAQLLTAASELCYHTVHCSALNAEELRREEGIEALLEAYTRCVSILGVDSKPDSLHYQVISNVTRCFEVACNFEKCKQKIIQLPQLLSDVCRVVYFKH-----TLSVSLVTSLAANNYDLQCQLSRNGVLWSLLLFIFEYDYTLDESGVDVSDKSNQQQLANNLAKMAVLGCIALAG 1587          

HSP 3 Score: 355.91 bits (912), Expect = 4.385e-98
Identity = 229/710 (32.25%), Postives = 384/710 (54.08%), Query Frame = 2
Query: 5189 ENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECD----HHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMD---------------ASVGTNQLTKPTLL--------TSSNGTVTVNNEVL------KRSQKIQS-----------------------------ALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFP---AIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLES--LQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEAGLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTS 7117
            +N  ++Q L  +LT YI  ++A  +        +LKLLT+N+  PYL WDN TR++LK +LE Q+ +  K +  D        + F+F  ++ EL IG +FIR+YN+     +  P+ F +DLL +LK   +++                  +G + +  PTL          S+  + T  +EVL      K  +K+++                              L AL+ VI  N E+ IQ IG+F M+F  +   +FP    ++  A+EVV  V+ ++EC+ ++ A  +L + +  L+   L+++ + +L+T+S + +V  ++KE   +G  IY L + C+S    ++ + AG+L KM  D+L G ++R  + +FLP +F+D+M ++P T V L+++ HE+PELIWN+ TR  +   V +    +++ Q+ +    W  P+  +     I++  + V GVYL L+VS+P W LR P +F + L     + I KSS+   V    L+L+T AL  LL S   L D +P  G++ K+F +L    + +P  K  L + +Q+S S+ CV+ ++  E + PL   M+  +D +  A E L RLF+   D LI+Q++++ L+ ++LGLL++ L  V +P  VKA  V ALK M  +  +G +VT +L    +W++FKDQ HDL++ +T  + GYLTG +  TAGYLT+
Sbjct: 1692 KNSLIKQVLDRLLTRYISNQLATVRD-----SDVLKLLTANTRNPYLIWDNGTRAQLKDFLEQQRTASAKETHEDIAQVSELVSSFEFDAHKDELQIGGIFIRIYNDMPTHPIAQPKLFIMDLLEYLKHAYQFLQYKKNPASTAAPVNATPKMGNDGILTPTLAPNHPQLQQASTGKSGTTFDEVLTAYNRSKSRKKLETDALTEQQLALQQSKYDFSSDGKIELHITMVLKALIAVIKANAEVEIQCIGNFDMIFGFLASNIFPDNSTVKAVALEVVSLVSRNKECVSEVAACEILGNYLVALKDPELRASQVKVLETLSGLMNVQEMIKEAQAKGATIYLLDMFCNSRNPQIREMCAGILAKMTADRLSGPKVRITVSKFLPALFIDAMVESPATSVQLFESIHEHPELIWNDTTRSNVCDAVADTCQRFYQLQKANSRHVWKDPEILK----DIVSNEIVVAGVYLRLFVSNPAWTLRKPKQFLSDLLDFVVEQIGKSSSEQDV----LDLSTTALVELLRSQPNLADDIPVLGHIPKLFNLL----SVQP--KNTLSVLHQLSLSEFCVSAISQTECVAPLKKCMEHNRDCIEKACEALSRLFKHQHDSLISQSLEVGLIPFLLGLLDSRLEFVDNPSAVKAQIVAALKGMTHNLNYGDRVTQILLKHPVWAEFKDQRHDLFIADT-TIRGYLTGVN-PTAGYLTA 2380          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Fly
Match: Rme-8 (gene:FBgn0015477 transcript:FBtr0088618)

HSP 1 Score: 696.041 bits (1795), Expect = 0.000e+0
Identity = 384/884 (43.44%), Postives = 550/884 (62.22%), Query Frame = 2
Query:   17 MLNPCMNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIE-MLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQ---QTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQ--EEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNV--DYLFERDNMELAQTHMQEIQRKNKEAWRIVEKKIDNLLMHWRSKIGINMKPMKDK-----DEKPVCLRKRRKRIKVLD---NWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVG 2620
            ML P   +NVD  C+ VTKH+W+G YKR++++G+ GI+TY+ + L +TN+W YS+I +  P       + FV+ +++  DKK   ++ SS++R +IL+  + Y   F +K +   + ++ K+ W+   +P +LEV    + Q+DP T+ V++ Y YKDIE ++A ISD+  G V+A  GFSRLH+F A N  E ++ +A+ +   + I     K  I+++     R GK+S D+  TS  EF V K+ T R+ PD PV+RILCLTE  L+ERDP+TY + TLRPL D+FAL+RD    QRF IEY +G+ R Y + DRDSLLA++LD  RSSGN+DV V++  T R  R+ PL   ++EE E+  M+++    Q P      E + RFNANV +SGL ++VTQ+ LFAENK+KLI  AL AL  +E +    ++S  +LEA FHAL RL+ASK G+ AFT L   RE +G KVV ALRR + AVT++AID IN+L+  ++ ++D++QEQLNK+SI+SS  FL+ LL+M++ HV  G+GALV+S MLDF+TF +C PY ET+DG+ FD LL+LV++RGR ++KLF HPSLAIVKGA L+++A+I+E +  V + MQ LAL E AL +HLL + +  +ND      RQL+R L+ LW+T +  A EL KR+ P GL+ +L S E  P S+V  D L  RDN++ A      IQ  NK    ++EK +   + HW    G+N+   +D        +PV LR RR++ K  D   N   FFY F +DH+ PNL+WN KTREE R  LE E+  F  +RD    +                                         V+WNY EF++ Y+CL +EIK+G
Sbjct:    1 MLPP--KENVDLECFLVTKHSWKGRYKRILSIGTAGISTYNPDKLDLTNRWSYSDIVAAAPSKTTNIPHDFVITIKK--DKKLDTIKLSSEYRNDILSSILKYYKEFADKPKNAQRFSAYKYHWSGISLPTVLEVTPCSLDQLDPTTNDVLASYMYKDIEGIIAGISDYEGGIVMAYGGFSRLHLFKALNHHEIVQNIAQRSAQFLGIETKILKSQITLEQFERQRFGKFSGDQFQTSSTEFSVHKI-TPRH-PD-PVKRILCLTEVTLLERDPQTYSVCTLRPLTDVFALVRDKDNLQRFSIEYKNGIVRNYSTNDRDSLLATVLDAVRSSGNQDVHVRIGNTPRGKRYVPLNSSVDEETEANLMRLVINNFQNPSKR--YEILERFNANVPHSGLNYSVTQDSLFAENKDKLILSALQALAQKELDSPTAQLSNLELEAIFHALTRLLASKVGYAAFTNLPGFREIIGTKVVAALRRKDLAVTYSAIDMINSLMHSVNSDHDLKQEQLNKSSILSSKSFLETLLNMWTTHVSHGSGALVLSAMLDFMTFALCVPYSETTDGKQFDTLLELVADRGRYLYKLFQHPSLAIVKGAGLVLRAIIEEGELQVAQQMQALALDEAALCRHLLVALYTPSNDPTQTTQRQLSRHLIGLWLTDSEEAMELFKRIFPAGLLTFLESEETVPESDVEEDKLNFRDNLKFA------IQHSNKTRKNVIEKHLQG-IKHW----GMNLIEKQDGAAQALKNRPVVLRNRRQKKKTSDVVVNLPFFFYSFAKDHSLPNLIWNHKTREELRMCLENELRQFLNDRDLAGQM----------------------------------------IVAWNYQEFEVAYQCLADEIKIG 824          

HSP 2 Score: 682.559 bits (1760), Expect = 0.000e+0
Identity = 348/768 (45.31%), Postives = 518/768 (67.45%), Query Frame = 2
Query: 2876 IRQSYEFFHDLYRRFL---QYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQ-EKN---KEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLG-GIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRAKLWS--GPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLSCDIW-LQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAG 5146
            ++   E F+ LYRR L   + +  +M    L A++ VY R H EIG  ND    + L +R  +   RD L+ L+  L++ K+N   +I  + ++ LVDLIT+AH+H  RA +  ++NVIEA  +  + ++   K+W+Y  EK+    E+ GP+++ EL +L  +G I P  + WA G+D WRS   +PQ++W    +  G  ++  +E++SK L IL+     +PS+ Q G  ++ P P+  +++++ + L H+VQ+ LT DP L+E++A LL  + ++NP   ++Y+TGVFYF+LMY GSN+L I  FLK+THM Q FR++E++ +S I+ RSI+G +LPEAM+CFLEN+ +E+FA+I+LG++DTPE IW+SEMRR +IEKIA H+ +FTPRL  +  A Y YLAIP+ISYPQLENELFC  YYLRHLCDT +FP+WPI  PV LL+  L AW+ E+EKKPP M++++AY+ L +   +    D       ES+IRK+Y++L+  YHPD+NP+GRE FEK+N AY+FLC+R  +WS  GPDP NI L+L++QSILF+R    +  +KY+GYP LIKTI  ET D++LF KE  LL   +EL YHTV+ SALNAEELRR++GI+AL  A++RCV+I+   S       +V   +T  F VA  FE C+Q+I ++PQ+  D+ R++YFK+     +L    V  L+ + + LQ  +  NG ++ LL ++F++DYTL+E GV  S+++++Q++ N LA +A+L    LAG
Sbjct:  842 VKDPIELFNALYRRVLCRQRVNDDQMTVFSLQALAKVYRRYHAEIGKFNDMSYILQLSDRCLSPSMRDALINLISCLVLEKSNSRALI--DHVQCLVDLITLAHLHKGRAQLNTKTNVIEAGPNMGTYEE---KDWYYNIEKDGQKPERQGPITYSELKELWQKGLITPKTRCWAIGMDGWRSLQQIPQLKWC--LIAKGTPLYDETELSSKILDILIKCTSFFPSRTQNGVAVLIPGPKLSRKLSEFICLPHVVQVCLTHDPGLLERVATLLYQIMEDNPEMPKVYLTGVFYFMLMYTGSNILPITRFLKMTHMKQGFRSEETS-QSGIMHRSILGQLLPEAMVCFLENYSAEKFAEIFLGEFDTPEVIWSSEMRRLLIEKIAAHIADFTPRLRGHTMARYPYLAIPVISYPQLENELFCHIYYLRHLCDTQKFPNWPISDPVQLLKHTLDAWRKEVEKKPPQMTIQQAYQDLGIDLTKTPKPD-------ESMIRKSYYKLAQMYHPDKNPNGREIFEKVNQAYEFLCSR-NVWSSGGPDPNNIVLILRTQSILFERYPDVLRPYKYAGYPQLIKTIRLETRDDELFSKEAQLLTAASELCYHTVHCSALNAEELRREEGIEALLEAYTRCVSILGVDSKPDSLHYQVISNVTRCFEVACNFEKCKQKIIQLPQLLSDVCRVVYFKH-----TLSVSLVTSLAANNYDLQCQLSRNGVLWSLLLFIFEYDYTLDESGVDVSDKSNQQQLANNLAKMAVLGCIALAG 1588          

HSP 3 Score: 355.525 bits (911), Expect = 4.540e-98
Identity = 229/710 (32.25%), Postives = 384/710 (54.08%), Query Frame = 2
Query: 5189 ENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECD----HHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMD---------------ASVGTNQLTKPTLL--------TSSNGTVTVNNEVL------KRSQKIQS-----------------------------ALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFP---AIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLES--LQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEAGLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTS 7117
            +N  ++Q L  +LT YI  ++A  +        +LKLLT+N+  PYL WDN TR++LK +LE Q+ +  K +  D        + F+F  ++ EL IG +FIR+YN+     +  P+ F +DLL +LK   +++                  +G + +  PTL          S+  + T  +EVL      K  +K+++                              L AL+ VI  N E+ IQ IG+F M+F  +   +FP    ++  A+EVV  V+ ++EC+ ++ A  +L + +  L+   L+++ + +L+T+S + +V  ++KE   +G  IY L + C+S    ++ + AG+L KM  D+L G ++R  + +FLP +F+D+M ++P T V L+++ HE+PELIWN+ TR  +   V +    +++ Q+ +    W  P+  +     I++  + V GVYL L+VS+P W LR P +F + L     + I KSS+   V    L+L+T AL  LL S   L D +P  G++ K+F +L    + +P  K  L + +Q+S S+ CV+ ++  E + PL   M+  +D +  A E L RLF+   D LI+Q++++ L+ ++LGLL++ L  V +P  VKA  V ALK M  +  +G +VT +L    +W++FKDQ HDL++ +T  + GYLTG +  TAGYLT+
Sbjct: 1693 KNSLIKQVLDRLLTRYISNQLATVRD-----SDVLKLLTANTRNPYLIWDNGTRAQLKDFLEQQRTASAKETHEDIAQVSELVSSFEFDAHKDELQIGGIFIRIYNDMPTHPIAQPKLFIMDLLEYLKHAYQFLQYKKNPASTAAPVNATPKMGNDGILTPTLAPNHPQLQQASTGKSGTTFDEVLTAYNRSKSRKKLETDALTEQQLALQQSKYDFSSDGKIELHITMVLKALIAVIKANAEVEIQCIGNFDMIFGFLASNIFPDNSTVKAVALEVVSLVSRNKECVSEVAACEILGNYLVALKDPELRASQVKVLETLSGLMNVQEMIKEAQAKGATIYLLDMFCNSRNPQIREMCAGILAKMTADRLSGPKVRITVSKFLPALFIDAMVESPATSVQLFESIHEHPELIWNDTTRSNVCDAVADTCQRFYQLQKANSRHVWKDPEILK----DIVSNEIVVAGVYLRLFVSNPAWTLRKPKQFLSDLLDFVVEQIGKSSSEQDV----LDLSTTALVELLRSQPNLADDIPVLGHIPKLFNLL----SVQP--KNTLSVLHQLSLSEFCVSAISQTECVAPLKKCMEHNRDCIEKACEALSRLFKHQHDSLISQSLEVGLIPFLLGLLDSRLEFVDNPSAVKAQIVAALKGMTHNLNYGDRVTQILLKHPVWAEFKDQRHDLFIADT-TIRGYLTGVN-PTAGYLTA 2381          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Xenopus
Match: smad3 (SMAD family member 3 [Source:Xenbase;Acc:XB-GENE-481992])

HSP 1 Score: 1325.46 bits (3429), Expect = 0.000e+0
Identity = 693/1426 (48.60%), Postives = 993/1426 (69.64%), Query Frame = 2
Query: 2876 IRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQ---EESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRA-KLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYF-KNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAH-EHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEA-GLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTSFAQNT 7132
            I+QSYEFF++LY RFL   K  MKC+CL A+SIVYGRCH+EIGP  D +  + +LER T++LERDRL+L L KLI+NK N++ I+D+NGIR+LVDL+T+AH+H +RA +P QSNVIEAA D + + +   KEW++   +KE+ GP SF E+ +  ++G + P  + WAQG+D WR    +PQ++W    L  GQAV   +++A+  L++L+ +C  +PS+DQ   IIRP+P+ K+ +T    L HI QLLLTFDP LVEK+++LL  +  +NP   R Y+TGVF+FI+MY GSNVL IA FLK TH  QAFR +ES K  +I  RSI+G+ILPEAM+C+LEN+  E+F++I+LG++DTPE IW+SEMRR MIEKIA HL +F+PRL SN RA YQY  IP+I+YPQLENELFC  YYL+H CDT++FPDWPI+ PV LL+D L+AWK E+EKKPP+MS+ +AYEVL L           SR Q   +ES IRKAYF+L+ KYHPD+NP+GR+ FEK+N AY+FLC ++ K+  GPDP+NI L+LK+QSILF R +++++ +KY+GYPMLI+TI  ET DEQLF K   LL    ELAYHTVN SALNAEELRR++GI+ LQ  FSRCV+++TASS   D  V+VCG+I   +SVAAQFE CR++I E+P I +DL R+LY+ K + +L+++   CV+  + D WLQT + + G ++HLL Y F +D+TLEE G+ ++E+ ++QE+ N LA L++LA++RL G ++ + +     +PEN  +R+ L  MLTPYI RK+      ++S   ILK+L SN+E+PYL W+N TR+EL +YLESQQES+++  +CD  +GA+F +S + KELI+G++F+R+YNEQ  F LE P++F   LL ++ S+ +Y+   +   Q           G V  +  V  R Q+++ AL AL NVI  NP    + IGHFK+LFSL+       +Q+ A+EVV  VTS+++C+ +I  S VL  L+ LL SL ++  L+L T+  + S T ++KE + +G LIY L + C+S    V+   A L  KM++DKL+G ++R +L++FLP +F+D+M+DNPE  VH+++  HENPELIWN+++R+ +ST V E    +F++Q ++ +  W +PDDF V Y       L VGGV+L ++++ P W LR P EF   L  K+ ++++K++     AH E LE  T+A   L ++   L+D++P  G++ K+ Q ++  + + P  K  + + + +++++LCV ++A+++TI PLM  MK R D +G A E L R+FQ    EL+AQA+K+ LV Y+L LLE  GL N++ P   KA  VKALK+M RS  +G QV  +L  SS+WS FKDQ HDL+++ + Q AGYLTG  V  AGYLT+ + +T
Sbjct:  852 IKQSYEFFNELYHRFLLTPKVNMKCLCLQALSIVYGRCHEEIGPFGDTKYIVGMLERCTDRLERDRLILFLNKLILNKKNVKDIMDSNGIRILVDLLTLAHLHTSRATVPLQSNVIEAAPDMKRESE---KEWYFGNADKERSGPYSFVEMQEFWNKGILSPKTRCWAQGMDGWRPLQVIPQLKWC--LLAAGQAVLNETDLATLILNMLITMCSYFPSRDQDNAIIRPLPKVKRLLTDNTCLPHITQLLLTFDPILVEKVSILLYHIMQDNPQLPRFYLTGVFFFIMMYTGSNVLPIARFLKHTHAKQAFRTEES-KGPDIFQRSILGHILPEAMVCYLENYEPEKFSEIFLGEFDTPEAIWSSEMRRLMIEKIAAHLADFSPRLQSNTRALYQYCPIPVINYPQLENELFCNIYYLKHFCDTLKFPDWPIKDPVKLLKDTLEAWKKEVEKKPPTMSIDDAYEVLGL-----------SRGQGQYDESKIRKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSKKVVDGPDPENIILILKTQSILFNRHKEDLQPYKYAGYPMLIRTITMETSDEQLFSK-VSLLPAATELAYHTVNCSALNAEELRRENGIEVLQDGFSRCVSVLTASSKPDDMPVQVCGHICKCYSVAAQFETCREKITEMPNIIKDLCRVLYYGKRVQRLAAMAVECVSSFAVDYWLQTHLLQAGVLWHLLAYPFNYDFTLEESGIQKNEDTNQQEVANSLAKLSLLALSRLGGYLSGDQE-----TPENPVLRKSLAGMLTPYIARKLT-----VSSPTEILKMLNSNTESPYLLWNNGTRAELLEYLESQQESMVRRGDCDVSYGADFVYSEHSKELIVGDIFVRIYNEQPTFQLELPKAFAASLLDYIGSQAQYLHTLMALTQ----------TGKVESDQHV-DRLQRVEMALEALRNVIKHNPGSETECIGHFKLLFSLLRVHGAGKVQQLALEVVNIVTSNQDCVNNIAESMVLSSLLSLLHSLPTSRQLVLATLYALTSSTKIIKEAMAKGALIYLLDMFCNSTHPQVRSQTAELFAKMISDKLIGPKVRIVLMKFLPGVFMDAMRDNPEAAVHIFEGTHENPELIWNDNSRERVSTTVREMMLEHFKQQVENPDANWKLPDDFTVAYGEAQG-ELLVGGVFLRIFIAQPAWVLRKPREFLVALLEKFTELLEKNN-----AHGETLETITNATVCLFSAQPQLMDQVPPLGHLPKILQAMSHKNNAVP--KCAIRVIHILTDNELCVRSLASLDTIGPLMSGMKKRSDMIGFACEALNRMFQKEQTELVAQALKVDLVPYLLRLLEGQGLENLESPAATKAQIVKALKSMTRSLQYGEQVNEILTRSSVWSAFKDQKHDLFISES-QTAGYLTGPGV--AGYLTAGSSST 2227          

HSP 2 Score: 848.581 bits (2191), Expect = 0.000e+0
Identity = 429/876 (48.97%), Postives = 583/876 (66.55%), Query Frame = 2
Query:   32 MNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTH------MQEIQRKNKEAWRIVEK----KIDNLLMHWRSKIGINMKPMKDK---DEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVG 2620
            + +N D  C+  TKH+WRG YKR+ ++G+  ITTY+  TL+VTNQWPY +IC I P  K  +  +F L  R+   KK + ++FS++ R  +L EA+ +   F E      + N  K  W++    V LEV    + QIDP+ +RV+  Y Y++IE   ++S +  GF I   GFSRLH+F +  R+E I++  E A N + I L   KE +  +Y +  R+GKYS DE ITS AEF+VQK+ +       PV+R+L LTETCL+ERDP TY ++TL+PL +IFAL+ DP+ PQ F +E++ G  R Y ST+RDSLLASLLDG R+SGNRDVCVKM  T R  R+G L VP++EEVES H++ L   P G  F +AVFRFNAN+SYSG+LHAVTQ+GLF+ENKEKLI  A+++L+++EG     +A+ LE+QF A+RRLVASKAGF AFTQL K RE LG KVV AL+RNN+ VTHAAID + AL+ PMH++YD+RQEQLNKAS++SS KFL+NLL+ F+LHV  GTGALVIS +LDFLTF +C PY ET++G+ FD LL++V+  GR +FKLF HPS+A+VKGA L+M+A+I+EAD  +   MQ LAL+EGALP+HL  S F  + DQR L  RQL+R L+ LW   N  +  LLKR+LPPGL+ YL+ST+  P  ++D +  RDN+++A         + E QR   +A + VEK    K+D +L+HWR ++GI  K  ++     +KPV LRKRR+RIK+  NW +F+Y+F+QDHA+ NL+WN KTREE RD LE E+  F  +R+                                        +  +  +SWN+ EF++ Y CL  EIK+G
Sbjct:    4 IRENKDLACFYTTKHSWRGKYKRVFSIGTHAITTYNPNTLEVTNQWPYGDICGISPVGKG-QGTEFALTFRKGSGKKSETLKFSTEHRTELLTEALRFRTDFSEGKITGRRYNCYKHHWSDTRKLVTLEVTPGGIDQIDPSNNRVLCTYDYRNIEGFTEVSGYQGGFCILYGGFSRLHLFASEQREEIIKSAIEHAGNFIGITLRTRKEPVDFEYYVSLRLGKYSNDESITSLAEFIVQKITSRH---TEPVKRLLALTETCLLERDPATYNIVTLKPLGEIFALVYDPENPQIFTVEFIKGQIRKYSSTERDSLLASLLDGVRASGNRDVCVKMTPTQRGQRWGLLSVPVDEEVESLHLRFLTTPPNG-NFADAVFRFNANISYSGVLHAVTQDGLFSENKEKLINNAITSLLSQEGELAASNAE-LESQFQAVRRLVASKAGFLAFTQLPKFRERLGVKVVKALKRNNDGVTHAAIDMLCALMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFNLHVNYGTGALVISSLLDFLTFALCAPYSETTEGQQFDMLLEMVASNGRTLFKLFQHPSMAVVKGAGLVMKAIIEEADKEIATKMQELALSEGALPRHLHTSMFTISADQRMLTNRQLSRHLVGLWTADNTTSLNLLKRILPPGLLAYLDSTDPVPEKDIDRMHIRDNLKIASDQYGKFNKIPEWQRIAGKAAKEVEKFAKEKVDLVLLHWRDRMGIAQKEDRNSMNTAQKPVILRKRRQRIKIELNWDLFYYRFHQDHARSNLIWNFKTREELRDTLEAEMRAFNVDRE----------------------------------------LGSSTVISWNHQEFEVKYDCLSEEIKIG 833          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Xenopus
Match: smad3 (SMAD family member 3 [Source:Xenbase;Acc:XB-GENE-481992])

HSP 1 Score: 1325.07 bits (3428), Expect = 0.000e+0
Identity = 693/1426 (48.60%), Postives = 993/1426 (69.64%), Query Frame = 2
Query: 2876 IRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQ---EESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRA-KLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYF-KNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAH-EHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEA-GLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTSFAQNT 7132
            I+QSYEFF++LY RFL   K  MKC+CL A+SIVYGRCH+EIGP  D +  + +LER T++LERDRL+L L KLI+NK N++ I+D+NGIR+LVDL+T+AH+H +RA +P QSNVIEAA D + + +   KEW++   +KE+ GP SF E+ +  ++G + P  + WAQG+D WR    +PQ++W    L  GQAV   +++A+  L++L+ +C  +PS+DQ   IIRP+P+ K+ +T    L HI QLLLTFDP LVEK+++LL  +  +NP   R Y+TGVF+FI+MY GSNVL IA FLK TH  QAFR +ES K  +I  RSI+G+ILPEAM+C+LEN+  E+F++I+LG++DTPE IW+SEMRR MIEKIA HL +F+PRL SN RA YQY  IP+I+YPQLENELFC  YYL+H CDT++FPDWPI+ PV LL+D L+AWK E+EKKPP+MS+ +AYEVL L           SR Q   +ES IRKAYF+L+ KYHPD+NP+GR+ FEK+N AY+FLC ++ K+  GPDP+NI L+LK+QSILF R +++++ +KY+GYPMLI+TI  ET DEQLF K   LL    ELAYHTVN SALNAEELRR++GI+ LQ  FSRCV+++TASS   D  V+VCG+I   +SVAAQFE CR++I E+P I +DL R+LY+ K + +L+++   CV+  + D WLQT + + G ++HLL Y F +D+TLEE G+ ++E+ ++QE+ N LA L++LA++RL G ++ + +     +PEN  +R+ L  MLTPYI RK+      ++S   ILK+L SN+E+PYL W+N TR+EL +YLESQQES+++  +CD  +GA+F +S + KELI+G++F+R+YNEQ  F LE P++F   LL ++ S+ +Y+   +   Q           G V  +  V  R Q+++ AL AL NVI  NP    + IGHFK+LFSL+       +Q+ A+EVV  VTS+++C+ +I  S VL  L+ LL SL ++  L+L T+  + S T ++KE + +G LIY L + C+S    V+   A L  KM++DKL+G ++R +L++FLP +F+D+M+DNPE  VH+++  HENPELIWN+++R+ +ST V E    +F++Q ++ +  W +PDDF V Y       L VGGV+L ++++ P W LR P EF   L  K+ ++++K++     AH E LE  T+A   L ++   L+D++P  G++ K+ Q ++  + + P  K  + + + +++++LCV ++A+++TI PLM  MK R D +G A E L R+FQ    EL+AQA+K+ LV Y+L LLE  GL N++ P   KA  VKALK+M RS  +G QV  +L  SS+WS FKDQ HDL+++ + Q AGYLTG  V  AGYLT+ + +T
Sbjct:  850 IKQSYEFFNELYHRFLLTPKVNMKCLCLQALSIVYGRCHEEIGPFGDTKYIVGMLERCTDRLERDRLILFLNKLILNKKNVKDIMDSNGIRILVDLLTLAHLHTSRATVPLQSNVIEAAPDMKRESE---KEWYFGNADKERSGPYSFVEMQEFWNKGILSPKTRCWAQGMDGWRPLQVIPQLKWC--LLAAGQAVLNETDLATLILNMLITMCSYFPSRDQDNAIIRPLPKVKRLLTDNTCLPHITQLLLTFDPILVEKVSILLYHIMQDNPQLPRFYLTGVFFFIMMYTGSNVLPIARFLKHTHAKQAFRTEES-KGPDIFQRSILGHILPEAMVCYLENYEPEKFSEIFLGEFDTPEAIWSSEMRRLMIEKIAAHLADFSPRLQSNTRALYQYCPIPVINYPQLENELFCNIYYLKHFCDTLKFPDWPIKDPVKLLKDTLEAWKKEVEKKPPTMSIDDAYEVLGL-----------SRGQGQYDESKIRKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSKKVVDGPDPENIILILKTQSILFNRHKEDLQPYKYAGYPMLIRTITMETSDEQLFSK-VSLLPAATELAYHTVNCSALNAEELRRENGIEVLQDGFSRCVSVLTASSKPDDMPVQVCGHICKCYSVAAQFETCREKITEMPNIIKDLCRVLYYGKRVQRLAAMAVECVSSFAVDYWLQTHLLQAGVLWHLLAYPFNYDFTLEESGIQKNEDTNQQEVANSLAKLSLLALSRLGGYLSGDQE-----TPENPVLRKSLAGMLTPYIARKLT-----VSSPTEILKMLNSNTESPYLLWNNGTRAELLEYLESQQESMVRRGDCDVSYGADFVYSEHSKELIVGDIFVRIYNEQPTFQLELPKAFAASLLDYIGSQAQYLHTLMALTQ----------TGKVESDQHV-DRLQRVEMALEALRNVIKHNPGSETECIGHFKLLFSLLRVHGAGKVQQLALEVVNIVTSNQDCVNNIAESMVLSSLLSLLHSLPTSRQLVLATLYALTSSTKIIKEAMAKGALIYLLDMFCNSTHPQVRSQTAELFAKMISDKLIGPKVRIVLMKFLPGVFMDAMRDNPEAAVHIFEGTHENPELIWNDNSRERVSTTVREMMLEHFKQQVENPDANWKLPDDFTVAYGEAQG-ELLVGGVFLRIFIAQPAWVLRKPREFLVALLEKFTELLEKNN-----AHGETLETITNATVCLFSAQPQLMDQVPPLGHLPKILQAMSHKNNAVP--KCAIRVIHILTDNELCVRSLASLDTIGPLMSGMKKRSDMIGFACEALNRMFQKEQTELVAQALKVDLVPYLLRLLEGQGLENLESPAATKAQIVKALKSMTRSLQYGEQVNEILTRSSVWSAFKDQKHDLFISES-QTAGYLTGPGV--AGYLTAGSSST 2225          

HSP 2 Score: 849.351 bits (2193), Expect = 0.000e+0
Identity = 429/874 (49.08%), Postives = 583/874 (66.70%), Query Frame = 2
Query:   32 MNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTH------MQEIQRKNKEAWRIVEK----KIDNLLMHWRSKIGINMKPMK-DKDEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVG 2620
            + +N D  C+  TKH+WRG YKR+ ++G+  ITTY+  TL+VTNQWPY +IC I P  K  +  +F L  R+   KK + ++FS++ R  +L EA+ +   F E      + N  K  W++    V LEV    + QIDP+ +RV+  Y Y++IE   ++S +  GF I   GFSRLH+F +  R+E I++  E A N + I L   KE +  +Y +  R+GKYS DE ITS AEF+VQK+ +       PV+R+L LTETCL+ERDP TY ++TL+PL +IFAL+ DP+ PQ F +E++ G  R Y ST+RDSLLASLLDG R+SGNRDVCVKM  T R  R+G L VP++EEVES H++ L   P G  F +AVFRFNAN+SYSG+LHAVTQ+GLF+ENKEKLI  A+++L+++EG +   S  +LE+QF A+RRLVASKAGF AFTQL K RE LG KVV AL+RNN+ VTHAAID + AL+ PMH++YD+RQEQLNKAS++SS KFL+NLL+ F+LHV  GTGALVIS +LDFLTF +C PY ET++G+ FD LL++V+  GR +FKLF HPS+A+VKGA L+M+A+I+EAD  +   MQ LAL+EGALP+HL  S F  + DQR L  RQL+R L+ LW   N  +  LLKR+LPPGL+ YL+ST+  P  ++D +  RDN+++A         + E QR   +A + VEK    K+D +L+HWR ++GI  K +  +  +KPV LRKRR+RIK+  NW +F+Y+F+QDHA+ NL+WN KTREE RD LE E+  F  +R+                                        +  +  +SWN+ EF++ Y CL  EIK+G
Sbjct:    4 IRENKDLACFYTTKHSWRGKYKRVFSIGTHAITTYNPNTLEVTNQWPYGDICGISPVGKG-QGTEFALTFRKGSGKKSETLKFSTEHRTELLTEALRFRTDFSEGKITGRRYNCYKHHWSDTRKLVTLEVTPGGIDQIDPSNNRVLCTYDYRNIEGFTEVSGYQGGFCILYGGFSRLHLFASEQREEIIKSAIEHAGNFIGITLRTRKEPVDFEYYVSLRLGKYSNDESITSLAEFIVQKITSRH---TEPVKRLLALTETCLLERDPATYNIVTLKPLGEIFALVYDPENPQIFTVEFIKGQIRKYSSTERDSLLASLLDGVRASGNRDVCVKMTPTQRGQRWGLLSVPVDEEVESLHLRFLTTPPNG-NFADAVFRFNANISYSGVLHAVTQDGLFSENKEKLINNAITSLLSQEG-ELAASNAELESQFQAVRRLVASKAGFLAFTQLPKFRERLGVKVVKALKRNNDGVTHAAIDMLCALMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFNLHVNYGTGALVISSLLDFLTFALCAPYSETTEGQQFDMLLEMVASNGRTLFKLFQHPSMAVVKGAGLVMKAIIEEADKEIATKMQELALSEGALPRHLHTSMFTISADQRMLTNRQLSRHLVGLWTADNTTSLNLLKRILPPGLLAYLDSTDPVPEKDIDRMHIRDNLKIASDQYGKFNKIPEWQRIAGKAAKEVEKFAKEKVDLVLLHWRDRMGIAQKEVNINTAQKPVILRKRRQRIKIELNWDLFYYRFHQDHARSNLIWNFKTREELRDTLEAEMRAFNVDRE----------------------------------------LGSSTVISWNHQEFEVKYDCLSEEIKIG 831          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Xenopus
Match: smad3 (SMAD family member 3 [Source:Xenbase;Acc:XB-GENE-481992])

HSP 1 Score: 1318.14 bits (3410), Expect = 0.000e+0
Identity = 685/1410 (48.58%), Postives = 983/1410 (69.72%), Query Frame = 2
Query: 2876 IRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQ---EESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRA-KLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAH-EHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEA-GLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGR 7087
            I+QSYEFF++LY RFL   K  MKC+CL A+SIVYGRCH+EIGP  D +  + +LER T++LERDRL+L L KLI+NK N++ I+D+NGIR+LVDL+T+AH+H +RA +P QSNVIEAA D + + +   KEW++   +KE+ GP SF E+ +  ++G + P  + WAQG+D WR    +PQ++W    L  GQAV   +++A+  L++L+ +C  +PS+DQ   IIRP+P+ K+ +T    L HI QLLLTFDP LVEK+++LL  +  +NP   R Y+TGVF+FI+MY GSNVL IA FLK TH  QAFR +ES K  +I  RSI+G+ILPEAM+C+LEN+  E+F++I+LG++DTPE IW+SEMRR MIEKIA HL +F+PRL SN RA YQY  IP+I+YPQLENELFC  YYL+H CDT++FPDWPI+ PV LL+D L+AWK E+EKKPP+MS+ +AYEVL L           SR Q   +ES IRKAYF+L+ KYHPD+NP+GR+ FEK+N AY+FLC ++ K+  GPDP+NI L+LK+QSILF R +++++ +KY+GYPMLI+TI  ET DEQLF K   LL    ELAYHTVN SALNAEELRR++GI+ LQ  FSRCV+++TASS   D  V+VCG+I   +SVAAQFE CR++I E+P I +DL R+LY+  + +L+++   CV+  + D WLQT + + G ++HLL Y F +D+TLEE G+ ++E+ ++QE+ N LA L++LA++RL G ++ + +     +PEN  +R+ L  MLTPYI RK+      ++S   ILK+L SN+E+PYL W+N TR+EL +YLESQQES+++  +CD  +GA+F +S + KELI+G++F+R+YNEQ  F LE P++F   LL ++ S+ +Y+   +   Q           G V  +  V  R Q+++ AL AL NVI  NP    + IGHFK+LFSL+       +Q+ A+EVV  VTS+++C+ +I  S VL  L+ LL SL ++  L+L T+  + S T ++KE + +G LIY L + C+S    V+   A L  KM++DKL+G ++R +L++FLP +F+D+M+DNPE  VH+++  HENPELIWN+++R+ +ST V E    +F++Q ++ +  W +PDDF V Y       L VGGV+L ++++ P W LR P EF   L  K+ ++++K++     AH E LE  T+A   L ++   L+D++P  G++ K+ Q ++  + + P  K  + + + +++++LCV ++A+++TI PLM  MK R D +G A E L R+FQ    EL+AQA+K+ LV Y+L LLE  GL N++ P   KA  VKALK+M RS  +G QV  +L  SS+WS FKDQ HDL+++ + Q AGYLTG+
Sbjct:  850 IKQSYEFFNELYHRFLLTPKVNMKCLCLQALSIVYGRCHEEIGPFGDTKYIVGMLERCTDRLERDRLILFLNKLILNKKNVKDIMDSNGIRILVDLLTLAHLHTSRATVPLQSNVIEAAPDMKRESE---KEWYFGNADKERSGPYSFVEMQEFWNKGILSPKTRCWAQGMDGWRPLQVIPQLKWC--LLAAGQAVLNETDLATLILNMLITMCSYFPSRDQDNAIIRPLPKVKRLLTDNTCLPHITQLLLTFDPILVEKVSILLYHIMQDNPQLPRFYLTGVFFFIMMYTGSNVLPIARFLKHTHAKQAFRTEES-KGPDIFQRSILGHILPEAMVCYLENYEPEKFSEIFLGEFDTPEAIWSSEMRRLMIEKIAAHLADFSPRLQSNTRALYQYCPIPVINYPQLENELFCNIYYLKHFCDTLKFPDWPIKDPVKLLKDTLEAWKKEVEKKPPTMSIDDAYEVLGL-----------SRGQGQYDESKIRKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSKKVVDGPDPENIILILKTQSILFNRHKEDLQPYKYAGYPMLIRTITMETSDEQLFSK-VSLLPAATELAYHTVNCSALNAEELRRENGIEVLQDGFSRCVSVLTASSKPDDMPVQVCGHICKCYSVAAQFETCREKITEMPNIIKDLCRVLYYGKVSRLAAMAVECVSSFAVDYWLQTHLLQAGVLWHLLAYPFNYDFTLEESGIQKNEDTNQQEVANSLAKLSLLALSRLGGYLSGDQE-----TPENPVLRKSLAGMLTPYIARKLT-----VSSPTEILKMLNSNTESPYLLWNNGTRAELLEYLESQQESMVRRGDCDVSYGADFVYSEHSKELIVGDIFVRIYNEQPTFQLELPKAFAASLLDYIGSQAQYLHTLMALTQ----------TGKVESDQHV-DRLQRVEMALEALRNVIKHNPGSETECIGHFKLLFSLLRVHGAGKVQQLALEVVNIVTSNQDCVNNIAESMVLSSLLSLLHSLPTSRQLVLATLYALTSSTKIIKEAMAKGALIYLLDMFCNSTHPQVRSQTAELFAKMISDKLIGPKVRIVLMKFLPGVFMDAMRDNPEAAVHIFEGTHENPELIWNDNSRERVSTTVREMMLEHFKQQVENPDANWKLPDDFTVAYGEAQG-ELLVGGVFLRIFIAQPAWVLRKPREFLVALLEKFTELLEKNN-----AHGETLETITNATVCLFSAQPQLMDQVPPLGHLPKILQAMSHKNNAVP--KCAIRVIHILTDNELCVRSLASLDTIGPLMSGMKKRSDMIGFACEALNRMFQKEQTELVAQALKVDLVPYLLRLLEGQGLENLESPAATKAQIVKALKSMTRSLQYGEQVNEILTRSSVWSAFKDQKHDLFISES-QTAGYLTGK 2211          

HSP 2 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 429/874 (49.08%), Postives = 583/874 (66.70%), Query Frame = 2
Query:   32 MNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTH------MQEIQRKNKEAWRIVEK----KIDNLLMHWRSKIGINMKPMK-DKDEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVG 2620
            + +N D  C+  TKH+WRG YKR+ ++G+  ITTY+  TL+VTNQWPY +IC I P  K  +  +F L  R+   KK + ++FS++ R  +L EA+ +   F E      + N  K  W++    V LEV    + QIDP+ +RV+  Y Y++IE   ++S +  GF I   GFSRLH+F +  R+E I++  E A N + I L   KE +  +Y +  R+GKYS DE ITS AEF+VQK+ +       PV+R+L LTETCL+ERDP TY ++TL+PL +IFAL+ DP+ PQ F +E++ G  R Y ST+RDSLLASLLDG R+SGNRDVCVKM  T R  R+G L VP++EEVES H++ L   P G  F +AVFRFNAN+SYSG+LHAVTQ+GLF+ENKEKLI  A+++L+++EG     +A+ LE+QF A+RRLVASKAGF AFTQL K RE LG KVV AL+RNN+ VTHAAID + AL+ PMH++YD+RQEQLNKAS++SS KFL+NLL+ F+LHV  GTGALVIS +LDFLTF +C PY ET++G+ FD LL++V+  GR +FKLF HPS+A+VKGA L+M+A+I+EAD  +   MQ LAL+EGALP+HL  S F  + DQR L  RQL+R L+ LW   N  +  LLKR+LPPGL+ YL+ST+  P  ++D +  RDN+++A         + E QR   +A + VEK    K+D +L+HWR ++GI  K +  +  +KPV LRKRR+RIK+  NW +F+Y+F+QDHA+ NL+WN KTREE RD LE E+  F  +R+                                        +  +  +SWN+ EF++ Y CL  EIK+G
Sbjct:    4 IRENKDLACFYTTKHSWRGKYKRVFSIGTHAITTYNPNTLEVTNQWPYGDICGISPVGKG-QGTEFALTFRKGSGKKSETLKFSTEHRTELLTEALRFRTDFSEGKITGRRYNCYKHHWSDTRKLVTLEVTPGGIDQIDPSNNRVLCTYDYRNIEGFTEVSGYQGGFCILYGGFSRLHLFASEQREEIIKSAIEHAGNFIGITLRTRKEPVDFEYYVSLRLGKYSNDESITSLAEFIVQKITSRH---TEPVKRLLALTETCLLERDPATYNIVTLKPLGEIFALVYDPENPQIFTVEFIKGQIRKYSSTERDSLLASLLDGVRASGNRDVCVKMTPTQRGQRWGLLSVPVDEEVESLHLRFLTTPPNG-NFADAVFRFNANISYSGVLHAVTQDGLFSENKEKLINNAITSLLSQEGELAASNAE-LESQFQAVRRLVASKAGFLAFTQLPKFRERLGVKVVKALKRNNDGVTHAAIDMLCALMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFNLHVNYGTGALVISSLLDFLTFALCAPYSETTEGQQFDMLLEMVASNGRTLFKLFQHPSMAVVKGAGLVMKAIIEEADKEIATKMQELALSEGALPRHLHTSMFTISADQRMLTNRQLSRHLVGLWTADNTTSLNLLKRILPPGLLAYLDSTDPVPEKDIDRMHIRDNLKIASDQYGKFNKIPEWQRIAGKAAKEVEKFAKEKVDLVLLHWRDRMGIAQKEVNINTAQKPVILRKRRQRIKIELNWDLFYYRFHQDHARSNLIWNFKTREELRDTLEAEMRAFNVDRE----------------------------------------LGSSTVISWNHQEFEVKYDCLSEEIKIG 831          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Xenopus
Match: smad3 (SMAD family member 3 [Source:Xenbase;Acc:XB-GENE-481992])

HSP 1 Score: 1311.98 bits (3394), Expect = 0.000e+0
Identity = 691/1426 (48.46%), Postives = 985/1426 (69.07%), Query Frame = 2
Query: 2876 IRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQ---EESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRA-KLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESL-QSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAH-EHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEA-GLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTSFAQNT 7132
            I+QSYEFF++LY RFL   K  MKC+CL A+SIVYGRCH+EIGP  D +  + +LER T++LERDRL+L L KLI+NK N++ I+D+NGIR+LVDL+T+AH+H +RA +P QSNVIEAA D + + +   KEW++   +KE+ GP SF E+ +  ++G + P  + WAQG+D WR    +PQ++W    L  GQAV   +++A+  L++L+ +C  +PS+DQ   IIRP+P+ K+ +T    L HI QLLLTFDP LVEK+++LL  +  +NP   R Y+TGVF+FI+MY GSNVL IA FLK TH  QAFR +ES K  +I  RSI+G+ILPEAM+C+LEN+  E+F++I+LG++DTPE IW+SEMRR MIEKIA HL +F+PRL SN RA YQY  IP+I+YPQLENELFC  YYL+H CDT++FPDWPI+ PV LL+D L+AWK E+EKKPP+MS+ +AYEVL L           SR Q   +ES IRKAYF+L+ KYHPD+NP+GR+ FEK+N AY+FLC ++ K+  GPDP+NI L+LK+QSILF R +++++ +KY+GYPMLI+TI  ET DEQLF K   LL    ELAYHTVN SALNAEELRR++GI+ LQ  FSRCV+++TASS   D  V+VCG+I   +SVAAQFE CR++I E+P I +DL R+LY+  + +L+++   CV+  + D WLQT + + G ++HLL Y F +D+TLEE G+ ++E+ ++QE+ N LA L++LA++RL G ++ + +     +PEN  +R+ L  MLTPYI RK+      ++S   ILK+L SN+E+PYL W+N TR+EL +YLESQQES+++  +CD  +GA+F +S + KELI+G++F+R+YNEQ  F LE P++F   LL ++ S+ +Y+   +   Q           G V  +  V  R Q+++ AL AL NVI  NP    + IGHFK+LFSL+       +Q+ A+EVV  VTS+++C+ +I  S VL  L+ LL SL  SN + I + I     V S     +  G LIY L + C+S    V+   A L  KM++DKL+G ++R +L++FLP +F+D+M+DNPE  VH+++  HENPELIWN+++R+ +ST V E    +F++Q ++ +  W +PDDF V Y       L VGGV+L ++++ P W LR P EF   L  K+ ++++K++     AH E LE  T+A   L ++   L+D++P  G++ K+ Q ++  + + P  K  + + + +++++LCV ++A+++TI PLM  MK R D +G A E L R+FQ    EL+AQA+K+ LV Y+L LLE  GL N++ P   KA  VKALK+M RS  +G QV  +L  SS+WS FKDQ HDL+++ + Q AGYLTG  V  AGYLT+ + +T
Sbjct:  850 IKQSYEFFNELYHRFLLTPKVNMKCLCLQALSIVYGRCHEEIGPFGDTKYIVGMLERCTDRLERDRLILFLNKLILNKKNVKDIMDSNGIRILVDLLTLAHLHTSRATVPLQSNVIEAAPDMKRESE---KEWYFGNADKERSGPYSFVEMQEFWNKGILSPKTRCWAQGMDGWRPLQVIPQLKWC--LLAAGQAVLNETDLATLILNMLITMCSYFPSRDQDNAIIRPLPKVKRLLTDNTCLPHITQLLLTFDPILVEKVSILLYHIMQDNPQLPRFYLTGVFFFIMMYTGSNVLPIARFLKHTHAKQAFRTEES-KGPDIFQRSILGHILPEAMVCYLENYEPEKFSEIFLGEFDTPEAIWSSEMRRLMIEKIAAHLADFSPRLQSNTRALYQYCPIPVINYPQLENELFCNIYYLKHFCDTLKFPDWPIKDPVKLLKDTLEAWKKEVEKKPPTMSIDDAYEVLGL-----------SRGQGQYDESKIRKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSKKVVDGPDPENIILILKTQSILFNRHKEDLQPYKYAGYPMLIRTITMETSDEQLFSK-VSLLPAATELAYHTVNCSALNAEELRRENGIEVLQDGFSRCVSVLTASSKPDDMPVQVCGHICKCYSVAAQFETCREKITEMPNIIKDLCRVLYYGKVSRLAAMAVECVSSFAVDYWLQTHLLQAGVLWHLLAYPFNYDFTLEESGIQKNEDTNQQEVANSLAKLSLLALSRLGGYLSGDQE-----TPENPVLRKSLAGMLTPYIARKLT-----VSSPTEILKMLNSNTESPYLLWNNGTRAELLEYLESQQESMVRRGDCDVSYGADFVYSEHSKELIVGDIFVRIYNEQPTFQLELPKAFAASLLDYIGSQAQYLHTLMALTQ----------TGKVESDQHV-DRLQRVEMALEALRNVIKHNPGSETECIGHFKLLFSLLRVHGAGKVQQLALEVVNIVTSNQDCVNNIAESMVLSSLLSLLHSLPTSNMLGIREVIHNAKCVIS--DNFLLSGALIYLLDMFCNSTHPQVRSQTAELFAKMISDKLIGPKVRIVLMKFLPGVFMDAMRDNPEAAVHIFEGTHENPELIWNDNSRERVSTTVREMMLEHFKQQVENPDANWKLPDDFTVAYGEAQG-ELLVGGVFLRIFIAQPAWVLRKPREFLVALLEKFTELLEKNN-----AHGETLETITNATVCLFSAQPQLMDQVPPLGHLPKILQAMSHKNNAVP--KCAIRVIHILTDNELCVRSLASLDTIGPLMSGMKKRSDMIGFACEALNRMFQKEQTELVAQALKVDLVPYLLRLLEGQGLENLESPAATKAQIVKALKSMTRSLQYGEQVNEILTRSSVWSAFKDQKHDLFISES-QTAGYLTGPGV--AGYLTAGSSST 2223          

HSP 2 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 429/874 (49.08%), Postives = 583/874 (66.70%), Query Frame = 2
Query:   32 MNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTH------MQEIQRKNKEAWRIVEK----KIDNLLMHWRSKIGINMKPMK-DKDEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVG 2620
            + +N D  C+  TKH+WRG YKR+ ++G+  ITTY+  TL+VTNQWPY +IC I P  K  +  +F L  R+   KK + ++FS++ R  +L EA+ +   F E      + N  K  W++    V LEV    + QIDP+ +RV+  Y Y++IE   ++S +  GF I   GFSRLH+F +  R+E I++  E A N + I L   KE +  +Y +  R+GKYS DE ITS AEF+VQK+ +       PV+R+L LTETCL+ERDP TY ++TL+PL +IFAL+ DP+ PQ F +E++ G  R Y ST+RDSLLASLLDG R+SGNRDVCVKM  T R  R+G L VP++EEVES H++ L   P G  F +AVFRFNAN+SYSG+LHAVTQ+GLF+ENKEKLI  A+++L+++EG     +A+ LE+QF A+RRLVASKAGF AFTQL K RE LG KVV AL+RNN+ VTHAAID + AL+ PMH++YD+RQEQLNKAS++SS KFL+NLL+ F+LHV  GTGALVIS +LDFLTF +C PY ET++G+ FD LL++V+  GR +FKLF HPS+A+VKGA L+M+A+I+EAD  +   MQ LAL+EGALP+HL  S F  + DQR L  RQL+R L+ LW   N  +  LLKR+LPPGL+ YL+ST+  P  ++D +  RDN+++A         + E QR   +A + VEK    K+D +L+HWR ++GI  K +  +  +KPV LRKRR+RIK+  NW +F+Y+F+QDHA+ NL+WN KTREE RD LE E+  F  +R+                                        +  +  +SWN+ EF++ Y CL  EIK+G
Sbjct:    4 IRENKDLACFYTTKHSWRGKYKRVFSIGTHAITTYNPNTLEVTNQWPYGDICGISPVGKG-QGTEFALTFRKGSGKKSETLKFSTEHRTELLTEALRFRTDFSEGKITGRRYNCYKHHWSDTRKLVTLEVTPGGIDQIDPSNNRVLCTYDYRNIEGFTEVSGYQGGFCILYGGFSRLHLFASEQREEIIKSAIEHAGNFIGITLRTRKEPVDFEYYVSLRLGKYSNDESITSLAEFIVQKITSRH---TEPVKRLLALTETCLLERDPATYNIVTLKPLGEIFALVYDPENPQIFTVEFIKGQIRKYSSTERDSLLASLLDGVRASGNRDVCVKMTPTQRGQRWGLLSVPVDEEVESLHLRFLTTPPNG-NFADAVFRFNANISYSGVLHAVTQDGLFSENKEKLINNAITSLLSQEGELAASNAE-LESQFQAVRRLVASKAGFLAFTQLPKFRERLGVKVVKALKRNNDGVTHAAIDMLCALMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFNLHVNYGTGALVISSLLDFLTFALCAPYSETTEGQQFDMLLEMVASNGRTLFKLFQHPSMAVVKGAGLVMKAIIEEADKEIATKMQELALSEGALPRHLHTSMFTISADQRMLTNRQLSRHLVGLWTADNTTSLNLLKRILPPGLLAYLDSTDPVPEKDIDRMHIRDNLKIASDQYGKFNKIPEWQRIAGKAAKEVEKFAKEKVDLVLLHWRDRMGIAQKEVNINTAQKPVILRKRRQRIKIELNWDLFYYRFHQDHARSNLIWNFKTREELRDTLEAEMRAFNVDRE----------------------------------------LGSSTVISWNHQEFEVKYDCLSEEIKIG 831          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Mouse
Match: Dnajc13 (DnaJ heat shock protein family (Hsp40) member C13 [Source:MGI Symbol;Acc:MGI:2676368])

HSP 1 Score: 1339.71 bits (3466), Expect = 0.000e+0
Identity = 687/1417 (48.48%), Postives = 981/1417 (69.23%), Query Frame = 2
Query: 2876 IRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRA-KLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYF-KNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEA-GLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTS 7117
            I++SYEFF++LY RFL   K  MKC+CL A++IVYGRCH+EIGP  D    I +LER T++LERDRL+L L KLI+NK N++ ++D+NGIR+LVDL+T+AH+HV+RA +P QSNVIEA+ D + + +   KEW++   +KE+ GP  F E+ +L  +G +    + WAQG+D WR   ++PQ++W    L +GQAV   +++A+  L++L+ +C  +PS+DQ   IIRP+PR K+ ++    L H++QLLLTFDP LVEK+A+LL+ +  +NP   RLY++GVF+FI+MY GSNVL +A FLK TH  QAF+++E+ K  +I  RSI+G+ILPEAM+C+LEN+  E+F++I+LG++DTPE IW+SEMRR MIEKIA HL +FTPRL SN RA YQY  IP+I+YPQLENELFC  YYL+ LCDT+RFPDWPI+ PV LL+D L AWK E+EKKPP MS+ +AYEVL L   + L         +ES IRKAYF+L+ KYHPD+NP+GR+ FEK+N AY+FLC ++ K+  GPDP+NI L+LK+QSILF R ++E++ +KY+GYPMLI+TI  ET D+ LF KE+PLL   AELA+HTVN SALNAEELRR++G++ LQ AFSRCV ++  SS  SD SV+VCG+I+  +SVAAQFE CR++I E+P I +DL R+LYF K +P++++L   CV+  + D WLQT +F+ G +++LL Y+F +DYTLEE G+ ++EE ++QE+ N LA L++ A++RL G ++E+       +PEN  VR+ L  MLTPYI RK+A     + S    LK+L SN+E+PYL W+N TR+EL ++LESQQE++IK  +CD  +GAEF +S + KELI+GE+F+R+YNE   F LE P+ F   LL ++ S+ +Y+            T +  ++     + +   R  +++ AL AL NVI  NP    + IGHFK++FSL+       +Q+ A+EVV  VTS+++C+ +I  S VL +L+ LL SL S+  L+L+T+  + S T ++KE + +G LIY L + C+S    V+   A L  KM  DKL+G ++R  L++FLP +F+D+M+DNPE  VH+++  HENPELIWN+ +R  +ST V E    +F+ Q  + +  W +P+DF V +       L+VGGV+L ++++ P W LR P EF         + + +     +   E LE  T A   L ++   L D++P  G++ KV Q +N  + + P  K+ + + + +S+++LCV  MA++ETI PLM  M+ R D +GLA E + R+FQ    EL+AQA+K +LV Y+L LLE  GL N+  P   KA  VKALKAM RS  +G QV+ +L  SS+WS FKDQ HDL+++++ Q AGYLTG  V  AGYLT+
Sbjct:  852 IKRSYEFFNELYHRFLLTPKVNMKCLCLQALAIVYGRCHEEIGPFTDTRYIIGMLERCTDKLERDRLILFLNKLILNKKNVKDLMDSNGIRILVDLLTLAHLHVSRATVPLQSNVIEASPDMKRESE---KEWYFGNADKERSGPYGFHEMQELWAKGMLNAKTRCWAQGMDGWRPLQAIPQLKWC--LLASGQAVLNETDLATLILNMLITMCGYFPSRDQDNAIIRPLPRVKRLLSDSTCLPHVIQLLLTFDPILVEKVAILLHHIMQDNPQLPRLYLSGVFFFIMMYTGSNVLPVARFLKYTHSKQAFKSEET-KGQDIFQRSILGHILPEAMVCYLENYEPEKFSEIFLGEFDTPEAIWSSEMRRLMIEKIAAHLADFTPRLQSNTRALYQYCPIPVINYPQLENELFCNIYYLKQLCDTLRFPDWPIKDPVKLLKDSLDAWKKEVEKKPPMMSIDDAYEVLNLPIGQGL--------HDESKIRKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSTKIVDGPDPENIILILKTQSILFNRHKEELQPYKYAGYPMLIRTITMETSDDLLFSKESPLLPAAAELAFHTVNCSALNAEELRRENGLEVLQEAFSRCVAVLNRSSKPSDMSVQVCGHISRCYSVAAQFEECREKITEMPGIIKDLCRVLYFGKCIPRVAALAVECVSSFAVDFWLQTHLFQAGILWYLLVYLFNYDYTLEESGIQKNEETNQQEVANSLAKLSVHALSRLGGYLSEDQA-----TPENPTVRKSLAGMLTPYIARKLA-----VASATETLKMLNSNTESPYLMWNNSTRAELLEFLESQQENMIKKGDCDKTYGAEFVYSEHAKELIVGEIFVRVYNEVPTFQLEVPKEFAASLLDYIGSQAQYLH-----------TFMAITHAAKVESEQHGDRLPRVEMALEALRNVIKYNPGSESECIGHFKLIFSLLRVHGAGQVQQLALEVVNIVTSNQDCVNNIAESMVLSNLLALLHSLPSSRQLVLETLYALASNTKIIKEAMAKGALIYLLDMFCNSTHPQVRSQTAELFAKMTADKLIGPKVRITLMKFLPSVFMDAMRDNPEAAVHIFEGTHENPELIWNDSSRDKVSTTVREMMLEHFKNQRDNPDVNWKLPEDFAVVFGEAEG-ELAVGGVFLRIFIAQPAWVLRKPREF----LIALLEKLTELLEKNNPHGETLETLTMATVCLFSAQPQLADQVPPLGHLPKVIQAMNHRNNAIP--KSAIRVIHVLSDNELCVRAMASLETIGPLMNGMRKRADTVGLACEAINRMFQKEQSELVAQALKAELVPYLLKLLEGVGLENLDSPAATKAQIVKALKAMTRSLQYGEQVSEILSRSSVWSAFKDQKHDLFISDS-QTAGYLTGPGV--AGYLTA 2223          

HSP 2 Score: 836.254 bits (2159), Expect = 0.000e+0
Identity = 427/876 (48.74%), Postives = 580/876 (66.21%), Query Frame = 2
Query:   32 MNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTH------MQEIQRKNKEAWRIVEK----KIDNLLMHWRSKIGINMKPMKDK---DEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVG 2620
            + +N D  C+  TKH+WRG YKR+ ++G+  +TTY+  TL+VTNQWPY +ICSI P  K  +  +F L  R+   KK + ++FS++ R  +L EA+ +   F E      + N  K  W++   PV+LEV      QI+P T+RV+  Y Y++IE    +SD+  GF I   GFSRLH+F +  R+E I++  E A N + I L   KE +  +  L  R GKYS DE ITS AEF+VQK++        PV+R+L +TETCLVERDP TY + TL+PL ++FAL+ D + PQ F IE++ G  R Y ST+RDSLLASLLDG R+SGNRDVCVKM  T +  R+G L +P++EEVES H++ L   P G  F +AVFRFNAN+SYSG+LHAVTQ+GLF+ENKEKLI  A++AL+++EG+    +A+ LE+QF A+RRLVASKAGF AFTQL K RE LG KVV AL+R+N  V HAA+D + AL+ PMH++YD+RQEQLNKAS++SS KFL+NLL+ F+ HV  GTGALVIS +LDFLTF +C PY ET++G+ FD LL++V+  GR +FKLF HPS+AIVKGA L+M+A+I+E D  +   MQ LAL+EGALP+HL  + F  ++DQR L  RQL+R L+ LW   N  A  LLKR+LPPGL+ YL+S++  P  + D +  RDN+++A         + E QR   +A + VEK    K+D +LMHWR ++GI  K  K+    ++KPV LRKRR+RIK+  NW +F+Y+F QDHA+ NL+WN KTREE +DALE E+  F  +R+                                        +  A+ +SWN+ EF++ Y CL  EIK+G
Sbjct:    4 IRENKDLACFYTTKHSWRGKYKRVFSVGTHAVTTYNPNTLEVTNQWPYGDICSISPVGKG-QGTEFNLTFRKGSGKKSETLKFSTEHRTELLTEALRFRTDFAEGKITGRRYNCYKHHWSDAKKPVVLEVTPGGFDQINPVTNRVLCSYDYRNIEGFVDLSDYQGGFCILYGGFSRLHLFSSEQREEIIKSAIEHAGNYIGISLRIRKEPLEFEQYLNLRFGKYSTDESITSLAEFVVQKISPRH---SEPVKRVLAVTETCLVERDPATYNIATLKPLGEVFALVCDSENPQLFTIEFIKGQVRKYSSTERDSLLASLLDGVRASGNRDVCVKMAPTHKGQRWGLLSMPIDEEVESLHLRFLAAPPNG-NFADAVFRFNANISYSGVLHAVTQDGLFSENKEKLINNAITALLSQEGDVVASNAE-LESQFQAVRRLVASKAGFLAFTQLPKFRERLGMKVVKALKRSNNGVIHAAVDMLCALMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFNSHVDHGTGALVISSLLDFLTFALCAPYSETTEGQQFDMLLEMVASNGRTLFKLFQHPSMAIVKGAGLVMKAIIEEGDREIATKMQELALSEGALPRHLHTAMFTISSDQRMLTNRQLSRHLVGLWTADNTTATNLLKRILPPGLLAYLDSSDPVPEKDADRMHVRDNVKIAMDQYGKFNKVPEWQRLAGKAAKEVEKFAKEKVDLVLMHWRDRMGIAQKEDKNHMNINQKPVVLRKRRQRIKIEANWDLFYYRFSQDHARSNLIWNFKTREELKDALESEMRTFNIDRE----------------------------------------LGSASVISWNHHEFEVKYECLAEEIKIG 833          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Mouse
Match: Dnajc13 (DnaJ heat shock protein family (Hsp40) member C13 [Source:MGI Symbol;Acc:MGI:2676368])

HSP 1 Score: 1339.71 bits (3466), Expect = 0.000e+0
Identity = 687/1417 (48.48%), Postives = 981/1417 (69.23%), Query Frame = 2
Query: 2876 IRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRA-KLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYF-KNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEA-GLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTS 7117
            I++SYEFF++LY RFL   K  MKC+CL A++IVYGRCH+EIGP  D    I +LER T++LERDRL+L L KLI+NK N++ ++D+NGIR+LVDL+T+AH+HV+RA +P QSNVIEA+ D + + +   KEW++   +KE+ GP  F E+ +L  +G +    + WAQG+D WR   ++PQ++W    L +GQAV   +++A+  L++L+ +C  +PS+DQ   IIRP+PR K+ ++    L H++QLLLTFDP LVEK+A+LL+ +  +NP   RLY++GVF+FI+MY GSNVL +A FLK TH  QAF+++E+ K  +I  RSI+G+ILPEAM+C+LEN+  E+F++I+LG++DTPE IW+SEMRR MIEKIA HL +FTPRL SN RA YQY  IP+I+YPQLENELFC  YYL+ LCDT+RFPDWPI+ PV LL+D L AWK E+EKKPP MS+ +AYEVL L   + L         +ES IRKAYF+L+ KYHPD+NP+GR+ FEK+N AY+FLC ++ K+  GPDP+NI L+LK+QSILF R ++E++ +KY+GYPMLI+TI  ET D+ LF KE+PLL   AELA+HTVN SALNAEELRR++G++ LQ AFSRCV ++  SS  SD SV+VCG+I+  +SVAAQFE CR++I E+P I +DL R+LYF K +P++++L   CV+  + D WLQT +F+ G +++LL Y+F +DYTLEE G+ ++EE ++QE+ N LA L++ A++RL G ++E+       +PEN  VR+ L  MLTPYI RK+A     + S    LK+L SN+E+PYL W+N TR+EL ++LESQQE++IK  +CD  +GAEF +S + KELI+GE+F+R+YNE   F LE P+ F   LL ++ S+ +Y+            T +  ++     + +   R  +++ AL AL NVI  NP    + IGHFK++FSL+       +Q+ A+EVV  VTS+++C+ +I  S VL +L+ LL SL S+  L+L+T+  + S T ++KE + +G LIY L + C+S    V+   A L  KM  DKL+G ++R  L++FLP +F+D+M+DNPE  VH+++  HENPELIWN+ +R  +ST V E    +F+ Q  + +  W +P+DF V +       L+VGGV+L ++++ P W LR P EF         + + +     +   E LE  T A   L ++   L D++P  G++ KV Q +N  + + P  K+ + + + +S+++LCV  MA++ETI PLM  M+ R D +GLA E + R+FQ    EL+AQA+K +LV Y+L LLE  GL N+  P   KA  VKALKAM RS  +G QV+ +L  SS+WS FKDQ HDL+++++ Q AGYLTG  V  AGYLT+
Sbjct:  847 IKRSYEFFNELYHRFLLTPKVNMKCLCLQALAIVYGRCHEEIGPFTDTRYIIGMLERCTDKLERDRLILFLNKLILNKKNVKDLMDSNGIRILVDLLTLAHLHVSRATVPLQSNVIEASPDMKRESE---KEWYFGNADKERSGPYGFHEMQELWAKGMLNAKTRCWAQGMDGWRPLQAIPQLKWC--LLASGQAVLNETDLATLILNMLITMCGYFPSRDQDNAIIRPLPRVKRLLSDSTCLPHVIQLLLTFDPILVEKVAILLHHIMQDNPQLPRLYLSGVFFFIMMYTGSNVLPVARFLKYTHSKQAFKSEET-KGQDIFQRSILGHILPEAMVCYLENYEPEKFSEIFLGEFDTPEAIWSSEMRRLMIEKIAAHLADFTPRLQSNTRALYQYCPIPVINYPQLENELFCNIYYLKQLCDTLRFPDWPIKDPVKLLKDSLDAWKKEVEKKPPMMSIDDAYEVLNLPIGQGL--------HDESKIRKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSTKIVDGPDPENIILILKTQSILFNRHKEELQPYKYAGYPMLIRTITMETSDDLLFSKESPLLPAAAELAFHTVNCSALNAEELRRENGLEVLQEAFSRCVAVLNRSSKPSDMSVQVCGHISRCYSVAAQFEECREKITEMPGIIKDLCRVLYFGKCIPRVAALAVECVSSFAVDFWLQTHLFQAGILWYLLVYLFNYDYTLEESGIQKNEETNQQEVANSLAKLSVHALSRLGGYLSEDQA-----TPENPTVRKSLAGMLTPYIARKLA-----VASATETLKMLNSNTESPYLMWNNSTRAELLEFLESQQENMIKKGDCDKTYGAEFVYSEHAKELIVGEIFVRVYNEVPTFQLEVPKEFAASLLDYIGSQAQYLH-----------TFMAITHAAKVESEQHGDRLPRVEMALEALRNVIKYNPGSESECIGHFKLIFSLLRVHGAGQVQQLALEVVNIVTSNQDCVNNIAESMVLSNLLALLHSLPSSRQLVLETLYALASNTKIIKEAMAKGALIYLLDMFCNSTHPQVRSQTAELFAKMTADKLIGPKVRITLMKFLPSVFMDAMRDNPEAAVHIFEGTHENPELIWNDSSRDKVSTTVREMMLEHFKNQRDNPDVNWKLPEDFAVVFGEAEG-ELAVGGVFLRIFIAQPAWVLRKPREF----LIALLEKLTELLEKNNPHGETLETLTMATVCLFSAQPQLADQVPPLGHLPKVIQAMNHRNNAIP--KSAIRVIHVLSDNELCVRAMASLETIGPLMNGMRKRADTVGLACEAINRMFQKEQSELVAQALKAELVPYLLKLLEGVGLENLDSPAATKAQIVKALKAMTRSLQYGEQVSEILSRSSVWSAFKDQKHDLFISDS-QTAGYLTGPGV--AGYLTA 2218          

HSP 2 Score: 836.254 bits (2159), Expect = 0.000e+0
Identity = 426/873 (48.80%), Postives = 580/873 (66.44%), Query Frame = 2
Query:   32 MNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTH------MQEIQRKNKEAWRIVEK----KIDNLLMHWRSKIGINMKPMKDKDEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVG 2620
            + +N D  C+  TKH+WRG YKR+ ++G+  +TTY+  TL+VTNQWPY +ICSI P  K  +  +F L  R+   KK + ++FS++ R  +L EA+ +   F E      + N  K  W++   PV+LEV      QI+P T+RV+  Y Y++IE    +SD+  GF I   GFSRLH+F +  R+E I++  E A N + I L   KE +  +  L  R GKYS DE ITS AEF+VQK++        PV+R+L +TETCLVERDP TY + TL+PL ++FAL+ D + PQ F IE++ G  R Y ST+RDSLLASLLDG R+SGNRDVCVKM  T +  R+G L +P++EEVES H++ L   P G  F +AVFRFNAN+SYSG+LHAVTQ+GLF+ENKEKLI  A++AL+++EG+    +A+ LE+QF A+RRLVASKAGF AFTQL K RE LG KVV AL+R+N  V HAA+D + AL+ PMH++YD+RQEQLNKAS++SS KFL+NLL+ F+ HV  GTGALVIS +LDFLTF +C PY ET++G+ FD LL++V+  GR +FKLF HPS+AIVKGA L+M+A+I+E D  +   MQ LAL+EGALP+HL  + F  ++DQR L  RQL+R L+ LW   N  A  LLKR+LPPGL+ YL+S++  P  + D +  RDN+++A         + E QR   +A + VEK    K+D +LMHWR ++GI  K  ++ ++KPV LRKRR+RIK+  NW +F+Y+F QDHA+ NL+WN KTREE +DALE E+  F  +R+                                        +  A+ +SWN+ EF++ Y CL  EIK+G
Sbjct:    4 IRENKDLACFYTTKHSWRGKYKRVFSVGTHAVTTYNPNTLEVTNQWPYGDICSISPVGKG-QGTEFNLTFRKGSGKKSETLKFSTEHRTELLTEALRFRTDFAEGKITGRRYNCYKHHWSDAKKPVVLEVTPGGFDQINPVTNRVLCSYDYRNIEGFVDLSDYQGGFCILYGGFSRLHLFSSEQREEIIKSAIEHAGNYIGISLRIRKEPLEFEQYLNLRFGKYSTDESITSLAEFVVQKISPRH---SEPVKRVLAVTETCLVERDPATYNIATLKPLGEVFALVCDSENPQLFTIEFIKGQVRKYSSTERDSLLASLLDGVRASGNRDVCVKMAPTHKGQRWGLLSMPIDEEVESLHLRFLAAPPNG-NFADAVFRFNANISYSGVLHAVTQDGLFSENKEKLINNAITALLSQEGDVVASNAE-LESQFQAVRRLVASKAGFLAFTQLPKFRERLGMKVVKALKRSNNGVIHAAVDMLCALMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFNSHVDHGTGALVISSLLDFLTFALCAPYSETTEGQQFDMLLEMVASNGRTLFKLFQHPSMAIVKGAGLVMKAIIEEGDREIATKMQELALSEGALPRHLHTAMFTISSDQRMLTNRQLSRHLVGLWTADNTTATNLLKRILPPGLLAYLDSSDPVPEKDADRMHVRDNVKIAMDQYGKFNKVPEWQRLAGKAAKEVEKFAKEKVDLVLMHWRDRMGIAQK--ENINQKPVVLRKRRQRIKIEANWDLFYYRFSQDHARSNLIWNFKTREELKDALESEMRTFNIDRE----------------------------------------LGSASVISWNHHEFEVKYECLAEEIKIG 828          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Mouse
Match: Dnajc13 (DnaJ heat shock protein family (Hsp40) member C13 [Source:MGI Symbol;Acc:MGI:2676368])

HSP 1 Score: 125.561 bits (314), Expect = 3.897e-32
Identity = 56/134 (41.79%), Postives = 92/134 (68.66%), Query Frame = 2
Query: 3134 ANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSK 3535
            +NGIR+LVDL+T+AH+HV+RA +P QSNVIEA+ D + + +   KEW++   +KE+ GP  F E+ +L  +G +    + WAQG+D WR   ++PQ++W    L +GQAV   +++A+  L++L+ +C  +PS+
Sbjct:   31 SNGIRILVDLLTLAHLHVSRATVPLQSNVIEASPDMKRESE---KEWYFGNADKERSGPYGFHEMQELWAKGMLNAKTRCWAQGMDGWRPLQAIPQLKW--CLLASGQAVLNETDLATLILNMLITMCGYFPSR 159          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Mouse
Match: Dnajc13 (DnaJ heat shock protein family (Hsp40) member C13 [Source:MGI Symbol;Acc:MGI:2676368])

HSP 1 Score: 89.7373 bits (221), Expect = 1.490e-19
Identity = 50/150 (33.33%), Postives = 83/150 (55.33%), Query Frame = 2
Query: 6389 YLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQ 6838
            +L ++++ P W LR P EF         + + +     +   E LE  T A   L ++   L D++P  G++ KV Q +N  + + P  K+ + + + +S+++LCV  MA++ETI PLM  M+ R D +GLA E + R+FQ    EL+AQ
Sbjct:    2 FLRIFIAQPAWVLRKPREF----LIALLEKLTELLEKNNPHGETLETLTMATVCLFSAQPQLADQVPPLGHLPKVIQAMNHRNNAIP--KSAIRVIHVLSDNELCVRAMASLETIGPLMNGMRKRADTVGLACEAINRMFQKEQSELVAQ 145          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Mouse
Match: Dnajc13 (DnaJ heat shock protein family (Hsp40) member C13 [Source:MGI Symbol;Acc:MGI:2676368])

HSP 1 Score: 85.5001 bits (210), Expect = 4.237e-19
Identity = 45/80 (56.25%), Postives = 56/80 (70.00%), Query Frame = 2
Query: 6854 LVEYVLGLLEA-GLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRS 7090
            LV Y+L LLE  GL N+  P   KA  VKALKAM RS  +G QV+ +L  SS+WS FKDQ HDL+++++ Q AGYLTG S
Sbjct:    2 LVPYLLKLLEGVGLENLDSPAATKAQIVKALKAMTRSLQYGEQVSEILSRSSVWSAFKDQKHDLFISDS-QTAGYLTGVS 80          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. UniProt/SwissProt
Match: sp|O75165|DJC13_HUMAN (DnaJ homolog subfamily C member 13 OS=Homo sapiens OX=9606 GN=DNAJC13 PE=1 SV=5)

HSP 1 Score: 1326.61 bits (3432), Expect = 0.000e+0
Identity = 692/1426 (48.53%), Postives = 979/1426 (68.65%), Query Frame = 2
Query: 2876 IRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNR-AKLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYF-KNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEA-GLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVE---TAGYLTSFAQNTP 7135
            I++SYEFF++LY RFL   K  MKC+CL A++IVYGRCH+EIGP  D    I +LER T++LERDRL+L L KLI+NK N++ ++D+NGIR+LVDL+T+AH+HV+RA +P QSNVIEAA D + + +   KEW++   +KE+ GP  F E+ +L  +G +    + WAQG+D WR   S+PQ++W    L +GQAV   +++A+  L++L+ +C  +PS+DQ   IIRP+P+ K+ ++    L HI+QLLLTFDP LVEK+A+LL  +  +NP   RLY++GVF+FI+MY GSNVL +A FLK TH  QAF+++E+ K  +I  RSI+G+ILPEAM+C+LEN+  E+F++I+LG++DTPE IW+SEMRR MIEKIA HL +FTPRL SN RA YQY  IPII+YPQLENELFC  YYL+ LCDT+RFPDWPI+ PV LL+D L AWK E+EKKPP MS+ +AYEVL L         Q     +ES IRKAYF+L+ KYHPD+NP+GR+ FEK+N AY+FLC + AK+  GPDP+NI L+LK+QSILF R +++++ +KY+GYPMLI+TI  ET D+ LF KE+PLL    ELA+HTVN SALNAEELRR++G++ LQ AFSRCV ++T +S  SD SV+VCGYI+  +SVAAQFE CR++I E+P I +DL R+LYF K++P++++L   CV+  + D WLQT +F+ G +++LL ++F +DYTLEE G+ +SEE ++QE+ N LA L++ A++RL G + EE       +PEN  +R+ L  MLTPY+ RK+A     + S+  ILK+L SN+E+PYL W+N TR+EL ++LESQQE++IK  +CD  +G+EF +S + KELI+GE+F+R+YNE   F LE P++F   LL ++ S+ +Y+            T +  ++     + +   R  +++ AL AL NVI  NP    + IGHFK++FSL+       +Q+ A+EVV  VTS+++C+ +I  S VL  L+ LL SL S+  L+L+T+  + S T ++KE + +G LIY L + C+S    V+   A L  KM  DKL+G ++R  L++FLP +F+D+M+DNPE  VH+++  HENPELIWN+++R  +ST V E    +F+ Q+ +    W +P+DF V +       L+VGGV+L ++++ P W LR P EF         + + +     +   E LE  T A   L ++   L D++P  G++ KV Q +N  + + P  K+ + + + +S ++LCV  MA++ETI PLM  MK R D +GLA E + R+FQ    EL+AQA+K  LV Y+L LLE  GL N+  P   KA  VKALKAM RS  +G QV  +L  SS+WS FKDQ HDL+++ + Q AGYLTG  V    TAG  TS   N P
Sbjct:  847 IKRSYEFFNELYHRFLLTPKVNMKCLCLQALAIVYGRCHEEIGPFTDTRYIIGMLERCTDKLERDRLILFLNKLILNKKNVKDLMDSNGIRILVDLLTLAHLHVSRATVPLQSNVIEAAPDMKRESE---KEWYFGNADKERSGPYGFHEMQELWTKGMLNAKTRCWAQGMDGWRPLQSIPQLKWC--LLASGQAVLNETDLATLILNMLITMCGYFPSRDQDNAIIRPLPKVKRLLSDSTCLPHIIQLLLTFDPILVEKVAILLYHIMQDNPQLPRLYLSGVFFFIMMYTGSNVLPVARFLKYTHTKQAFKSEET-KGQDIFQRSILGHILPEAMVCYLENYEPEKFSEIFLGEFDTPEAIWSSEMRRLMIEKIAAHLADFTPRLQSNTRALYQYCPIPIINYPQLENELFCNIYYLKQLCDTLRFPDWPIKDPVKLLKDTLDAWKKEVEKKPPMMSIDDAYEVLNLP--------QGQGPHDESKIRKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSAKIVDGPDPENIILILKTQSILFNRHKEDLQPYKYAGYPMLIRTITMETSDDLLFSKESPLLPAATELAFHTVNCSALNAEELRRENGLEVLQEAFSRCVAVLTRASKPSDMSVQVCGYISKCYSVAAQFEECREKITEMPSIIKDLCRVLYFGKSIPRVAALGVECVSSFAVDFWLQTHLFQAGILWYLLGFLFNYDYTLEESGIQKSEETNQQEVANSLAKLSVHALSRLGGYLAEEQA-----TPENPTIRKSLAGMLTPYVARKLA-----VASVTEILKMLNSNTESPYLIWNNSTRAELLEFLESQQENMIKKGDCDKTYGSEFVYSDHAKELIVGEIFVRVYNEVPTFQLEVPKAFAASLLDYIGSQAQYLH-----------TFMAITHAAKVESEQHGDRLPRVEMALEALRNVIKYNPGSESECIGHFKLIFSLLRVHGAGQVQQLALEVVNIVTSNQDCVNNIAESMVLSSLLALLHSLPSSRQLVLETLYALTSSTKIIKEAMAKGALIYLLDMFCNSTHPQVRAQTAELFAKMTADKLIGPKVRITLMKFLPSVFMDAMRDNPEAAVHIFEGTHENPELIWNDNSRDKVSTTVREMMLEHFKNQQDNPEANWKLPEDFAVVFGEAEG-ELAVGGVFLRIFIAQPAWVLRKPREF----LIALLEKLTELLEKNNPHGETLETLTMATVCLFSAQPQLADQVPPLGHLPKVIQAMNHRNNAIP--KSAIRVIHALSENELCVRAMASLETIGPLMNGMKKRADTVGLACEAINRMFQKEQSELVAQALKADLVPYLLKLLEGIGLENLDSPAATKAQIVKALKAMTRSLQYGEQVNEILCRSSVWSAFKDQKHDLFISES-QTAGYLTGPGVAGYLTAGTSTSVMSNLP 2229          

HSP 2 Score: 832.017 bits (2148), Expect = 0.000e+0
Identity = 425/873 (48.68%), Postives = 577/873 (66.09%), Query Frame = 2
Query:   32 MNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTH------MQEIQRKNKEAWRIVEK----KIDNLLMHWRSKIGINMKPMKDKDEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVG 2620
            + +N D  C+  TKH+WRG YKR+ ++G+  ITTY+  TL+VTNQWPY +ICSI P  K  +  +F L  R+   KK + ++FS++ R  +L EA+ +   F E      + N  K  W++   PVILEV      QI+P T+RV+  Y Y++IE    +SD+  GF I   GFSRLH+F +  R+E I++  + A N + I L   KE +  +  L  R GKYS DE ITS AEF+VQK++        PV+R+L LTETCLVERDP TY + TL+PL ++FAL+ D + PQ F IE++ G  R Y ST+RDSLLASLLDG R+SGNRDVCVKM  T +  R+G L +P++EEVES H++ L   P G  F +AVFRFNAN+SYSG+LHAVTQ+GLF+ENKEKLI  A++AL+++EG+    +A+ LE+QF A+RRLVASKAGF AFTQL K RE LG KVV AL+R+N  + HAA+D + AL+ PMH++YD+RQEQLNKAS++SS KFL+NLL+ F+ HV  GTGALVIS +LDFLTF +C PY ET++G+ FD LL++V+  GR +FKLF HPS+AI+KGA L+M+A+I+E D  +   MQ LAL+EGALP+HL  + F  ++DQR L  RQL+R L+ LW   N  A  LLKR+LPPGL+ YL S++  P  + D +  RDN+++A         + E QR   +A + VEK    K+D +LMHWR ++GI  K  ++ ++KPV LRKRR+RIK+  NW +F+Y+F QDHA+ NL+WN KTREE +D LE E+  F  +R+                                        +  A  +SWN+ EF++ Y CL  EIK+G
Sbjct:    4 IRENKDLACFYTTKHSWRGKYKRVFSVGTHAITTYNPNTLEVTNQWPYGDICSISPVGKG-QGTEFNLTFRKGSGKKSETLKFSTEHRTELLTEALRFRTDFSEGKITGRRYNCYKHHWSDSRKPVILEVTPGGFDQINPATNRVLCSYDYRNIEGFVDLSDYQGGFCILYGGFSRLHLFASEQREEIIKSAIDHAGNYIGISLRIRKEPLEFEQYLNLRFGKYSTDESITSLAEFVVQKISPRH---SEPVKRVLALTETCLVERDPATYNIATLKPLGEVFALVCDSENPQLFTIEFIKGQVRKYSSTERDSLLASLLDGVRASGNRDVCVKMTPTHKGQRWGLLSMPVDEEVESLHLRFLATPPNG-NFADAVFRFNANISYSGVLHAVTQDGLFSENKEKLINNAITALLSQEGDVVASNAE-LESQFQAVRRLVASKAGFLAFTQLPKFRERLGVKVVKALKRSNNGIIHAAVDMLCALMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFNSHVDHGTGALVISSLLDFLTFALCAPYSETTEGQQFDMLLEMVASNGRTLFKLFQHPSMAIIKGAGLVMKAIIEEGDKEIATKMQELALSEGALPRHLHTAMFTISSDQRMLTNRQLSRHLVGLWTADNATATNLLKRILPPGLLAYLESSDLVPEKDADRMHVRDNVKIAMDQYGKFNKVPEWQRLAGKAAKEVEKFAKEKVDLVLMHWRDRMGIAQK--ENINQKPVVLRKRRQRIKIEANWDLFYYRFGQDHARSNLIWNFKTREELKDTLESEMRAFNIDRE----------------------------------------LGSANVISWNHHEFEVKYECLAEEIKIG 828          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. UniProt/SwissProt
Match: sp|F4IVL6|GRV2_ARATH (DnaJ homolog subfamily C GRV2 OS=Arabidopsis thaliana OX=3702 GN=GRV2 PE=1 SV=1)

HSP 1 Score: 577.4 bits (1487), Expect = 1.768e-166
Identity = 447/1513 (29.54%), Postives = 721/1513 (47.65%), Query Frame = 2
Query: 2951 MCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRS-RLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESN---IVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMR-RFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQ------------------EESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRAKLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKE-TPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHK-----QEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQ------------------LTKPTLL-------TSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPA----IQXXXXXXXXXXXXXXXCLED-IGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKS---NVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNP-ETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSS-NSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQML----------------------NDNSTSEPILKAG-----------LLIAYQMSNSKLCVATMATIET----IRPLMLAMKVRQDQLGLAGETLFRLFQSGT---DELIAQAIKMKLVEYVLGLLE------AGLVNVKDPGQVKAYF--VKALKAMQRSPTFGA---QVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTSFAQNTPNKP 7144
            +C  AM+IVY + +  IGP        +L++RT ++  R RLLLLL+ L+    N+E  +   G  + VDL+T+ H +  R  +P QSN+I A    +       KEW Y +K   ++GP+    +  L  +  I    K  A G+  W+    + ++RW+   +     V T S+V   ALSIL  +  A+   D  G I+ P PR K+ ++    L HI Q LL+ +P +VE  A LL  V   N     RLY TG FYF L Y GSN+ SIA+   +TH+ QAF   E    S+   +  RS++G +LPE+++  LE      FA   + D DTPE IW  +MR   +I ++  HL ++  +L  +  + Y Y  +P ++YP+L +E++C  YYLR+LCD ++FP+WPI   V  L+ +L  W+ E+ +KP  +S  EA ++L++  N N+SSD  +RT                   +E  +++ Y +L+M+YHPD+NP+GRE+F  +  AY+ L    +   GP P  + LLLK+Q IL++R    +   KY+GYPML+  +  + +D      + +PLL   +EL   T   S+LN EEL R  G+Q L    SRC+ ++  +++  + +  +   +    SV +QFE+ R    E+P +  D++     + +P       + +A +S    LQ  + + GA++++LP + Q+D T EE   + S E+H      Q   N  AL A  A++RL G   +E+     L+P N      L A+LTP    K+A    D  + K +L  L +N ETP + W++ TRSEL  +++ Q+         D      F +    KE+ +G V++++YN+Q    +  P SF   L+ F+ S V     SV  +Q                  + +P+L+        SS G   + NE       +Q  L AL N++   P++        ++L     + +  A    I +  + V+  +T+   CLE  +   + L+ L+++L S  S     L  +  + S   L       G ++Y L +L    K      +  AA LLGK++   + G R+   L++FLP   +  ++D P E  VH  +   E PEL+W       LS  +    S  + EQ+K    +W VP+      E  +     VGG+Y+  ++  P + LRNP  F   L  ++   +  +      V  E   L + AL +LL  H  L D +   GYV K+   +                        N +++P    G           L + +Q++ S  C   MA        + PL++          LA ETL R+  +G    D L+AQ +K+ L+E +LGLL+       GL +     + +A    V A++ +    T GA   +V  +L+ S +WS +KDQ HDL+L +  Q A  + G  +E +    ++A   P  P
Sbjct: 1067 LCARAMAIVYEQHYNTIGPFEGTAHITALIDRTNDRALRHRLLLLLKALVKVLLNVEGCVVVGGCVLAVDLLTVVHENSERTPIPLQSNLIAATAFMEPP-----KEWMYIDKGGAEVGPVEKDVIRSLWSKKDIDWTTKCRALGMSDWKKLRDIRELRWA---VAVRVPVLTPSQVGDAALSILHSMVSAHSDLDDAGEIVTPTPRVKRILSSTRCLPHIAQALLSGEPVIVEAGAALLKDVVTRNSKAMIRLYSTGAFYFALAYPGSNLYSIAQLFSVTHVHQAFHGGEEATVSSSLPLAKRSVLGGLLPESLLYVLERSGPAAFAAGMVSDSDTPEIIWTHKMRAENLICQVLQHLGDYPQKLSQHCHSLYDYAPMPPVTYPELRDEMWCHRYYLRNLCDEIQFPNWPIVEHVEFLQSLLVMWREELTRKPMDLSEGEACKILEISLN-NVSSDDLNRTASVELNEEISNISKQIQNLDEEKLKRQYRKLAMRYHPDKNPEGREKFLAVQKAYECLQATMQGLQGPQPWRLLLLLKAQCILYRRYGHVLRPFKYAGYPMLLDAVTVDKDDNNFLSNDRSPLLVAASELVSLTCAASSLNGEELVRDGGVQLLSTLLSRCMCVVQPTTSQHEPAAIIVTNVMRTLSVISQFESARAGFLELPSLIEDIVHCTELERVPAAVDAALQSIAKVSVFPELQHGLLKAGALWYILPLLLQYDSTAEE---SNSVESHGVGVSIQIAKNEHALQASQALSRLTGLCADES-----LTPYNATAADVLKALLTP----KLASLLKDEVA-KDLLSKLNTNLETPEIIWNSATRSELLNFVDEQRACQCPDGSYDLKNAQSFSYDALSKEVFVGNVYLKVYNDQPDSEISEPESFCNALIDFISSLVHTELPSVSEDQNLIEDRNSSNDTPELQSSVAEPSLIEEHSDHQPSSEG---MKNEECFLIDHLQLGLTALQNLLTKYPDLASVFSSKERLLPLFECFSVAIASKTDIPKLCLNVLSRLTAYAPCLETMVSDGSSLLLLLQMLHSAPSFREGALHVLYALASTPELAWAAAKHGGVVYILELLLPLQKEIPLQQRAAAASLLGKLVAQPMHGPRVAITLVRFLPDGLVSIIRDGPGEAVVHALERTTETPELVWTPAMAASLSAQIATMASDIYREQQKGSVIEWDVPEQSAGQQE--MRDEPQVGGIYVRRFLKDPKFPLRNPKRFLEGLLDQYLSAMAATHYEQHPVDPELPLLLSAALVSLLRVHPALADHIGHLGYVPKLVAAVAYEGRRETMSSGEVKAEEIGSDGVNESTDPSSLPGQTPQERVRLSCLRVLHQLAASTTCAEAMAATSAGNAQVVPLLMKAIGWLGGSILALETLKRVVVAGNRARDALVAQGLKVGLIEVLLGLLDWRTGGRYGLSSHMKWNESEASIGRVLAVEVLHGFATEGAHCSKVREILDASEVWSAYKDQKHDLFLPSNTQSAAGVAG-FIENSSNSLTYALTAPPPP 2551          

HSP 2 Score: 163.31 bits (412), Expect = 1.965e-38
Identity = 196/754 (25.99%), Postives = 322/754 (42.71%), Query Frame = 2
Query:   59 YCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWP----YSEICSIEPDSKNPKS--NKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRW-NEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKI---------SDHNQGFVIACNGFSRLHIFY----ANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDN-------------------PVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLN-RTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKT-------DRCLRF----GPLIVPMEEEVESQHMKMLQQTP------GGM--GFNEAVFR----FNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQ-------------FHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENY----DIRQEQLNKASIMSSSKFLQNLLDMFSLHVLR----GTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVD 2068
            Y V KH+WRG YKR++ + S GI T    TL VTN +     +     +    +N +S   +F + +R  G  K K M+FSS  R +IL E      L   + RP  +      R  N + VP  L++    +  +D  +     +  ++D+   A I         S  + GFV+ C  + R    +           + ++A+ A + + + L      +        R  K +     T +  + V +L +  +G  N                    V   L LT+  LVER  + Y ++ +RPL  + +L+R  +EPQ F IE+  G     Y S  RD+LLA++LD  ++ G+  + V  + T         C R     GP  +  + E  S H+K L          GG   G    ++R    FNA + Y+G+            N E + +  L ALI    +   +                        LRRL++S++   A + +      + R + L LR  +E V   A   I +LI     +     D R E+   A+IM +   L       ++ V R        L    +++     +C P+ ET+    F  LL+ ++   R +F LF HP+ ++ +  ++IM+ + +E D    ESM+  AL +GAL +HLLN+ F+    +R    R+++RQL++LW      A +LL RVLPPGL+ YL++  D  + + D
Sbjct:   26 YLVVKHSWRGRYKRILCISSGGIVTLDPNTLAVTNSYDTGSNFDGASPLVGRDENTESVGGEFTVNVRTDGKGKFKAMKFSSRCRASILTE---LYRLRWNQIRPVAEFQVLHLRRRNAEWVPYKLKITFVGLELVDSKSGNSRWILDFRDMGSPAIILLSDAYRTKSADSAGFVL-CPMYGRKSKAFRAAPGTTNSSIVASLAKTAKSMVGVFLSVDDSQLLTVSEYMTRRAKEAVGAEETPNGWWSVTRLRSAAHGTLNMPGLSLAIGPKGGLGEHGDAVALQLILTKASLVERRIDNYEVVIVRPLSSVSSLVRFAEEPQMFAIEFSDGCPVLVYASISRDNLLAAILDTLQTEGHCPIPVLPRLTMPGHRIDPPCGRVSLISGPQHLVADLETCSLHLKHLAAAAKDAVAEGGSVPGCRARLWRRIREFNACIPYTGV----------PANSE-VPEVTLMALITMLPSTPNLPVDAPPLPPPSPKAAATVIGFVTCLRRLLSSRS---AASHIMSFPAAVNRIMGL-LRNGSEGVAAEAAGLIASLIGGWSADLSTAPDSRGEK--HATIMHTKSVLFAQQGYVTILVNRLKPMSVSPLFSMAIVEVFEAMVCDPHGETTQYTVFVELLRQIAALRRRLFALFAHPAESVRETIAVIMRTIAEE-DAIAAESMRDAALRDGALLRHLLNA-FSLPASER----REVSRQLVALWADSYQPALDLLSRVLPPGLVAYLHTRPDDVVDDTD 752          

HSP 3 Score: 66.6254 bits (161), Expect = 3.523e-9
Identity = 37/116 (31.90%), Postives = 56/116 (48.28%), Query Frame = 2
Query: 2273 KVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVG 2620
            K+L NWR F+  F  DH + +L+WN +TR+E  +AL+ E+ +   E+         E+T D    D  ++   EI                  ++SWNY EF + YR L  E+ VG
Sbjct:  898 KLLLNWREFWRAFGLDHNRADLIWNERTRQELIEALKAEVHNLDVEK---------ERTEDISPGDVEATTGQEI----------------IPRISWNYSEFSVSYRSLSKEVCVG 988          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. UniProt/SwissProt
Match: sp|Q7VG06|DNAJ_HELHP (Chaperone protein DnaJ OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) OX=235279 GN=dnaJ PE=3 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 3.311e-6
Identity = 23/52 (44.23%), Postives = 39/52 (75.00%), Query Frame = 2
Query: 4307 QTSRTQEESLIRKAYFQLSMKYHPDRNPDGR---EQFEKINTAYQFLCNRAK 4453
            + +RT ++  I+KAY ++++KYHPDRNPD +   EQF+++N AY+ L + +K
Sbjct:   11 EITRTSDKETIKKAYRKMALKYHPDRNPDDKDAEEQFKRVNEAYEVLSDDSK 62          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. UniProt/SwissProt
Match: sp|B5ENA2|DNAJ_ACIF5 (Chaperone protein DnaJ OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) OX=380394 GN=dnaJ PE=3 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 7.718e-6
Identity = 28/73 (38.36%), Postives = 46/73 (63.01%), Query Frame = 2
Query: 4244 MSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPD---GREQFEKINTAYQFLCNRAK 4453
            M+ ++ YEVL++           SRT ++  I+K+Y +L+M+YHPDRNPD     E+F++I+ AY+ L +  K
Sbjct:    1 MATRDYYEVLEI-----------SRTADDGEIKKSYRRLAMRYHPDRNPDDASAEERFKEISAAYEVLSDPQK 62          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. UniProt/SwissProt
Match: sp|B7J7X8|DNAJ_ACIF2 (Chaperone protein DnaJ OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) OX=243159 GN=dnaJ PE=3 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 7.718e-6
Identity = 28/73 (38.36%), Postives = 46/73 (63.01%), Query Frame = 2
Query: 4244 MSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPD---GREQFEKINTAYQFLCNRAK 4453
            M+ ++ YEVL++           SRT ++  I+K+Y +L+M+YHPDRNPD     E+F++I+ AY+ L +  K
Sbjct:    1 MATRDYYEVLEI-----------SRTADDGEIKKSYRRLAMRYHPDRNPDDASAEERFKEISAAYEVLSDPQK 62          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. TrEMBL
Match: G4M1F0 (Endosomal trafficking protein, putative OS=Schistosoma mansoni OX=6183 GN=Smp_175760 PE=4 SV=1)

HSP 1 Score: 1859.73 bits (4816), Expect = 0.000e+0
Identity = 1051/2563 (41.01%), Postives = 1525/2563 (59.50%), Query Frame = 2
Query:   17 MLNPCMNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPD----SKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDN---PVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDL----------------------------------EAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTHMQEIQRKNKEAWRIVEKKIDNLLMHWRSKIGINMKPMKDKDEKPVCLRKRRKRIKVLD----------NWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVGXXXXXXXXXXXXXVSRIIREKEYIASLENHSTVENGRHLS---DRTSLNDQNIESQNGAESDTKSENSLNSKLAPNETEVGAVGGVIKIRQSYEFFHDLYRRFLQY-----------------------------HKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQ---SKQDDHYKEWFYQEKNKEQI--------------GPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQT--SRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRAKLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQ------------------------------------KETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIIT-ASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAG--SVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFK-------GDLTS--------------------IKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIIN--------------------IG-LSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLM-LAMKVRQDQLGLAGETLFRLFQSG-TDELIAQAIKMKLVEYVLGLLEAGL-VNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQ-VAGYLTGRSVET---AGYLTS 7117
            M   CM+KN + +CY +TK +W+GNYKRL T+G+LG+TTY+ +TL+VTNQW Y EI  I+ D    S  P+  +F+L + +  ++K+ ++ F++++RV +L + + + + F ++ +  +++++ K  W+E    VIL++    +   +P T  +   Y +KDIE ++KI D + G  I   GF  +HIF     D  I+ + + A + +++  ++    ++ DY  E+R+GK +QD H+ S AEF VQKL+ +RYG  N    V R++CLTE+ L+ERDP +Y  I+  PLC+I  L+RD  +PQRF IEYV G   TY ST+RD+LLASLLDG R+SGNRDV V    +DR LRF PL+    EEVES H++ L+Q P G+ F E V RFNAN++YSGLLHAVTQ+G+FAENKEKLIK AL +++ ++     I A  L                                  EAQFHALRRLVASKAGF AFTQL  +R TLG+ VV AL+  ++AVTH+ +D IN L+ PMH+  DIRQEQLNKASIMSS  FL +L+D+F+LH LRG+G+LV+  +LDF T+ +C PY ETS+G  FDNLL+L++ RGR +F+L+ HPSLAIV+G  +IM+ALI+E    V + +++LAL EGAL  H   +CF + ND RSLA +QL+RQL++LW   N  A +L KR+LP GL+ YL STE+PP+  ++ L +RDN++LA      I ++N                            +K+ +E+PV LR+ R  ++ L           NWR+FFYQF QDHAK +L+W ++TR E R+++EKE+ +F++ER++ A   + E++  PD                       D    A+ VSWNY EFK+ Y  L  E +VG                      Y   L     +E  RH++   D T+L + N            S + L+              G+ +IR S  FF++L+RR+LQY                              +  M+C+CL+AMS+VY RCH EIGP+ D  L   LL+RTT   ERD LLLLL+KL++NKNN+   +DA+G+RVL+DL  +AH+H NRA  P QSNV++A+ + +   S  +   + W+      EQ               GP+SF E+     + T + + K  A G+  W     + QIRW+ + +        ++ +A K + IL  +C +  S+D  GG++RP+P+ ++ I+    L H++QLLLTFDP LVE++  LL+ V D+NP   RLY+TG+FYFIL+Y GSNVL IA+FLK  H+ QA R DE     ++ SRSI+GN+LP+AMI +LENHP E+FA+I+LGD+D+PE IWNSEMRR+MI +I  HL +FTPRL SN RA Y+++ +PII YPQLENELFC +YYLRHLCD  RFP+WPIR PV+LLRDIL+ W++E++KKP +MS +EA   L L        D T  + + EES IR+AY+Q+SMKYHPD+NP+GRE+F+ +  AYQFLCNR+KL  GP+  +I L+L++QSI+++R R  +   KY+GYPML+ TIL+E  D++LF                                     +   LL    EL Y TV  S LNAEELRR++GI  LQ AFS+C   ++  SS      V VCG+I    + A+ F + RQ IQE PQ+ +D +RLLY+KNLP+L  L   CVA    D WL  + +E G ++ LL +V  +D+TLEE GV  +EE + Q + NRLALL++ AI R+    +   E   +  L  E   V + L  +LTP++ RKI E         G L++                    ++ + KLLT+NS TPYL WDNR R+EL+  ++ Q   LIKT EC+ +    F    Y +EL+IGEVF+RLYN+Q  + L++P+ F IDL  FL +E++ ++        ++    T+   T  + N+ +     + SAL AL NVI  N  + IQ IGHF +LFS++     P +Q  A++V+++V+++ +CLED+ AS++L  LV L   L    ++++ T+  + S + LLKE +Y G LIY + ++C S++   +     L+   + +K  G RI+AIL Q+LP +F+D+++D PETF+ L+D  HENPE+IW+ + R  L+ V+ E+  +++  Q  + N KW++ D F+VPY  II                     +G + +  VYLHLY+S PGW LRNP+ F N+   KW + I +  NST +    + L T A   +L    GL D LP+ G VH+V ++L      E   KA ++I +QMS SKLCV +M+  +TI  L+ +  +   ++LGL GETLF LF +  +D LI QA+K  L+ ++L +L+ G   +V++PGQ +AY +KALKAMQ S  +GA+VT++LE    W+ ++DQ H L+++N PQ +  YLT         +GYLT+
Sbjct:    1 MRRACMSKNREVSCYLLTKMSWKGNYKRLFTIGTLGVTTYNKDTLRVTNQWTYEEIYEIKIDHNIKSNQPQLKRFILDILDT-NRKRHELTFATEYRVELLTDLLHFRDRFIKEKKSNVRIHATKISWSESTYDVILDIGPISIDVRNPRTGELWKTYDFKDIECISKIHDTSNGVAIIHGGFGHIHIFLTREPDNLIKEINKSAHSNLSVSFNQPSNPLTRDYCTEYRLGKVNQD-HLISQAEFTVQKLS-NRYGGTNQMKTVSRLMCLTESLLLERDPTSYRPISAHPLCEIHLLVRDRFQPQRFSIEYVRGQIATYFSTNRDALLASLLDGVRASGNRDVYVSSSFSDRSLRFIPLMNSATEEVESVHLRFLRQRPEGVSFWEVVQRFNANIAYSGLLHAVTQDGVFAENKEKLIKDALISILTQD--TRIIDANPLTSIRRSSSSSLHCTTDSITTSTTNNNTNYELILIEAQFHALRRLVASKAGFNAFTQLPGIRVTLGQLVVNALKLRDDAVTHSVLDAINTLMHPMHDQPDIRQEQLNKASIMSSEIFLAHLVDIFTLHALRGSGSLVLCALLDFFTYGVCLPYSETSEGGLFDNLLRLLANRGRALFRLYLHPSLAIVRGGGMIMRALIEEGGTDVAKELRSLALTEGALLHHFWTACFTQGNDPRSLAVQQLSRQLVALWSENNQDAWDLFKRMLPLGLLSYLESTEEPPVKVINMLPDRDNLQLAH-----IGKQNH---------------------------LKEAEERPVVLRRPRHLLQSLRGDSANCKPTINWRLFFYQFQQDHAKADLIWTIRTRNELRESMEKELQEFRQERNYFAQSRL-EESDIPDF----------------------DRSEPASLVSWNYREFKVNYPSLIEEPRVG---------------------NYFLRL----LLEEDRHVNEVIDATTLTNAN------------SNHVLSM-------------GLSRIRDSTAFFNELFRRYLQYVASDPFYSINDNSIKRCTTDHNNITPNTLRRLTMRCLCLHAMSVVYHRCHHEIGPITDIPLLTYLLDRTTFASERDCLLLLLDKLMLNKNNVMSFVDADGVRVLIDLACLAHLHTNRAPTPFQSNVLKASSEQEFSGSGANTQREWWYINTTQTEQTTSGSIAKSGSHSIQGPVSFNEV-----DHTEQMNEKTIACGMYGWMPAKRIVQIRWTLADISEMNVSTHYTSLAIKCIDILRRLCDSCSSRDLHGGVVRPLPKPRRAISDMNCLPHLIQLLLTFDPPLVERVVSLLHAVMDQNPLLPRLYLTGIFYFILLYTGSNVLPIAKFLKDVHLLQALRLDEV--RIDLTSRSILGNMLPDAMIAYLENHPPEKFAEIFLGDFDSPEAIWNSEMRRYMISRITSHLADFTPRLHSNIRAIYRFIGMPIIIYPQLENELFCHNYYLRHLCDLQRFPNWPIRDPVALLRDILKTWRDELQKKPVNMSYEEALGELGL--------DPTLLNSSNEESFIRRAYYQMSMKYHPDKNPNGREKFQSLTKAYQFLCNRSKLSRGPNRLHIQLMLRAQSIVYKRYRSLLISEKYAGYPMLVATILAEISDDKLFSYGAQTSEDQTDNTDNTTNNNSQSSASNNKNKSNETVENAVLLVAATELTYETVVTSVLNAEELRRENGIPVLQKAFSQCSNFLSRTSSRPGHIVVEVCGHIVSVLAAASLFPSSRQCIQETPQLLKDTLRLLYYKNLPKLCCLTATCVASFCIDYWLCVTCYEYGGLFLLLQHVLSYDFTLEEAGVEINEETNSQVLANRLALLSLWAIGRMVNGYATGREVTEDGYLMREGPDVMEALSRLLTPHLARKILELNIYDSSQIGRLSNGNNDSQILHDFPLDTSRGKYLRSLAKLLTTNSVTPYLIWDNRCRAELETLIDLQVVRLIKTGECNLNSVLSFTHESYAQELLIGEVFVRLYNKQPAYTLDDPKGFIIDLFQFLTNELQNLN--------SEKVYDTNHQLTNNITNQCVT---NVSSALEALTNVIRHNTGLEIQCIGHFPLLFSILDLHDHPEVQLRALDVIQAVSTNPQCLEDMAASHLLTSLVMLFFVLPRAHLVLIQTMEHLISSSLLLKEFIYAGGLIYLMSIICQSSQQQTRQATVDLISHCLINKQFGRRIQAILNQYLPNVFVDTIRDQPETFLALFDADHENPEVIWDSNLRSILTKVLNEQTHSFYNSQCDNHNMKWNLSDSFKVPYTEIIAKKANEENKNKPNEIAQYVACLGPIQIANVYLHLYISHPGWTLRNPELFLNECMEKWIEAIHQLPNSTLL----VRLLTRACKTVLTDRPGLTDSLPRSGNVHRVLELLAKVDDPEGA-KAIVIILHQMSASKLCVQSMSESDTISGLIRIVNRCIGEELGLIGETLFCLFDTQYSDPLIEQALKHDLIGFILRMLQNGFPSSVREPGQTRAYLIKALKAMQYSAVYGAKVTSILETYPNWADYRDQGHSLFISNVPQSMTTYLTAGPASGSLHSGYLTT 2422          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. TrEMBL
Match: A0A1V9X6Z5 (DnaJsubfamily C member 13-like OS=Tropilaelaps mercedesae OX=418985 GN=BIW11_04424 PE=4 SV=1)

HSP 1 Score: 1857.8 bits (4811), Expect = 0.000e+0
Identity = 1037/2402 (43.17%), Postives = 1512/2402 (62.95%), Query Frame = 2
Query:   41 NVDETCYCVTKHAWRGNYKRLITLGSLGITTYH-SETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKK-KDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDH-NQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLAT-HRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHG--LNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQL-------------NKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSER-GRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTHMQEI-QRKNKEAWRIVEKKIDNLLMHWRSKI---------GINMKPMKDKDEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVGXXXXXXXXXXXXXVSRIIREKEYIASLENHSTVENGRHLSDRTSLNDQNIESQNGAESDTKSENSLNSKLAPNETEVGAVGGVIKIRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRA-KLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQ-RIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSN---PILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMA-TIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEAGLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTSFAQNTPN 7138
            N D  CY V K +W+G Y R+ ++GS  ITTY+  + +  TN++ Y +   IEP        +FV+  R++ + KK  DM+F+S++R +IL EA+ + +LF E     +  ++ K  ++++ V VILEV    VSQ+DP T   +  YYYKD+  +A+++D    G VI+   + RLH+F+   RDEF+++VAE A   + + L   KE +S   V   R G++S DE +TS  +FMV K++  HR    +PV+RIL ++E+CLVERD  TY + +LRPL D+ ALIRD +EP++F IE+V+G  + ++Y S++RD+LLASLLDG R+SGNRDV V+M +  R +R GPL VP+ EEVE  H+K L   P    F + V RFNANV YSGLLH    +    ENK+K+ + AL+A++ +EG Q++I    LE QFHALRRLVA KAGF AFTQ+               +RE +GRKV+ AL R + AV+HAA+D + ALIQPMH++ D+ QEQ NK SI+SS  FL+ LL+MF+ HV  GTG LV+  MLDFLTF++C PY ET+DG  FD LL+LV++  GR++FKLF H S+A+V+GA L+M+A+I+E +P +   MQ LALAE ALP+HLL++ +A  ++ R  A R+L+RQL+ LW+TG+      LKR++P GL+ Y+ S E PP   ++ L  RDN+ +A  H  ++  R     WR+VE+ ++  LMHW+S++                +   ++PV LR+RR+R+K   NW MF+YQF+QDHAKP+L+WN KTREE +DALE E+    ++R+ C ++                                         VSWN+ EF+++YR L +E++VGD++L           R++ E+                        +D+N +++          NS NS   P+            I QS EFF+DLY RFL     +MKCMCL AMSIVYGR H+EIGP ND +  I +L++T+++LERDRL+L ++KL+ NK NI+ ++D+NGI+VL++ + +AH+H +RA +P Q+NVIEA+ +    Q+   KEWFY    K   GP S  E+ KL++EG +    KVWAQG+D W   + V Q++W+   +  G A+   +++A+  L+IL+ +C  YP+K+  G I+RP+PR K+++  P ++ HIVQLLLTFDP LVEK+A+LL  V + NP   RLY +G F+FILMY GSNVL I   L +TH  QAFR++E N    +  RSI+GNILPEAMIC+LENH + +FA+I+LG++DTPE IW +EMRRFMIEKIA H+ +FTPRL SN RA YQY  IP I YPQL+NELFC  YYLRHLCDT R+PDWPI  PV LL+D+L  WK E+ +KP +++  +A E+L LK  + L         +ES IRKAYF+L+ KYHPD+NP+GRE FEK+N AY+FL + + +   GPDP N+ L+LK+Q+ILF RCR+E+  +KY+GYPMLIK I +ET+D+QL  K  PLLG+  E  YHT+N S LN +ELRR+DG+  L+ AF RCV  ++ SST  D  V VC +    F+VAA+FE+CR   I ++P    DL R+LYFK+L +L +    C+A LS    LQ+SM E G ++HLL + F++DYTL EGGV  S+E+++Q + N LA L++ A  RLAG   E   P    +P N+ +RQCL+A+LTPYI RK+      L     ILK+L SN+E PYL WDN  R+EL +YLE QQ+S I++ ECD  +G+ F +SL+ KEL++G++F+R+YNEQ  F LEN R FT DLL F+ S+ +++ ++             +S   VT ++E   R +  + A+ AL +VI+ NP + +  IGHFK+LF L+    +  ++  AV V+++VT ++ C++DI +  VLV L+ +L+S QSN     ++LDT+  + S ++L+KE + +G L+Y L V C+++   V+   A L+ KM  DKL G ++  +L +F+P +FLD+MK++P+  V L++   ENPELIWNE++R+ L  +V +     FE+Q +D  + W++P DF +  E+  N  L +GGVY+ L+V +PGW+LR P EF  +   +   ++ +      +    L+  T A+  LL +   L + +P  G++ ++   L       P  K  + + ++++ S+ CV  +  + + +  L  A+    + L L  +TL ++FQ     L+ QA+ +KLV  +L LLE  + N       KA+ V+ALKAM   P +G +V  LL +S  W+ FKDQ HDL+   T  +AGYL   +   AGYLT+ +   PN
Sbjct:   25 NEDVACYNVIKLSWKGKYARIFSVGSRAITTYNIGDAMVETNKFEYQDFVGIEPVVGKGSDTEFVIKYRKSREGKKVADMKFASEYRADILTEALKFKHLFCEPRSNAVWFSATKKDFSDQLVDVILEVGEVAVSQLDPITRERLGRYYYKDMGSIARLTDGLPGGVVISVESYKRLHLFFVEKRDEFLKSVAEFAMRHVGVML-SFKEELSEGTVHLKRFGRFSGDEAVTSLCDFMVHKVSVRHR----DPVKRILGISESCLVERDCNTYSITSLRPLSDVAALIRDREEPRKFSIEFVNGGDVQKSYFSSNRDALLASLLDGVRASGNRDVHVRMGRLPRGMRCGPLSVPVCEEVEIAHLKFLHTQPSSWSFADTVERFNANVPYSGLLHTAKNKDALFENKDKMFQAALTAVLAKEGEQDKIPLDLLEQQFHALRRLVACKAGFAAFTQVPQYVWVLLYDGKRGSVRERIGRKVIAALSRGDPAVSHAAVDMLCALIQPMHDDCDLFQEQQNKLSILSSKNFLEQLLNMFTQHVQYGTGCLVVLAMLDFLTFSLCAPYSETTDGAQFDALLELVAQHAGRMLFKLFQHSSIAVVRGAGLVMKAIIEEGEPDLAAKMQDLALAEAALPRHLLHALYASGSESRLFALRELSRQLVGLWLTGHPPTMHALKRIMPAGLLAYMESKEMPPKEAIETLRTRDNLRMATEHSNKMNHRAGGRQWRVVERHVEQFLMHWKSRVPQGLKGGMGLGGGDDRQAARQQPVVLRRRRQRVKSTANWTMFYYQFHQDHAKPHLIWNYKTREELKDALENELRGLTQDRELCHDV----------------------------------------TVSWNHHEFEVVYRSLADELRVGDFFL-----------RLLLEE------------------------DDRNAKAR---------VNSPNSPTPPSGF----------IMQSSEFFNDLYHRFLLSIDVDMKCMCLRAMSIVYGRHHEEIGPFNDTKYIIDMLQKTSSRLERDRLILFIDKLVSNKKNIKYLLDSNGIKVLIEFLCLAHLHTSRAVIPTQTNVIEASAEMMMDQE---KEWFYDNNEK---GPHSINEMKKLYEEGVVSAGTKVWAQGMDGWHRLSEVGQLKWT--LMAHGTALRNETDLAALILNILIKVCEVYPTKEPDGSIVRPLPRAKRRLCDPTIMPHIVQLLLTFDPILVEKVAVLLTHVMEHNPAIQRLYQSGFFFFILMYTGSNVLPIGHLLHLTHTCQAFRSEEGN---TLRQRSILGNILPEAMICYLENHGAAKFAEIFLGEFDTPEAIWTAEMRRFMIEKIATHIADFTPRLKSNTRAPYQYCPIPQIQYPQLQNELFCSIYYLRHLCDTQRYPDWPILEPVQLLKDVLDTWKAELNRKPSAINEDDACEILGLKQEQKL---------DESAIRKAYFRLAAKYHPDKNPEGREIFEKVNKAYEFLSDTSTRKADGPDPVNLSLILKTQAILFSRCREELHPYKYAGYPMLIKMIETETQDDQLLSKPNPLLGLAIETMYHTLNCSELNVQELRREDGLAVLEKAFVRCVEQLSHSSTPDDLVVSVCRHSVACFAVAAKFESCRTVLINDLPNFVNDLCRILYFKHLTRLCASAVECIASLSVCEQLQSSMLECGVLFHLLLFFFKYDYTLGEGGVEVSKESNQQAVANHLAELSVRACARLAGL--ESTDP----TPPNQRIRQCLIALLTPYITRKLG-----LAKPMDILKILNSNTENPYLIWDNSARAELTEYLERQQKSKIRSGECDEDYGSSFVYSLFDKELVVGDIFVRIYNEQPQFPLENARQFTQDLLSFIGSQAQFIYSA------------KNSKLVVTKDSES-DRIRNAELAMEALHHVILNNPSVEVLCIGHFKLLFLLLNTN-YTRLRVLAVGVIQAVTGNKNCVQDIASVQVLVFLLLVLKSFQSNHQHQQVVLDTLLPLMSNSALVKEAIAKGALLYLLDVYCNASDPKVRERTAELVAKMSGDKLSGPKLVRLLGRFMPAVFLDAMKESPQESVTLFEGNQENPELIWNEESRERLCAIVSQMSQQLFEKQTEDPAELWALPSDFSICSETGEN-ELVIGGVYIRLFVQNPGWSLRRPKEFLGECLDRACGLMARQDFDEVM----LDTLTTAVIGLLTNQGQLRESIPVMGHIPRIVMSLG---APPPQAKHAVRLLHELAQSQQCVEQLCESGDCMAGLRSAINNCPETLDLVAKTLNQMFQKDASRLVQQALSVKLVTLLLDLLERPVTNATS----KAHIVQALKAMHADPIYGDEVNELLSSSKTWADFKDQRHDLFTRET-TIAGYLPS-TTNVAGYLTA-SSTGPN 2267          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. TrEMBL
Match: A0A068WUS3 (DnaJ subfamily C 3 OS=Echinococcus granulosus OX=6210 GN=EgrG_000345600 PE=4 SV=1)

HSP 1 Score: 1775.37 bits (4597), Expect = 0.000e+0
Identity = 1046/2641 (39.61%), Postives = 1519/2641 (57.52%), Query Frame = 2
Query:   23 NPCMNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKS----NKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNP-VQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQE------------------EISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTHMQEIQRKNKEAWRIVEKKIDNLLMHWRSKIGIN-MKP-MKDKDEKPVCLR-KRRKRIKV------LD----------NWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEI-NEKTTDPDAVD-------ENSSASN------EINLDSNKKKILDD-------------------------LISQAAKVSWNYVEFKIIYRCLENEIKVGXXXXXXXXXXXXXVSRIIREKEYIASLENHSTVENGRHLSDRTSLNDQNIESQNGAESDTKSENSLNSKLAPNETEVGAVGGVIKIRQSYEFFHDLYRRFLQY-------------------------------HKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGD---AQSKQDDHYKEWFYQEKNKEQI--GPLSFKELIKLHDEGTIKPDVKVWAQGLDQ----------------------------------------------------WRSFASVPQIRWSNSKLYTGQ-------------------------------AVFTFSEVASKALSILVGICRAYPSKDQ-LGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRAKLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQK----------ETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRC-VTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKI------AEFKGDLTSIKVIL-------------------KLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGL--------------------------SVGGVYLHLYVSSPG--WALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMK-VRQDQLGLAGETLFRLFQ-SGTDELIAQAIKMKLVEYVLGLLEAGL-VNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLE-NSSIWSQFKDQSHDLYLTNTPQVAG----YLTGRSVET---AGYLTS 7117
            +P M  NV+   Y VTK+AW+G+YKR++++G+ GITTY  + L+VTNQW Y EI +I  DS   K+    N+    L   G   +KDM FSS++R +IL + + + +LF E+ +P +K+++ +  W+EK  PV LE+    + QID  T   V+ Y Y+DI+ LA+++     F I C    R+H+F  ++    +   AE A   +   L+ +   +++D+  E R+G  +  E++ S AEF++QK+A +R+G   P + R LCLT+  LVERDP +Y  I+ +PLC++FALIR  +EPQ   IEY++G   TY S+DRDSLL S+LDG R+SGN+ VCV+  K+ R LR  P  V    EVES H++ L+Q P  + F E + RFNANV+YSGL+HAV+Q+G+F ENKE+LIK AL  L++R  + +                  E+  Q  EA+F A+RRLVASKAGF+AFTQL+ +RE LGR VV AL +N++++THA ID +N L+QPMHE+ D+RQEQLNKASIMSS+ F++ L+++F+LH LRGTG+LVIS +LDF TF +C PY ETS+G  F+ LL +V+ RGR +F+LF HPSLAIVKGA L+M+A+IDEA  ++   ++ ++LAEGAL QH+L +CFA  ND R+L  RQL+RQL++LW   N  A++LLKRV P GL+ +L+S + PP +  D+LF RDN++LAQ H+  +Q K  E   I+++++D++L HWR K+G+   KP   + +++PV LR  RR RIK+      +D          NW +F+Y F +DHAKP+L+WN++TR+E +DA+EKE+ ++ RE  F ++  + NE        D       E + A++      E   D +   +  D                         L++   +VSWN+ EF++ Y  L  E +VG+Y+LRLLLEED+R++    + ++ AS    S ++N R                                                     EFF +L+RR+LQY                               H   M+C+CL AM+IVYGRC+ EIG V+D  L + L++RT +  ERD L+ LLEKL+I+K N +  ++A+G+RV+ DL  ++H+H  RA +P  +NV++   D   A        +EW+Y    + +   GP +F E+ +   +G +  +  V+AQGLD                                                     W     V Q+RWS  +L  G+                               A+   + +A + + +L  +C    S+D+  GGIIRP+PR ++ I+ P  L HIVQLLLTFDP LVE++A LL  V D+NP   R+Y+TGVF+FILMY GSNVL I  FLK TH+ QA    E   E+ +   S++  ILPEAMI FL+NHP E+FA+I+LGD+DTPE IWN EMRRFMI +IA HL +FTPRL SN R+ Y ++ IP I Y QLE ELFC  YYLRH CDT RFPDWP++ P++LLRDIL  W+ E EKKP  ++ +++   L L+      + Q + + +ES IR+AY+QLSMKYHPD+NP+G+ +F+ +  AY FLC R     GP+ ++I LL+++QSIL+ R RKE+  HKY+GYP LI+TI  E EDE LFQK           T LL    ELAY TV  SALNAEELRR+ G++ LQ AF RC   +   ++ ++  +  VC ++T FF+V+ +F A R+ I EIPQI R++IRLLY+KNL +L      C A    + WL TS+++NG ++ LL ++  +D+TLEE GV  S   +KQ  LN+L+LL + A+ RL   +   N+    +   +  V   L  +LTPYI RK+      A+    + ++ ++L                   KLLT+NS TP   WDN+ R+++ ++L+ Q    +KT E D +    F+    Q EL++GE+F+R++N+Q  F L+NP+ F IDLL +LK+E+  +           P +      T        KR   ++SAL AL NV+ +   + +Q IGHF +LF ++    +  ++  ++EV+ +V  + ECL DI ASN+LV  V L  +L    + +LD  + V +V SLLKELVY G LIY L  + +S    V+  +A LL + + +  +G RI+A+L QFLP IF ++++  P+ FV LYD+ H NPELIWN+D R  L+  + +  + +  +QEK+   KWS+PD + V Y + +   L                           VGGVYL +YVS     W LR P+ F   L ++  +   + S  T        L + A   LL    GLLD LPKKG+ H++  +    +  E      LLI + MS SKLCV  M   ETI      +     ++LG  GETLF +F  +G D L+AQA+K  L++++L +L+ GL V V++PGQ +AY VKALKAMQ++P +GAQV+  L+  S  W +F+DQSH L+LTN PQ A     YLT  +  +   AG+LT 
Sbjct:    7 HPKMQSNVNLASYLVTKNAWKGSYKRVLSVGTQGITTYRKDNLRVTNQWLYQEIFAIRADSVGSKAGNVNNQQKFNLVAGGPGGRKDMSFSSEYRTDILTDMLRFRSLFAEEPQPNVKLSAVRVTWSEKEKPVFLEITPISIDQIDQVTGTRVACYAYRDIQYLAQVTGLQGAFAIVCGSQERIHLFRCSDPVSLMNAAAEAAALYLGFILNRSLAPLTVDWCREMRLGPMATPENMISTAEFVLQKVAPYRHGSGAPPLSRTLCLTDCLLVERDPISYRPISAQPLCEVFALIRSRREPQMLSIEYINGKVHTYYSSDRDSLLCSILDGVRASGNQCVCVRSTKSRRSLRLQPTSVLSSAEVESMHLRFLRQPPEDISFWEVIERFNANVAYSGLVHAVSQDGIFTENKERLIKDALIVLLSRCPSTQRSVPTDDDFIYRKGLPDREVRLQLDEARFQAIRRLVASKAGFEAFTQLSGVRENLGRAVVAALAQNDDSLTHAVIDAVNTLMQPMHESPDLRQEQLNKASIMSSAPFMRQLVNLFTLHALRGTGSLVISGLLDFFTFALCLPYSETSEGASFETLLTMVASRGRAIFRLFSHPSLAIVKGAGLVMRAIIDEASEALVAQLRQMSLAEGALLQHILIACFANVNDPRNLVLRQLSRQLIALWTENNPQAQDLLKRVFPEGLLSFLDSPDLPPETEKDHLFVRDNLQLAQEHVLRVQSKKSEPLYILQERVDSILQHWRVKVGLQPRKPSTPNIEDRPVALRLTRRMRIKLGTPDTRVDGKPTELPRTLNWPLFYYHFQRDHAKPDLIWNLRTRDELKDAIEKEVGEYCRECSFFSHSRLENEDGEGASGADYSEMETLEEAEAADVALEAHESGEDDSDSTVTSDGNVGSSSKSTSSTIPTSSLERQVSRLLTHVNEVSWNHAEFRVRYHSLAAEPRVGNYFLRLLLEEDKRLASASDDADHGASTLGLSRIKNSR-----------------------------------------------------EFFSELFRRYLQYTAALGSMNSSLGGGGGGRIPRGKRGRGRRGNHLLSMRCLCLNAMTIVYGRCYAEIGAVSDIPLLVHLMDRTPSAAERDCLITLLEKLVIDKYNADEFLEADGVRVVTDLACLSHLHTARAPVPTATNVLKGDADNPEAVEGGGATQREWWYWRTTEPRTSEGPFTFTEIRQKLSDGNLASNTYVFAQGLDSQPRCRIEGVFVGTEEDEKEAFGSNSTSDFAPFGATTTGTTVTTKTPLASTLGWMPANRVTQLRWSVPRLLFGEDAEGGGDMNELGAEGRTEEDDLTTKLGVSQGALLDHTALAIRCVEVLKRLCERSASRDETTGGIIRPLPRPRRAISSPFNLPHIVQLLLTFDPPLVERVASLLLHVVDQNPCLPRIYLTGVFFFILMYTGSNVLPIVRFLKATHLLQA----EETSETGLP--SVLSKILPEAMIAFLDNHPPEKFAEIFLGDFDTPEAIWNQEMRRFMISRIAAHLADFTPRLKSNVRSIYHHIGIPRIIYAQLEGELFCNRYYLRHFCDTSRFPDWPVKDPIALLRDILAFWRVETEKKPSRITYEDSLRELGLE------AGQLNESNQESSIRRAYYQLSMKYHPDKNPNGQAKFQAVKAAYNFLCERGLHSDGPNRRHIQLLIRAQSILYSRYRKELAPHKYAGYPALIRTIRMEVEDEALFQKGLDTASNGNNATELLSSSTELAYETVTTSALNAEELRREGGLKTLQDAFERCSALLSLDNNLNNSLATNVCCHVTGFFTVSTKFSASRECICEIPQIVREIIRLLYYKNLLRLCCQAAACAAAFCEEFWLCTSVYQNGGVFMLLYHILAYDFTLEESGVEASSATNKQITLNQLSLLCLWALARLLNGI-ASNESQCEVDSLSASVEFTLNRLLTPYITRKLFDLAQTAKPPAPVANVDILLASSFLSPKSESGRTLRQLAKLLTTNSATPCFIWDNQCRAQMSEFLDEQVLHFVKTGEADLNAVKTFEHKTLQGELLVGEIFVRIFNKQPAFPLDNPKGFVIDLLNYLKTELALL-----------PRVSDGFPATT-------KRVSHLESALEALRNVVHSYAGVELQCIGHFDILFGILELEGYADLKLRSIEVLHAVAKNPECLNDIHASNLLVVAVILFRALPLAHLPLLDFFAHVVAVNSLLKELVYAGGLIYLLEAIATSEVPEVRRGSAELLSRCLANPQLGRRIQALLGQFLPAIFPETIRGAPQQFVALYDSDHLNPELIWNQDCRDHLTEAIIDMCNRFNRQQEKNHALKWSLPDAYAVSYATAVTAALRAHNLADSNKDSAGAEASLSDSLEVVCVGGVYLQIYVSQAAGRWMLRQPETFLEALMTRLLETFNRKSPETDPGLL--RLLSRAALQLLADRPGLLDGLPKKGFAHRILDLCPAVNEPEEARTCALLI-HAMSASKLCVGAMMERETIAGYRHVISYCVGEELGTMGETLFNIFNTTGCDPLVAQALKCDLIDFLLQILQRGLPVTVREPGQCRAYIVKALKAMQKNPLYGAQVSAKLDAESDRWLEFRDQSHALFLTNAPQSAALASTYLTAGASGSSMHAGFLTG 2560          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. TrEMBL
Match: W6UNW0 (DnaJ subfamily C member protein OS=Echinococcus granulosus OX=6210 GN=EGR_10071 PE=4 SV=1)

HSP 1 Score: 1755.34 bits (4545), Expect = 0.000e+0
Identity = 1043/2641 (39.49%), Postives = 1510/2641 (57.18%), Query Frame = 2
Query:   23 NPCMNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKS----NKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNP-VQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQE------------------EISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTHMQEIQRKNKEAWRIVEKKIDNLLMHWRSKIGIN-MKP-MKDKDEKPVCLR-KRRKRIKV------LD----------NWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEI-NEKTTDPDAVD-------ENSSASN------EINLDSNKKKILDD-------------------------LISQAAKVSWNYVEFKIIYRCLENEIKVGXXXXXXXXXXXXXVSRIIREKEYIASLENHSTVENGRHLSDRTSLNDQNIESQNGAESDTKSENSLNSKLAPNETEVGAVGGVIKIRQSYEFFHDLYRRFLQY-------------------------------HKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGD---AQSKQDDHYKEWFYQEKNKEQI--GPLSFKELIKLHDEGTIKPDVKVWAQGLDQ----------------------------------------------------WRSFASVPQIRWSNSKLYTGQ-------------------------------AVFTFSEVASKALSILVGICRAYPSKDQ-LGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRAKLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQK----------ETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRC-VTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKI------AEFKGDLTSIKVIL-------------------KLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGL--------------------------SVGGVYLHLYVSSPG--WALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMK-VRQDQLGLAGETLFRLFQ-SGTDELIAQAIKMKLVEYVLGLLEAGL-VNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLE-NSSIWSQFKDQSHDLYLTNTPQVAG----YLTGRSVET---AGYLTS 7117
            +P M  NV+   Y VTK+AW+G+YKR++++G+ GITTY  + L+VTNQW Y EI +I  DS   K+    N+    L   G   +KDM FSS++R +IL +               LK+++ +  W+EK  PV LE+    + QID  T   V+ Y Y+DI+ LA+++     F I C    R+H+F  ++    +   AE A   +   L+ +   +++D+  E R+G  +  E++ S AEF++QK+A +R+G   P + R LCLT+  LVERDP +Y  I+ +PLC++FALIR  +EPQ   IEY++G   TY S+DRDSLL S+LDG R+SGN+ VCV+  K+ R LR  P  V    EVES H++ L+Q P  + F E + RFNANV+YSGL+HAV+Q+G+F ENKE+LIK AL  L++R  + +                  E+  Q  EA+F A+RRLVASKAGF+AFTQL+ +RE LGR VV AL +N++++THA ID +N L+QPMHE+ D+RQEQLNKASIMSS+ F++ L+++F+LH LRGTG+LVIS +LDF TF +C PY ETS+G  F+ LL +V+ RGR +F+LF HPSLAIVKGA L+M+A+IDEA  ++   ++ ++LAEGAL QH+L +CFA  ND R+L  RQL+RQL++LW   N  A++LLKRV P GL+ +L+S + PP +  D+LF RDN++LAQ H+  +Q K  E   I+++++D++L HWR K+G+   KP   + +++PV LR  RR RIK+      +D          NW +F+Y F +DHAKP+L+WN++TR+E +DA+EKE+ ++ RE  F ++  + NE        D       E + A++      E   D +   +  D                         L++   +VSWN+ EF++ Y  L  E +VG+Y+LRLLLEED+R++    + ++ AS    S ++N R                                                     EFF +L+RR+LQY                               H   M+C+CL AM+IVYGRC+ EIG V+D  L + L++RT +  ERD L+ LLEKL+I+K N +  ++A+G+RV+ DL  ++H+H  RA +P  +NV++   D   A        +EW+Y    + +   GP +F E+ +   +G +  +  V+AQGLD                                                     W     V Q+RWS  +L  G+                               A+   + +A + + +L  +C    S+D+  GGIIRP+PR ++ I+ P  L HIVQLLLTFDP LVE++A LL  V D+NP   R+Y+TGVF+FILMY GSNVL I  FLK TH+ QA    E   E+ +   S++  ILPEAMI FL+NHP E+FA+I+LGD+DTPE IWN EMRRFMI +IA HL +FTPRL SN R+ Y ++ IP I Y QLE ELFC  YYLRH CDT RFPDWP++ P++LLRDIL  W+ E EKKP  ++ +++   L L+      + Q + + +ES IR+AY+QLSMKYHPD+NP+G+ +F+ +  AY FLC R     GP+ ++I LL+++QSIL+ R RKE+  HKY+GYP LI+TI  E EDE LFQK           T LL    ELAY TV  SALNAEELRR+ G++ LQ AF RC   +   ++ ++  +  VC ++T FF+V+ +F A R+ I EIPQI R++IRLLY+KNL +L      C A    + WL TS+++NG ++ LL ++  +D+TLEE GV  S   +KQ  LN+L+LL + A+ RL   +   N+    +   +  V   L  +LTPYI RK+      A+    + ++ ++L                   KLLT+NS TP   WDN+ R+++ ++L+ Q    +KT E D +    F+    Q EL++GE+F+R++N+Q  F L+NP+ F IDLL +LK+E+  +           P +      T        KR   ++SAL AL NV+ +   + +Q IGHF +LF ++    +  ++  ++EV+ +V  + ECL DI ASN+LV  V L  +L    + +LD  + V +V SLLKELVY G LIY L  + +S    V+  +A LL + + +  +G RI+A+L QFLP IF ++++  P+ FV LYD+ H NPELIWN+D R  L+  + +  + +  +QEK+   KWS+PD + V Y + +   L                           VGGVYL +YVS     W LR P+ F   L ++  +   + S  T        L + A   LL    GLLD LPKKG+ H++  +    +  E      LLI + MS SKLCV  M   ETI      +     ++LG  GETLF +F  +G D L+AQA+K  L++++L +L+ GL V V++PGQ +AY VKALKAMQ++P +GAQV+  L+  S  W +F+DQSH L+LTN PQ A     YLT  +  +   AG+LT 
Sbjct:  306 HPKMQSNVNLASYLVTKNAWKGSYKRVLSVGTQGITTYRKDNLRVTNQWLYQEIFAIRADSVGSKAGSVNNQQKFNLVAGGPGGRKDMSFSSEYRTDILTDM--------------LKLSAVRVTWSEKEKPVFLEITPISIDQIDQVTGTRVACYAYRDIQYLAQVTGLQGAFAIVCGSQERIHLFRCSDPVSLMNAAAEAAALYLGFILNRSLAPLTVDWCREMRLGPMATPENMISTAEFVLQKVAPYRHGSGAPPLSRTLCLTDCLLVERDPISYRPISAQPLCEVFALIRSRREPQMLSIEYINGKVHTYYSSDRDSLLCSILDGVRASGNQCVCVRSTKSRRSLRLQPTSVLSSAEVESMHLRFLRQPPEDISFWEVIERFNANVAYSGLVHAVSQDGIFTENKERLIKDALIVLLSRCPSTQRSVPTDDDFIYRKGLPDREVRLQLDEARFQAIRRLVASKAGFEAFTQLSGVRENLGRAVVAALAQNDDSLTHAVIDAVNTLMQPMHESPDLRQEQLNKASIMSSAPFMRQLVNLFTLHALRGTGSLVISGLLDFFTFALCLPYSETSEGASFETLLTMVASRGRAIFRLFSHPSLAIVKGAGLVMRAIIDEASEALVAQLRQMSLAEGALLQHILIACFANVNDPRNLVLRQLSRQLIALWTENNPQAQDLLKRVFPEGLLSFLDSPDLPPETEKDHLFVRDNLQLAQEHVLRVQSKKSEPLYILQERVDSILQHWRVKVGLQPRKPSTPNIEDRPVALRLTRRMRIKLGTPDTRVDGKPTELPRTLNWPLFYYHFQRDHAKPDLIWNLRTRDELKDAIEKEVGEYCRECSFFSHSRLENEDGEGASGADYSEMETLEEAEAADVALEAHESGEDDSDSTVTSDGNVGSSSKSTSSTIPTSSLERQVSRLLTHVNEVSWNHAEFRVRYHSLAAEPRVGNYFLRLLLEEDKRLASASDDADHGASTLGLSRIKNSR-----------------------------------------------------EFFSELFRRYLQYTAALGSMNSSLGGGGGGRIPRGKRGRGRRGNHLLSMRCLCLNAMTIVYGRCYAEIGAVSDIPLLVHLMDRTPSAAERDCLITLLEKLVIDKYNADEFLEADGVRVVTDLACLSHLHTARAPVPTATNVLKGDADNPEAVEGGGATQREWWYWRTTEPRTSEGPFTFTEIRQKLSDGNLASNTYVFAQGLDSQPRCRIEGVFVGTEEDEKEAFGSNSTSDFAPFGATTTGTTVTTKTPLASTLGWMPANRVTQLRWSVPRLLFGEDAEGGGDMNELGAEGRTEEDDLTTKLGVSQGALLDHTALAIRCVEVLKRLCERSASRDETTGGIIRPLPRPRRAISSPFNLPHIVQLLLTFDPPLVERVASLLLHVVDQNPCLPRIYLTGVFFFILMYTGSNVLPIVRFLKATHLLQA----EETSETGLP--SVLSKILPEAMIAFLDNHPPEKFAEIFLGDFDTPEAIWNQEMRRFMISRIAAHLADFTPRLKSNVRSIYHHIGIPRIIYAQLEGELFCNRYYLRHFCDTSRFPDWPVKDPIALLRDILAFWRVETEKKPSRITYEDSLRELGLE------AGQLNESNQESSIRRAYYQLSMKYHPDKNPNGQAKFQAVKAAYNFLCERGLHSDGPNRRHIQLLIRAQSILYSRYRKELAPHKYAGYPALIRTIRMEVEDEALFQKGLDTASNGNNATELLSSSTELAYETVTTSALNAEELRREGGLKTLQDAFERCSALLSLDNNLNNSLATNVCCHVTGFFTVSTKFSASRECICEIPQIVREIIRLLYYKNLLRLCCQAAACAAAFCEEFWLCTSVYQNGGVFMLLYHILAYDFTLEESGVEASSATNKQITLNQLSLLCLWALARLLNGI-ASNESQCEVDSLSASVEFTLNRLLTPYITRKLFDLAQTAKPPAPVANVDILLASSFLSPKSESGRTLRQLAKLLTTNSATPCFIWDNQCRAQMSEFLDEQVLHFVKTGEADLNAVKTFEHKTLQGELLVGEIFVRIFNKQPAFPLDNPKGFVIDLLNYLKTELALL-----------PRVSDGFPATT-------KRVSHLESALEALRNVVHSYAGVELQCIGHFDILFGILELEGYADLKLRSIEVLHAVAKNPECLNDIHASNLLVVAVILFRALPLAHLPLLDFFAHVVAVNSLLKELVYAGGLIYLLEAIATSEVPEVRRGSAELLSRCLANPQLGRRIQALLGQFLPAIFPETIRGAPQQFVALYDSDHLNPELIWNQDCRDHLTEAIIDMCNRFNRQQEKNHALKWSLPDAYAVSYATAVTAALRAHNLADSNKDSAGAEASLSDSLEVVCVGGVYLQIYVSQAAGRWMLRQPETFLEALMTRLLETFNRKSPETDPGLL--RLLSRAALQLLADRPGLLDGLPKKGFAHRILDLCPAVNEPEEARTCALLI-HAMSASKLCVGAMMERETIAGYRHVISYCVGEELGTMGETLFNIFNTTGCDPLVAQALKCDLIDFLLQILQRGLPVTVREPGQCRAYIVKALKAMQKNPLYGAQVSAKLDAESDRWLEFRDQSHALFLTNAPQSAALASTYLTAGASGSSMHAGFLTG 2845          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. TrEMBL
Match: A0A068XZX1 (DnaJ subfamily C 3 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000345600 PE=4 SV=1)

HSP 1 Score: 1751.87 bits (4536), Expect = 0.000e+0
Identity = 1027/2609 (39.36%), Postives = 1511/2609 (57.91%), Query Frame = 2
Query:   23 NPCMNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKS----NKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNP-VQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQE------------------EISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTHMQEIQRKNKEAWRIVEKKIDNLLMHWRSKIGIN-MKP-MKDKDEKPVCLR-KRRKRIKV------LD----------NWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVGXXXXXXXXXXXXXVSRIIREKEYIASLENHSTVENGRHLSDRTSLNDQNIESQNG-------AESDTKSENSLNSKLAPNETEVGAVG-GVIKIRQSYEFFHDLYRRFLQY------------------------------HKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGD---AQSKQDDHYKEWFYQEKNKEQI--GPLSFKELIKLHDEGTIKPDVKVWAQGLDQ----------------------------------------------------WRSFASVPQIRWSNSKLYTGQ-------------------------------AVFTFSEVASKALSILVGICRAYPSKDQL-GGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRAKLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQK----------ETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRC-VTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKI------AEFKGDLTSIKVIL-------------------KLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGL--------------------------SVGGVYLHLYVSSPG--WALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMK-VRQDQLGLAGETLFRLFQ-SGTDELIAQAIKMKLVEYVLGLLEAGL-VNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLE-NSSIWSQFKDQSHDLYLTNTPQVAG----YLTGRSVET---AGYLTS 7117
            +P M  NV+   Y VTK+AW+G+YKR++++G+ G+TTY  + L+VTNQW Y EI +I  DS   K+    N+    L   G   +KDM FSS++R +IL + + + +LF E+ +P +K+++ +  W+EK  PV LE+    + QID  T   V+ Y Y+DI+ LA+++     F I C    R+H+F  ++    +   AE A   +   L+ +   +++D+  E R+G  +  E++ S AEF++QK+A +R+G   P + R LCLT+  LVERDP +Y  I+ +PLC++FAL+R  +EPQ   IEY++G   TY S+DRDSLL S+LDG R+SGN+ VCV+  K+ R LR  P  V    EVES H++ L+Q P  + F E + RFNANV+YSGL+HAV+Q+G+F ENKE+LIK AL  L++R  + +                  E+  Q  EA+F A+RRLVASKAGF+AFTQL+ +RE LGR VV AL +N++++THA ID +N L+QPMH++ D+RQEQLNKASIMSS+ F++ L+++F+LH LRGTG+LVIS +LDF TF +C PY ETS+G  F+ LL +V+ RGR +F+LF HPSLAIVKGA L+M+A+IDEA  ++   ++ ++LAEGAL QH+L +CFA  ND R+L  RQL+RQL++LW   N  A++LLKRV P GL+ +L+S + PP +  D+LF RDN++LAQ H+  +Q K  E   I+++++D++L HWR K+G+   KP   + +++PV LR  RR RIK+      +D          NW +F+Y F +DHAKP+L+WN++T    RD L+  I   K   ++C        +   +   E +S ++   +++ ++    D+  +A +   +  +  +      ++  VG    +         S     +  ++ L  H    +  H   R   +  + E + G        E D +  +      A ++ + GA   G+ +I+ S EFF++L+RR+LQY                              H   M+C+CL AM+IVYGRC+ EIG V+D  L + L++RT +  ERD L+ LLEKL+I+K N +  ++A+G+RV+ DL  ++H+H  RA +P ++NV++   D   A        +EW+Y    + +   GP +F E+ +   +G +  +  V+AQGLD                                                     W     V Q+RWS  +L  G+                               A+   + +A + + +L  +C    S+D+  GG++RP+PR ++ I+ P  L HIVQLLLTFDP LVE++A LL  V D+NP   R+Y+TGVF+FILMY GSNVL I  FLK TH+ QA    E   E+ + S  ++  ILPEAMI FL+NHP E+FA+I+LGD+DTPE IWN EMRRFMI +IA HL +FTPRL SN R+ Y ++ IP I Y QLE ELFC  YYLRH CDT RFPDWP++ P++LLRDIL  W+ E EKKP  ++ +++   L L+      + Q + + +ES IR+AY+QLSMKYHPD+NP+G+ +F+ +  AY FLC R     GP+ ++I LL+++QSIL+ R RKE+  HKY+GYP LI+TI  E EDE LFQK           T LL    ELAY TV  SALNAEELRR+ G++ LQ AF RC   +   ++ ++  +  VC ++T FF+V+ +F A R+ I EIPQI R++IRLLY+KNL +L      C A    + WL TS+++NG ++ LL ++  +D+TLEE GV  S   +KQ  LN+L+LL + A+ RL   +   N+    +   +  V   L  +LTPYI RK+      A+    + ++ ++L                   KLLT+NS TP   WDN+ R+++ ++L+ Q   L+KT E D +    FK    Q EL++GE+F+R++N+Q  F L+NP+ F IDLL +LK+E+  +           P +      T        KR   ++SAL AL NV+ +   + +Q IGHF +LF ++    +  ++  +VEV+ +V  + ECL DI ASN+LV  V L  +L    + +LD  + V +V SLLKELVY G LIY L  + +S    V+  +A LL + + +  +G RI+A+L QFLP IF ++++  P+ FV LYD+ H NPELIWN+D R  L+  + +  + +  +QEK+   KWS+PD + V Y + +   L                           VGGVYL +YVS     W LR P+ F   L ++  +   + S  T        L + A   LL    GLLD LPKKG+ H++  +    +  E      LLI + MS SKLCV  M   ETI      +     ++LG  GETLF +F  +G D L+AQA+K  L++++L +L+ GL V V++PGQ +AY VKALKAMQ++P +GAQV+  L+  S  WS+F+DQSH L+LTN PQ A     YLT  +  +   AG+LT 
Sbjct:    7 HPKMQSNVNLASYLVTKNAWKGSYKRVLSVGTQGVTTYRKDNLRVTNQWLYQEIFAIRVDSGGSKAGSVNNQQKFNLVAGGPGGRKDMSFSSEYRTDILTDMLRFRSLFAEEPQPNVKLSAVRVTWSEKEKPVFLEITPISIDQIDQVTGTRVACYAYRDIQYLAQVTGLQGAFAIVCGSQERIHLFRCSDPVSLMNAAAEAAALYLGFILNRSPAPLTVDWCREMRLGPMATPENMISTAEFVLQKVAPYRHGSGAPPLSRTLCLTDCLLVERDPISYRPISAQPLCEVFALVRSRREPQMLSIEYINGKVHTYYSSDRDSLLCSILDGVRASGNQCVCVRSTKSRRSLRLQPTSVLSSAEVESMHLRFLRQPPEDVSFWEVIERFNANVAYSGLVHAVSQDGIFTENKERLIKDALIVLLSRCPSAQRSVPTDDDFIYRKGLPDREVRLQLDEARFQAIRRLVASKAGFEAFTQLSGVRENLGRAVVAALAQNDDSLTHAVIDAVNTLMQPMHQSPDLRQEQLNKASIMSSAPFMRQLVNLFTLHALRGTGSLVISGLLDFFTFALCLPYSETSEGASFETLLTMVASRGRAIFRLFSHPSLAIVKGAGLVMRAIIDEASEALVAQLRQMSLAEGALLQHILIACFANVNDPRNLVLRQLSRQLIALWTENNPQAQDLLKRVFPEGLLSFLDSPDLPPETEKDHLFVRDNLQLAQEHVLRVQSKKSEPLYILQERVDSILQHWRVKVGLQPRKPSTPNIEDRPVALRLTRRMRIKLGTPDTRVDGKPTELPRTLNWPLFYYHFQRDHAKPDLIWNLRT----RDELKDAIE--KEIGEYCRECSFFSHSRLENGDGEGASGADYSEMETLEEAEAADVALEAHESGEDDSDSTVT-----SDGNVGSSSKKSTSSTIPISSL----ERQVSRLLTHVNEVSWNHAEFRVRYHSLDAEPRVGNYFLRLLLEEDKRLAS------ASDDADHGASTLGLSRIKNSREFFNELFRRYLQYTAALGSMNSSLGGGSGRIPRGKRGRGRRGNHLLSMRCLCLNAMTIVYGRCYAEIGAVSDIPLLVHLMDRTPSAAERDCLITLLEKLVIDKYNADEFLEADGVRVVTDLACLSHLHTARAPVPTETNVLKGDADNPEAVEGGGATQREWWYWRTTEPRTSEGPFTFTEIRQKLSDGNLANNTYVFAQGLDSQPRCRIEGVFVGTEEDEKEAFGSNSTSDFAPFGATTTGTTVTTKTPLASTLGWMPANRVTQLRWSVPRLLFGEDAEGGGDVNELGAEGRTEEDDLTTKLGVSQGALLDHTALAIRCVEVLKRLCERSASRDETTGGVVRPLPRPRRAISSPFNLPHIVQLLLTFDPPLVERVASLLLHVVDQNPCLPRIYLTGVFFFILMYTGSNVLPIVRFLKATHLLQA----EETSETGLPS--VLSKILPEAMIAFLDNHPPEKFAEIFLGDFDTPEAIWNQEMRRFMISRIAAHLADFTPRLKSNVRSIYHHIGIPRIIYAQLEGELFCNRYYLRHFCDTSRFPDWPVKDPIALLRDILAFWRVETEKKPSRITYEDSLRELGLE------ASQLNESNQESSIRRAYYQLSMKYHPDKNPNGQAKFQAVKAAYNFLCERGLHSDGPNRRHIQLLIRAQSILYSRYRKELAPHKYAGYPALIRTIRMEVEDEALFQKGLDTASNGNNATELLSSSTELAYETVTTSALNAEELRREGGLKTLQDAFERCSALLSLDNNLNNSLATNVCCHVTGFFTVSTKFSASRECICEIPQIVREIIRLLYYKNLSRLCCQAAACAAAFCEEFWLCTSVYQNGGVFMLLYHILAYDFTLEESGVEASSATNKQITLNQLSLLCLWALARLLNGI-ASNESQCKVDSLSASVEFTLNRLLTPYITRKLFDLAQTAKPPAPVANVDILLASSFLSPKSESGRTLRQLAKLLTTNSATPCFIWDNQCRAQMSEFLDEQVLHLVKTGEADLNAVKTFKHKALQGELLVGEIFVRIFNKQPAFPLDNPKGFVIDLLNYLKAELALL-----------PRVSDGFPATT-------KRVSHLESALEALRNVVHSYAGVELQCIGHFDILFGILELEGYADLKLRSVEVLHAVAKNPECLNDIHASNLLVVAVILFRALPLAHLPLLDFFAHVVAVNSLLKELVYAGGLIYLLEAIATSEVPEVRRGSAELLSRCLANPQLGRRIQALLGQFLPAIFPETIRGAPQQFVALYDSDHLNPELIWNQDCRDHLTESIIDMCNRFNRQQEKNHALKWSLPDAYAVSYATAVTAALRAHNLADSNEDSAGAEASLSDSLEVVCVGGVYLQIYVSQAAGRWMLRQPETFLEALMTRLLETFNRKSPETDPGLL--RLLSRAALQLLADRPGLLDGLPKKGFAHRILDLCPAVNEPEEARTCALLI-HAMSASKLCVGAMMERETIAGYRHVISYCVGEELGTMGETLFNIFNTTGCDPLVAQALKCDLIDFLLQMLQRGLPVTVREPGQCRAYIVKALKAMQKNPLYGAQVSAKLDAESDRWSEFRDQSHALFLTNAPQSAALASTYLTAGASGSSMHAGFLTG 2560          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Cavefish
Match: DNAJC13 (DnaJ heat shock protein family (Hsp40) member C13 [Source:HGNC Symbol;Acc:HGNC:30343])

HSP 1 Score: 1325.46 bits (3429), Expect = 0.000e+0
Identity = 702/1432 (49.02%), Postives = 988/1432 (68.99%), Query Frame = 2
Query: 2876 IRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNR-AKLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYF-KNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEA-GLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTSFAQNT--PNKPF*ID 7156
            I++SYEFF++LY RFL   K  MKC+CL A++IVYG+C +EIGP  D +  + +L+R T++LERDRL+L L KLI+NK N++ I+D+NG+R+LVDL+T+AH+H +RA +P QSNVIEAA D + + +   KEW++   +KE+ GP SF+E+ +    GT+    + WAQG+D WR   ++PQ++W    L +GQAV   +++A+  L++L+ +C  +PS+DQ   IIRP+P+ K+ I+    L HIVQLLLTFDP LVEK+A LL +V  +NP   RLY+TGVF+FI+MY GSNVL +A FLK TH+ QAF+++E+ K  +IV RS++G +LPEAM+C+LEN+ +E+F++I+LG++DTPE IW+SEMRR MIEKIA HL +FTPRL SN RA YQY  IP++S+PQL++ELFC  YYLRHLCD+ RFP+WPIR PV LL+D L+AWK E+EKKPPSMSV +AYEVL L   +           EES IRKAYF+L+ KYHPD+NP+GR+ FEK+N AY+FLC + A++  GPDP+NI L+LK+QSILF R R+E+E +KY+GYPMLIKTI  ET DEQLF K +PLL   +ELA+HTVN SALNAEELRR+ GI+ L  A SRCV ++TASS   D +V+VCG+I   +SVAAQFE CR++I E+P I RD+  +LY+ K LP+L SL  +CV+  + D +LQT ++  G ++HLL  +F +DYTLEE GV  S+E ++QE+ N LA L+++A+ RL G       P     PEN  VR+ L AMLTPY+ RK+       TS  V LKLL SNSE PYL W+N TR+EL ++LE+QQES +K  ECD  FGAEF FS + KELI+GE+F+R+YNEQ  F LE P++F   LL ++ S+ +Y+            TLL  +      + +  +R +  + AL AL NVI  NP    + I HFK+LFSL+       +Q+ A+EVV +VTS++EC+ +I  S VL +L+ LL SL S+  L+L+T+  + S T ++KE + +G LIY L + C+S    V+   A L  KM +DKLVG ++R  L++FLP +F+D+M+DN E  VH+++  HENPELIWN+ +R+ +ST V E    +F++Q+ + +  W +P+DF VPY +     L VGGV+L ++++ PGW LR P EF   L     ++++K++ +     E LE  T A   L ++ + L D++P  G++ ++   LN  + + P  K+ + + + +S+++LCV +MA +ETI PLM  MKVR D  GLA E L R+FQ    +L+AQA++++LV Y+L LLE  GL  + +P   KA  VKALK+M RS  +G QV  +L  S++WS FKDQ HDL+++ + Q AGYLTG  +  AGYLT+    T  P+ P  +D
Sbjct:  846 IKRSYEFFNELYHRFLLTPKVAMKCLCLQALTIVYGKCCEEIGPFTDTKYIVGMLDRCTDKLERDRLILFLNKLILNKKNVKEIMDSNGVRILVDLLTLAHLHTSRATVPLQSNVIEAAPDMKRESE---KEWYFGNADKERRGPFSFEEMQEFWSSGTLTAKTRCWAQGMDGWRPLQAIPQLKWC--LLASGQAVMNETDLATLILNMLITMCSYFPSRDQDNAIIRPLPKVKRLISDNTSLPHIVQLLLTFDPILVEKVANLLYLVMQDNPNLQRLYLTGVFFFIMMYTGSNVLPVARFLKYTHLKQAFKSEEA-KGQDIVQRSVLGPVLPEAMVCYLENYEAERFSEIFLGEFDTPEAIWSSEMRRMMIEKIAAHLADFTPRLQSNTRALYQYCPIPVVSFPQLDSELFCNIYYLRHLCDSNRFPNWPIRDPVKLLKDTLEAWKREVEKKPPSMSVDDAYEVLNLPIGQG--------QHEESKIRKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSARIVDGPDPENIILILKTQSILFNRHRQELEPYKYAGYPMLIKTITMETGDEQLFSKTSPLLPAASELAFHTVNCSALNAEELRRESGIEVLLEALSRCVAVLTASSKPEDMAVQVCGHICKCYSVAAQFEECREKIIELPNIIRDVCHILYYGKVLPRLCSLSVQCVSSFAVDFFLQTHLYHAGVLWHLLVNLFNYDYTLEESGVQTSQETNQQEVANSLAKLSLVALGRLGGYRETVGPP-----PENPTVRKSLAAMLTPYVARKLG------TSTPV-LKLLNSNSENPYLIWNNGTRAELLEFLEAQQESNVKRGECDKSFGAEFVFSEHGKELIVGEIFVRVYNEQPAFPLEYPKAFAASLLDYVGSQAQYLH-----------TLLAMTQTNKVESQQHAQRLRWAEMALEALRNVIKNNPGSETECINHFKLLFSLLRVHGAGKVQQLALEVVNTVTSNQECVSNIAESLVLANLLVLLHSLPSSRQLVLETLYALTSNTKIVKEAMAKGALIYLLDLFCNSTHPQVRSQTAELFSKMTSDKLVGPKVRLTLMRFLPGVFMDAMRDNAEAAVHIFEGTHENPELIWNDASRETVSTTVREMMLDHFKQQKDNPDVNWKMPEDFTVPYAAGQG-ELEVGGVFLRIFIAQPGWVLRKPREFLVSLLETLTELLEKNNPNG----EALETVTTAAVCLFSTQTQLADQVPPLGHLPRILAALNHKNNAIP--KSSIRLIHVLSDNELCVRSMAALETIGPLMTGMKVRADMAGLACEALNRMFQREQSDLVAQALRVELVPYLLKLLEGVGLETLDNPSATKAQIVKALKSMTRSLQYGEQVNEILSRSTVWSAFKDQKHDLFISES-QTAGYLTGPGI--AGYLTAGTSATVMPSVPPPVD 2230          

HSP 2 Score: 839.721 bits (2168), Expect = 0.000e+0
Identity = 429/872 (49.20%), Postives = 581/872 (66.63%), Query Frame = 2
Query:   32 MNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELA-----QTHMQEIQRKNKEAWRIVEK----KIDNLLMHWRSKIGINMKPMKDKDEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVG 2620
            +  N D  C+  TKH+WRG YKR+ ++G+ GITTY+  TL+VTNQWPY +IC I P  K  +  +F L  R+   KK + ++FS++ R  +L EA+ +   F E      + N  K  W++    V LEV    + QIDP+T+RV+  Y Y+ +E  A++SD+  GF I   GFSRLH+F + +RDE IR+  E A N + I L   K+ ++ +  +  R+GKY  DE ITS AEF+VQK++        PV+RIL LTETCLVERDP +Y ++T++P  ++FALI D + PQ F IE++ G  R Y ST+RDSL+ASLLDG R+SGNRDVCVKM  T R  R+G L +P++EEVES H++ L   P G+ F +AVFRFNAN+SYSG+LHAVTQ+GLF+ENKEKLI  A+ AL++++      +A+ LEAQF A+RRLVASKAGFQAFTQL K RE LG K V AL+RNN  VTHAAID + AL+ PMH++YD+RQEQLNKAS++SS KFL+NLL+ F  +V  GTGALVIS +LDFLTF +C PY ET++G+ FD LL++V+  GR +FKLF HPS+AIVKGA L+M+A+I+E D  +   MQ LAL+EGALP+HL  S F  + DQR L  RQL+R L+ LW+  N +A  LLKR+LP GL+ YL+S++  P  +VD +  RDN+++A     +  + E QR   +A + VEK    K D +LMHWR K+GI  K  ++ ++KPV LRKRR+RIK+  NW +F+Y+F  DHA+ NL+WN+KTREE RDALE E+  F  +R+                                        +  A  +SWN+ EF++ Y CL +EIK+G
Sbjct:    4 LKDNKDLACFYTTKHSWRGKYKRVFSVGTHGITTYNPTTLEVTNQWPYGDICGIAPVGKG-QGTEFNLTFRKGSGKKSETLKFSTEHRTELLTEALRFRTDFSEGKITGRRYNCYKHHWSDTRRTVGLEVTPGGIDQIDPHTNRVICSYDYRSVEGFAEVSDYQGGFCILYGGFSRLHLFASEHRDEIIRSAIEHAGNYIGITLRLRKDPLTFEGFVSERLGKYGSDECITSLAEFVVQKISPRHA---EPVKRILALTETCLVERDPASYNIVTVKPFEEVFALICDAENPQVFTIEFIRGQIRKYCSTERDSLMASLLDGVRASGNRDVCVKMAPTQRGQRWGLLSMPVDEEVESLHLRFLAAPPNGI-FADAVFRFNANISYSGVLHAVTQDGLFSENKEKLINNAILALLSQDAELPGPNAE-LEAQFQAIRRLVASKAGFQAFTQLPKFREKLGVKTVKALKRNNNGVTHAAIDMLCALMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFISNVEHGTGALVISALLDFLTFALCAPYSETTEGQQFDMLLEMVASNGRTLFKLFQHPSMAIVKGAGLVMKAIIEEGDKEIATKMQDLALSEGALPRHLHTSMFTVSADQRMLTNRQLSRHLVGLWIAENPVAMNLLKRILPTGLLAYLDSSDAVPEKDVDRMHIRDNLKIATDQFGRNKVPEWQRIAGKAAKEVEKFAKEKADLVLMHWRDKMGIAQK--ENPNQKPVILRKRRQRIKIEANWELFYYKFQLDHARSNLIWNLKTREELRDALEGEMRSFSVDRE----------------------------------------LGSANVISWNHQEFEVKYECLSDEIKIG 827          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Cavefish
Match: dnajb2 (DnaJ heat shock protein family (Hsp40) member B2 [Source:NCBI gene;Acc:103038546])

HSP 1 Score: 49.6766 bits (117), Expect = 1.920e-6
Identity = 21/51 (41.18%), Postives = 37/51 (72.55%), Query Frame = 2
Query: 4313 SRTQEESLIRKAYFQLSMKYHPDRNPDGREQ----FEKINTAYQFLCNRAK 4453
            SR+  +  I+KAY +L++++HPD+NPD +E+    F++I  AY+ L +R+K
Sbjct:   11 SRSASQDDIKKAYRKLALRWHPDKNPDNKEEAERKFKEIAEAYEVLSDRSK 61          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Sea Lamprey
Match: DNAJC13 (DnaJ heat shock protein family (Hsp40) member C13 [Source:HGNC Symbol;Acc:HGNC:30343])

HSP 1 Score: 1340.87 bits (3469), Expect = 0.000e+0
Identity = 698/1432 (48.74%), Postives = 997/1432 (69.62%), Query Frame = 2
Query: 2876 IRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNR-AKLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYF-KNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEA-GLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTSFAQNT--PNKPF*ID 7156
            I++SYEFF+DLY RFL   K  MKC+CL A++IVYG+C++EIGP ND +  + +LER T++LERDRL+L L KLI+N+ N++ ++DANG R+LVDL+T+AH+H +RA +P QSNVIEA+ D + + +   KEW+Y    KE++GP  F E+ +L   G + P  + WAQG+D WR   S+PQ++W    + TGQAV   SE+A+  L++L+ +C  +PS+DQ   IIRP+PR K+ +++ + L HIVQLLLTFDP LVEK+A+LL +V  +NP   RLY+TGVF+FI+MY GSN+L IA FLK  H+ QAFR++E+ K   +V RSI+G++LPEAM+C+LEN+  E+FA+I+LG++DTPE IW++EMRR MIEKI+ HL +F+PRL SN RA YQY  IP+IS+PQL+NELFC  YYL+HLCDTVRFPDW I+ PV LL+D L AWK E+EKKP +MSV +AYEVL L   + +         +E+ IRKAYF+L+ KYHPD+NP+GR+ FEK+N AY+FLC++ AK   GPDP+NI L+LK+QSIL+ R ++E++ +KY+GYPMLIKT+  ETED+QLF K +PLL    ELA+HTVN SALNAEELRR+DGI+ LQ A +RCV +++ SS  +D  V+VCG+I   +SVAAQFE CR++I E+P I RDL R+L+F K LP+L+++   CV+  + D WLQT + + GA++HLL Y+F++DYTLEE GV  +EE ++QE+ N LA L++ A++RL G    E       +PEN  +++CL+AMLTPY+ RK+    G   S +V LKLL SNSE PYL W+N TR+EL ++L+S+Q+S+IK  ECD  +G+EF FS Y KELI+GE+F+R+YNEQ  + LE P+ F   LL  L S+ +Y+   +  NQ  K               + L+R  + +  L AL NVI  NP    + IGHFK++FSL+  +   ++Q+ A+EV+ +V S++EC+  I  S VL +L+ LL SL S+  L+L+T+  + S T ++KE + +G LIY + + C+S    ++   A L  KM +D+L+G ++R I+ +FLP +F+D+M+D+PE  VH+++  HENPELIWN++ R+ + + V +    +++EQ  +L+  W +PDDF V Y  + +  L VGGV+L ++V+ PGW LR P EF   L  K  +++ +++       E LE  T A   LL++   L ++LP  G++ K+   LN  + +  I K+ + I + +S+S+LCV  MA+++TI PL++AM+ R D +GLA E L R+FQ    +L+ QA+K  LV Y+L LLE  GL N ++P   KA  VKALKAM RS  FG Q+T +L  S++WS +KDQ HDL+++ T Q AGYLTG  V  AGYLT+   +T  P+ P  ID
Sbjct:  849 IKRSYEFFNDLYHRFLLTPKINMKCLCLQALAIVYGKCYEEIGPFNDTKYIVGMLERCTDRLERDRLILFLHKLILNQKNVKELMDANGTRILVDLLTMAHLHTSRATVPLQSNVIEASPDMKRESE---KEWYYGNAEKERLGPYGFDEMQELWQSGVLTPKTRCWAQGMDGWRPLHSIPQLKWC--LMATGQAVLDESELATLVLNMLIAMCHYFPSRDQDDAIIRPLPRIKRLLSENICLPHIVQLLLTFDPILVEKVAVLLGLVMQDNPQLPRLYLTGVFFFIMMYTGSNLLPIASFLKYAHIKQAFRSEET-KGQELVQRSILGHMLPEAMVCYLENYLPEKFAEIFLGEFDTPEAIWSNEMRRLMIEKISAHLADFSPRLQSNTRALYQYCPIPLISFPQLDNELFCNIYYLKHLCDTVRFPDWLIKHPVKLLKDTLDAWKKEVEKKPSAMSVDDAYEVLHLPKGQGV--------HDEAKIRKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCSKSAKTVDGPDPENIILILKTQSILYNRHKEELQPYKYAGYPMLIKTLTMETEDQQLFSKLSPLLPAATELAFHTVNCSALNAEELRREDGIEILQEALARCVAVLSPSSKVNDMPVQVCGHICRCYSVAAQFEDCREKIAELPPIIRDLCRVLFFGKYLPRLATVAVECVSAFAVDYWLQTHLLQAGALWHLLVYLFKYDYTLEESGVVANEETNQQEVANNLAKLSLQALSRLGGYAEGEGG-----TPENPAIKRCLMAMLTPYVARKL----GQGPSAEV-LKLLNSNSENPYLIWNNGTRAELLEFLQSEQDSMIKKGECDKSYGSEFVFSDYAKELIVGEIFVRVYNEQPTYTLELPKVFAASLLDSLGSQAQYLHTLMAINQDRK-----------VETEQQLERLSRAEMGLEALRNVIKNNPGTESECIGHFKLIFSLLRVQSAGSVQKLALEVINNVASNQECVNSIADSLVLANLLLLLHSLLSSRQLVLETLYALTSNTKIIKEAMAKGALIYLMDLFCNSTNPQIRSQTAELFAKMTSDRLIGPKVRIIMSKFLPSVFMDAMRDSPEAAVHIFEGMHENPELIWNDNARERVCSTVRDMTLEHYKEQFNNLDVNWKLPDDFAVAYNEVED-ELVVGGVFLRIFVAQPGWVLRKPKEFLVALLEKLTELLSRNNPHG----ETLETVTTAAVALLSTQPQLAEQLPPLGHLPKLLLALNHRNNA--IAKSAIRIVHVISDSELCVRAMASLDTIGPLIVAMRSRTDMVGLACEALNRMFQKDQTDLVGQALKADLVPYLLRLLEGIGLENTENPAATKAQVVKALKAMTRSLQFGEQITEILSRSTVWSAYKDQKHDLFISET-QTAGYLTGPGV--AGYLTAGTASTMAPSAPPPID 2235          

HSP 2 Score: 833.943 bits (2153), Expect = 0.000e+0
Identity = 425/875 (48.57%), Postives = 586/875 (66.97%), Query Frame = 2
Query:   32 MNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQE-KTRPRL-KVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQ------THMQEIQRKNKEAWRIVEK----KIDNLLMHWRSKIGINMKPMKDKDEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVG 2620
            +  N D  C+  TKH+WRG YKR++++G+LG+ TY+  TL++TNQWPY++ICSI P  K  +  +F L  R+   KK + ++FSS+ R ++L EA+ +   F E K   R  + N  K  W++    V+LEV    V QID  T RV+  Y Y+DIE   ++SD+  GF I   GFSRLH+F +  RDE I++  E A N + I L   KEAI+ +    +R+GK+S D+ ITS AEF VQKL T+R+    P +RIL LTE+C+VERDP+TY ++ ++PL ++F L+ D + PQ F IEY+ G  R Y ST+RDSLLAS+LDG R+SGNRDVCVKM+ T+R  R+G +  P++EEVES H++ L   P G  F +AV+RFNANVSYSGLLHAVTQ+  FAENKEKLI GA++AL+  EG+Q   + + LE+QF A+RRLVASKAGF AFTQL K RE LG KVV AL++N + VTHAAID + AL+ PMH++YD+RQEQ+NK S++SS KFL++LL+ F+ HV  GTGALVIS +LDFLTF +C PY ET+DG+ FD LL++V++ GR +F+LF HPS+AIVKG  L+M+A+I+E D  +   MQ LAL+EGALP+HL  + F  + DQR L  RQL+R L++LW +GN  +  L+KR+LP GL+  L+S E     ++D +  RDN+++A       + + E QR   +A + VEK    K+D +L+HWR ++GI  K  ++ ++KPV LRKRR+R+KV  NW +F+Y+F QDHA+ NL+WN KTREE RD LE E+  F  +R+  +N+ I                                        SWNY EF++ Y CL +EIK+G
Sbjct:    4 LKDNKDVACFFTTKHSWRGKYKRVLSVGTLGVATYNPTTLEITNQWPYNDICSISPVGKG-QGTEFNLTFRKGSGKKSETLKFSSEHRTDLLTEALRFRTEFAEGKIVGRAQRYNCYKQHWSDIRKSVVLEVTPGGVDQIDLVTHRVLCSYDYRDIEGFTEVSDYPGGFAIISGGFSRLHLFASEQRDELIKSAIEHAANHIGIALRLRKEAITFEQFQNNRLGKFSADDAITSLAEFNVQKL-TNRHS--EPQRRILALTESCVVERDPDTYSIVNVKPLAEVFCLVSDTENPQLFTIEYIKGQIRRYASTERDSLLASMLDGVRASGNRDVCVKMRLTERGQRWGLMSTPVDEEVESTHLRFLASPPNG-NFADAVYRFNANVSYSGLLHAVTQDSFFAENKEKLINGAITALLTHEGDQMATNPE-LESQFQAIRRLVASKAGFMAFTQLPKFREKLGVKVVRALKKNCDGVTHAAIDMLCALMCPMHDDYDLRQEQMNKCSLLSSKKFLESLLEKFNTHVGHGTGALVISSLLDFLTFALCAPYSETTDGQQFDLLLEMVADMGRTLFRLFQHPSMAIVKGTGLVMKAIIEEGDEEIATKMQDLALSEGALPRHLHTAMFTISTDQRLLTNRQLSRHLVALWTSGNPTSLNLMKRILPSGLMACLDSEEKVSDKDIDRMNVRDNLKIASDQFLKMSKVPEWQRIAGKAAKGVEKFAKEKVDFVLIHWRDRMGITQK--ENANQKPVVLRKRRQRVKVESNWDLFYYRFNQDHARSNLIWNFKTREELRDGLESEMRAFNVDRELGSNVTI----------------------------------------SWNYQEFEVRYDCLSDEIKIG 830          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Nematostella
Match: EDO27839 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T855])

HSP 1 Score: 73.9442 bits (180), Expect = 5.996e-15
Identity = 31/69 (44.93%), Postives = 48/69 (69.57%), Query Frame = 2
Query: 5993 RGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDN 6199
            +G LIY L + CS +   V+  +A L  KMM+DKL+G R++ IL +FLP IF+D+M+D+ E  VH+++ 
Sbjct:   79 QGALIYLLDLFCSGSNPAVRERSAELFAKMMSDKLIGPRVKIILAKFLPAIFMDAMRDSAEASVHMFEG 147          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Medaka
Match: DNAJC13 (DnaJ heat shock protein family (Hsp40) member C13 [Source:NCBI gene;Acc:101164685])

HSP 1 Score: 1269.99 bits (3285), Expect = 0.000e+0
Identity = 684/1423 (48.07%), Postives = 967/1423 (67.96%), Query Frame = 2
Query: 2876 IRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNR-AKLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYF-KNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNE-ENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEA-GLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTSFAQNT 7132
            I++SYEFF++LY RFL   K  MKC+CL A++IVYGRC +EIGP  D +  + +L+R T++LERDRL+L L KLI+NK N++ ++D+NG+R+LVDL+T+AH+H +RA +P QSNV+EAA D + + +   KEW++   +KE+ GP SF+E+ +  + G +    + WAQG+D WR   ++PQ++W    L TGQAV   S++A+  L++L+ +C  YPS+DQ   IIRP+P+ K+ I+    L HIVQLLLTFDP LVEK+A LL +V  +NP   RLY+TG+F+FI+MY GSNVL +A FLK TH+ QAF+++E+ K  +IV RS++G +LPEAM+C+LEN+  E+F++I+LG++DTPE IW+SEMRR MIEKIA H+ +F+PRL SN RA YQY  IP+IS+PQL+NELFC  YYLRHLCDT RFP+WPIR PV LL+D L+AWK E+EKKPPSMSV +AYEVL      NL   Q     EES IRKAYF+L+ KYHPD+NP+GR+ FEK+N AY+FLC + A++  GPDP+NI L+LK+QSILF   +KE+E +KY+GYPMLIKTI  ETEDEQLF K +PLL    ELA+HTV+ SALNAEELRR++GI+ L  A SRCV ++TASS   D +V+VCG+    +SVAAQFE CR++I E P I RDL  +LY+ K LP+ ++L  +CV+  + D +LQT +F  G ++HLL Y+F +DYTLEE GV  +++ ++QE+ N LA L+++A++RL G  N  E  P     PEN  +R+ L AMLTPYI RK+    G  T  + + K        P L   N +R+    +  S   S     E D  FGA+F FS + KELI+GE+F+R+YNEQ  F LE P++F   LL ++ S+ +Y+            TLL  S+     + +  +R +  + AL AL NVI  NP    + IGHFK+LFSL+       +Q+  +EVV +VTS++EC+ +I  S VL +L+ LL SL S+  L+L+T+  + S T ++KE + +G LIY L + C+     V+   A L  KM +DKLVG ++R  L++FLP +F+D+M+DN E  VH+++  HENPELIWN+ +R+ +ST V E    +F++Q+ + +  W +PDDF V Y +     L VGGV+L ++++ PGW LR P EF   L     ++++K++ +     E LE  T A   L ++ S L D++P  G++ ++   LN  + + P  K+ + + + +S+++LCV +MA++ETI PLM AMKVR D  G+A E L R+FQ    +L+AQA+++ LV Y+L LLE  GL  +++P   KA  VKALK+M RS  +G QV  +L  SS+WS FKDQ HDL+++++ Q AGYLTG  V  AGYLT+    T
Sbjct:  846 IKRSYEFFNELYHRFLLTPKVTMKCLCLQALAIVYGRCFEEIGPFADTKYIVGMLDRCTDKLERDRLILFLNKLILNKKNVKDVMDSNGVRILVDLLTLAHLHTSRATVPLQSNVLEAAPDMKRESE---KEWYFGNADKERRGPFSFEEMQEFWNTGILTAKTRCWAQGMDGWRPLQAIPQLKWC--LLATGQAVMNESDLATLILNMLITMCSYYPSRDQDNAIIRPLPKIKRMISDNACLPHIVQLLLTFDPILVEKVANLLYLVMQDNPNLQRLYLTGIFFFIMMYTGSNVLPVARFLKYTHLKQAFKSEEA-KGQDIVQRSVLGPVLPEAMVCYLENYEPERFSEIFLGEFDTPEAIWSSEMRRMMIEKIAAHIADFSPRLQSNTRALYQYCPIPVISFPQLDNELFCNIYYLRHLCDTTRFPNWPIRDPVKLLKDTLEAWKREVEKKPPSMSVDDAYEVL------NLPKGQGQ--HEESKIRKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSARIVDGPDPENIILILKTQSILFNLHKKELEPYKYAGYPMLIKTITMETEDEQLFSKTSPLLPASTELAFHTVSCSALNAEELRRENGIEILLEALSRCVAVLTASSKPEDMAVQVCGHTCRCYSVAAQFEECREKIIEQPNIIRDLCHILYYGKTLPKTAALAVQCVSSFAVDFFLQTHLFHAGVLWHLLGYLFGYDYTLEESGVQANQDTNQQEVANNLAKLSLVALSRLGGFTNGVEGAP-----PENPTIRKSLAAMLTPYISRKL----GTGTPAEQLRK------PPPDLEQRNSSRASRVVFFRSPFPS---QGENDKSFGADFVFSDHSKELIVGEIFVRVYNEQPTFPLEYPKAFAASLLDYVGSQAQYLH-----------TLLAMSHSNKVESQQHAERLRFAEMALEALRNVIKNNPGSETECIGHFKLLFSLLRVHGAGRVQQLVLEVVSTVTSNQECVGNIAESMVLSNLLLLLHSLPSSRQLVLETLHALTSNTKIVKEAMAKGALIYLLDLFCNCTHPQVRTQTAELFSKMTSDKLVGPKVRLTLMRFLPGVFMDAMRDNAEAAVHIFEGTHENPELIWNDSSREKVSTTVREMMLDHFKQQKDNPDVNWKLPDDFTVAYGAGQG-ELEVGGVFLRIFIAQPGWVLRKPREFLVSLLETLTELLEKNNPNG----EALETVTTAAVCLFSTQSQLADQVPPLGHLPRIIAALNHKNNAIP--KSSIRVIHVLSDNELCVRSMASLETIGPLMAAMKVRADMAGVACEALNRMFQKEQTDLVAQALRVDLVPYLLKLLEGVGLETIENPSATKAQIVKALKSMTRSLQYGEQVNEILSKSSVWSAFKDQKHDLFISDS-QTAGYLTGPGV--AGYLTAGTGTT 2215          

HSP 2 Score: 847.04 bits (2187), Expect = 0.000e+0
Identity = 434/872 (49.77%), Postives = 582/872 (66.74%), Query Frame = 2
Query:   32 MNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTHMQ-----EIQRKNKEAWRIVEK----KIDNLLMHWRSKIGINMKPMKDKDEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVG 2620
            + +N D  C+  TKH+WRG YKR+ ++GS GITTY+  TL+VTNQWPY +IC I P  K  +  +F L  R+   KK + ++FS++ R ++L EA+ +   F E      + N  K  W++   PV LEV    + QIDP+T+RVV  Y Y+++E   ++SD+  GF I   GFSRLH+F +  RD+ IR+  E A N + I L   KEA++ +  +  R+GKYS DE ITS AEF+VQK++        PV+RIL LTETCLVERDP +Y ++T++P  ++FALI D   PQ F  E++ G  R Y ST+RDSLLASLLDG R+SGNRDVCVKM  T R  R+G L +P++EEVES H++ L   P G  F +AVFRFNAN+SYSG+LHAVTQ+GLF+ENKEKLI  A+ AL+++E     ++A+ LE+QF A+RRLVASKAGFQAFTQL K RE LG K V AL+RNN  VTHAAID + AL+ PMH++YD+RQEQLNKAS++SS KFL+NLL+ F  +V  GTGALVIS +LDFLTF +C PY ET++G+ FD LL++V+  GR +FKLF HPS+AIVKGA L+M+A+I+E D  +   MQ LAL+EGALP+HL  S F  ++DQR L  RQL+R L+ LW   N +A  LLKR+LP GL+ YL+S++  P  +VD +  RDN++LA   +      E QR   +A + VEK    K D +LMHWR K+GI  K  ++ ++KPV LRKRR+RIK+  NW +F+Y+F  DHA+ NL+WN+KTREE RDALE E+  F  +R+                                        +  A  +SWN+ EF++ Y CL +EIK+G
Sbjct:    4 VKENKDLACFYTTKHSWRGKYKRVFSVGSHGITTYNPTTLEVTNQWPYGDICGIGPVGKG-QGTEFSLTFRKGSGKKSETLKFSTEHRTDLLTEALRFRTEFSEGKITGRRYNCYKHHWSDTRKPVSLEVTPGGIDQIDPHTNRVVCSYDYRNVEGFVEVSDYQGGFCILYGGFSRLHLFASEQRDDIIRSAIEHAANFIGIMLRLRKEALTFEGFVTDRLGKYSSDESITSLAEFVVQKISPRH---PEPVKRILALTETCLVERDPASYNIVTVKPFGEVFALICDADNPQVFTAEFIRGQIRKYSSTERDSLLASLLDGVRASGNRDVCVKMAPTQRGQRWGLLSMPVDEEVESLHLRFLAAPPNG-NFADAVFRFNANISYSGVLHAVTQDGLFSENKEKLINNAILALLSQEVELPTLNAE-LESQFQAIRRLVASKAGFQAFTQLPKFREKLGVKTVKALKRNNNGVTHAAIDMLCALMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFITNVDHGTGALVISSLLDFLTFALCAPYSETTEGQQFDMLLEMVATNGRTLFKLFQHPSMAIVKGADLVMKAIIEEGDKEIATKMQELALSEGALPRHLHTSLFTISSDQRMLTNRQLSRHLVGLWTAENPVAMNLLKRILPTGLLAYLDSSDSVPEKDVDRMHIRDNLKLATDQLNRNKVPEWQRIAGKAAKEVEKFAKEKADVVLMHWRDKMGIAQK--ENPNQKPVILRKRRQRIKIEANWELFYYRFQLDHARSNLIWNLKTREELRDALEGEMRAFGVDRE----------------------------------------LGNATVISWNHQEFEVKYECLSDEIKIG 827          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Medaka
Match: DNAJC13 (DnaJ heat shock protein family (Hsp40) member C13 [Source:NCBI gene;Acc:101164685])

HSP 1 Score: 1266.91 bits (3277), Expect = 0.000e+0
Identity = 682/1430 (47.69%), Postives = 968/1430 (67.69%), Query Frame = 2
Query: 2876 IRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNR-AKLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYF-KNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLS--------PENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEA-GLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTSFAQNT 7132
            I++SYEFF++LY RFL   K  MKC+CL A++IVYGRC +EIGP  D +  + +L+R T++LERDRL+L L KLI+NK N++ ++D+NG+R+LVDL+T+AH+H +RA +P QSNV+EAA D + + +   KEW++   +KE+ GP SF+E+ +  + G +    + WAQG+D WR   ++PQ++W    L TGQAV   S++A+  L++L+ +C  YPS+DQ   IIRP+P+ K+ I+    L HIVQLLLTFDP LVEK+A LL +V  +NP   RLY+TG+F+FI+MY GSNVL +A FLK TH+ QAF+++E+ K  +IV RS++G +LPEAM+C+LEN+  E+F++I+LG++DTPE IW+SEMRR MIEKIA H+ +F+PRL SN RA YQY  IP+IS+PQL+NELFC  YYLRHLCDT RFP+WPIR PV LL+D L+AWK E+EKKPPSMSV +AYEVL      NL   Q     EES IRKAYF+L+ KYHPD+NP+GR+ FEK+N AY+FLC + A++  GPDP+NI L+LK+QSILF   +KE+E +KY+GYPMLIKTI  ETEDEQLF K +PLL    ELA+HTV+ SALNAEELRR++GI+ L  A SRCV ++TASS   D +V+VCG+    +SVAAQFE CR++I E P I RDL  +LY+ K LP+ ++L  +CV+  + D +LQT +F  G ++HLL Y+F +DYTLEE GV  +++ ++QE+ N LA L+++A++RL G  +  +  N +          PEN  +R+ L AMLTPYI RK+    G  T  + + K        P L   N +R+    +  S   S     E D  FGA+F FS + KELI+GE+F+R+YNEQ  F LE P++F   LL ++ S+ +Y+            TLL  S+     + +  +R +  + AL AL NVI  NP    + IGHFK+LFSL+       +Q+  +EVV +VTS++EC+ +I  S VL +L+ LL SL S+  L+L+T+  + S T ++KE + +G LIY L + C+     V+   A L  KM +DKLVG ++R  L++FLP +F+D+M+DN E  VH+++  HENPELIWN+ +R+ +ST V E    +F++Q+ + +  W +PDDF V Y +     L VGGV+L ++++ PGW LR P EF   L     ++++K++ +     E LE  T A   L ++ S L D++P  G++ ++   LN  + + P  K+ + + + +S+++LCV +MA++ETI PLM AMKVR D  G+A E L R+FQ    +L+AQA+++ LV Y+L LLE  GL  +++P   KA  VKALK+M RS  +G QV  +L  SS+WS FKDQ HDL+++++ Q AGYLTG  V  AGYLT+    T
Sbjct:  846 IKRSYEFFNELYHRFLLTPKVTMKCLCLQALAIVYGRCFEEIGPFADTKYIVGMLDRCTDKLERDRLILFLNKLILNKKNVKDVMDSNGVRILVDLLTLAHLHTSRATVPLQSNVLEAAPDMKRESE---KEWYFGNADKERRGPFSFEEMQEFWNTGILTAKTRCWAQGMDGWRPLQAIPQLKWC--LLATGQAVMNESDLATLILNMLITMCSYYPSRDQDNAIIRPLPKIKRMISDNACLPHIVQLLLTFDPILVEKVANLLYLVMQDNPNLQRLYLTGIFFFIMMYTGSNVLPVARFLKYTHLKQAFKSEEA-KGQDIVQRSVLGPVLPEAMVCYLENYEPERFSEIFLGEFDTPEAIWSSEMRRMMIEKIAAHIADFSPRLQSNTRALYQYCPIPVISFPQLDNELFCNIYYLRHLCDTTRFPNWPIRDPVKLLKDTLEAWKREVEKKPPSMSVDDAYEVL------NLPKGQGQ--HEESKIRKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSARIVDGPDPENIILILKTQSILFNLHKKELEPYKYAGYPMLIKTITMETEDEQLFSKTSPLLPASTELAFHTVSCSALNAEELRRENGIEILLEALSRCVAVLTASSKPEDMAVQVCGHTCRCYSVAAQFEECREKIIEQPNIIRDLCHILYYGKTLPKTAALAVQCVSSFAVDFFLQTHLFHAGVLWHLLGYLFGYDYTLEESGVQANQDTNQQEVANNLAKLSLVALSRLGGFAHTPDGNNPVAETNGVEGAPPENPTIRKSLAAMLTPYISRKL----GTGTPAEQLRK------PPPDLEQRNSSRASRVVFFRSPFPS---QGENDKSFGADFVFSDHSKELIVGEIFVRVYNEQPTFPLEYPKAFAASLLDYVGSQAQYLH-----------TLLAMSHSNKVESQQHAERLRFAEMALEALRNVIKNNPGSETECIGHFKLLFSLLRVHGAGRVQQLVLEVVSTVTSNQECVGNIAESMVLSNLLLLLHSLPSSRQLVLETLHALTSNTKIVKEAMAKGALIYLLDLFCNCTHPQVRTQTAELFSKMTSDKLVGPKVRLTLMRFLPGVFMDAMRDNAEAAVHIFEGTHENPELIWNDSSREKVSTTVREMMLDHFKQQKDNPDVNWKLPDDFTVAYGAGQG-ELEVGGVFLRIFIAQPGWVLRKPREFLVSLLETLTELLEKNNPNG----EALETVTTAAVCLFSTQSQLADQVPPLGHLPRIIAALNHKNNAIP--KSSIRVIHVLSDNELCVRSMASLETIGPLMAAMKVRADMAGVACEALNRMFQKEQTDLVAQALRVDLVPYLLKLLEGVGLETIENPSATKAQIVKALKSMTRSLQYGEQVNEILSKSSVWSAFKDQKHDLFISDS-QTAGYLTGPGV--AGYLTAGTGTT 2227          

HSP 2 Score: 847.04 bits (2187), Expect = 0.000e+0
Identity = 434/872 (49.77%), Postives = 582/872 (66.74%), Query Frame = 2
Query:   32 MNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTHMQ-----EIQRKNKEAWRIVEK----KIDNLLMHWRSKIGINMKPMKDKDEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVG 2620
            + +N D  C+  TKH+WRG YKR+ ++GS GITTY+  TL+VTNQWPY +IC I P  K  +  +F L  R+   KK + ++FS++ R ++L EA+ +   F E      + N  K  W++   PV LEV    + QIDP+T+RVV  Y Y+++E   ++SD+  GF I   GFSRLH+F +  RD+ IR+  E A N + I L   KEA++ +  +  R+GKYS DE ITS AEF+VQK++        PV+RIL LTETCLVERDP +Y ++T++P  ++FALI D   PQ F  E++ G  R Y ST+RDSLLASLLDG R+SGNRDVCVKM  T R  R+G L +P++EEVES H++ L   P G  F +AVFRFNAN+SYSG+LHAVTQ+GLF+ENKEKLI  A+ AL+++E     ++A+ LE+QF A+RRLVASKAGFQAFTQL K RE LG K V AL+RNN  VTHAAID + AL+ PMH++YD+RQEQLNKAS++SS KFL+NLL+ F  +V  GTGALVIS +LDFLTF +C PY ET++G+ FD LL++V+  GR +FKLF HPS+AIVKGA L+M+A+I+E D  +   MQ LAL+EGALP+HL  S F  ++DQR L  RQL+R L+ LW   N +A  LLKR+LP GL+ YL+S++  P  +VD +  RDN++LA   +      E QR   +A + VEK    K D +LMHWR K+GI  K  ++ ++KPV LRKRR+RIK+  NW +F+Y+F  DHA+ NL+WN+KTREE RDALE E+  F  +R+                                        +  A  +SWN+ EF++ Y CL +EIK+G
Sbjct:    4 VKENKDLACFYTTKHSWRGKYKRVFSVGSHGITTYNPTTLEVTNQWPYGDICGIGPVGKG-QGTEFSLTFRKGSGKKSETLKFSTEHRTDLLTEALRFRTEFSEGKITGRRYNCYKHHWSDTRKPVSLEVTPGGIDQIDPHTNRVVCSYDYRNVEGFVEVSDYQGGFCILYGGFSRLHLFASEQRDDIIRSAIEHAANFIGIMLRLRKEALTFEGFVTDRLGKYSSDESITSLAEFVVQKISPRH---PEPVKRILALTETCLVERDPASYNIVTVKPFGEVFALICDADNPQVFTAEFIRGQIRKYSSTERDSLLASLLDGVRASGNRDVCVKMAPTQRGQRWGLLSMPVDEEVESLHLRFLAAPPNG-NFADAVFRFNANISYSGVLHAVTQDGLFSENKEKLINNAILALLSQEVELPTLNAE-LESQFQAIRRLVASKAGFQAFTQLPKFREKLGVKTVKALKRNNNGVTHAAIDMLCALMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFITNVDHGTGALVISSLLDFLTFALCAPYSETTEGQQFDMLLEMVATNGRTLFKLFQHPSMAIVKGADLVMKAIIEEGDKEIATKMQELALSEGALPRHLHTSLFTISSDQRMLTNRQLSRHLVGLWTAENPVAMNLLKRILPTGLLAYLDSSDSVPEKDVDRMHIRDNLKLATDQLNRNKVPEWQRIAGKAAKEVEKFAKEKADVVLMHWRDKMGIAQK--ENPNQKPVILRKRRQRIKIEANWELFYYRFQLDHARSNLIWNLKTREELRDALEGEMRAFGVDRE----------------------------------------LGNATVISWNHQEFEVKYECLSDEIKIG 827          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Medaka
Match: DNAJC13 (DnaJ heat shock protein family (Hsp40) member C13 [Source:NCBI gene;Acc:101164685])

HSP 1 Score: 1263.06 bits (3267), Expect = 0.000e+0
Identity = 678/1412 (48.02%), Postives = 961/1412 (68.06%), Query Frame = 2
Query: 2876 IRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNR-AKLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYF-KNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNE-ENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEA-GLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVET 7099
            I++SYEFF++LY RFL   K  MKC+CL A++IVYGRC +EIGP  D +  + +L+R T++LERDRL+L L KLI+NK N++ ++D+NG+R+LVDL+T+AH+H +RA +P QSNV+EAA D + + +   KEW++   +KE+ GP SF+E+ +  + G +    + WAQG+D WR   ++PQ++W    L TGQAV   S++A+  L++L+ +C  YPS+DQ   IIRP+P+ K+ I+    L HIVQLLLTFDP LVEK+A LL +V  +NP   RLY+TG+F+FI+MY GSNVL +A FLK TH+ QAF+++E+ K  +IV RS++G +LPEAM+C+LEN+  E+F++I+LG++DTPE IW+SEMRR MIEKIA H+ +F+PRL SN RA YQY  IP+IS+PQL+NELFC  YYLRHLCDT RFP+WPIR PV LL+D L+AWK E+EKKPPSMSV +AYEVL      NL   Q     EES IRKAYF+L+ KYHPD+NP+GR+ FEK+N AY+FLC + A++  GPDP+NI L+LK+QSILF   +KE+E +KY+GYPMLIKTI  ETEDEQLF K +PLL    ELA+HTV+ SALNAEELRR++GI+ L  A SRCV ++TASS   D +V+VCG+    +SVAAQFE CR++I E P I RDL  +LY+ K LP+ ++L  +CV+  + D +LQT +F  G ++HLL Y+F +DYTLEE GV  +++ ++QE+ N LA L+++A++RL G  N  E  P     PEN  +R+ L AMLTPYI RK+    G  T  + + K        P L   N +R+    +  S   S     E D  FGA+F FS + KELI+GE+F+R+YNEQ  F LE P++F   LL ++ S+ +Y+            TLL  S+     + +  +R +  + AL AL NVI  NP    + IGHFK+LFSL+       +Q+  +EVV +VTS++EC+ +I  S VL +L+ LL SL S+  L+L+T+  + S T ++KE + +G LIY L + C+     V+   A L  KM +DKLVG ++R  L++FLP +F+D+M+DN E  VH+++  HENPELIWN+ +R+ +ST V E    +F++Q+ + +  W +PDDF V Y +     L VGGV+L ++++ PGW LR P EF   L     ++++K++ +     E LE  T A   L ++ S L D++P  G++ ++   LN  + + P  K+ + + + +S+++LCV +MA++ETI PLM AMKVR D  G+A E L R+FQ    +L+AQA+++ LV Y+L LLE  GL  +++P   KA  VKALK+M RS  +G QV  +L  SS+WS FKDQ HDL+++++ Q AGYLTG S  +
Sbjct:  846 IKRSYEFFNELYHRFLLTPKVTMKCLCLQALAIVYGRCFEEIGPFADTKYIVGMLDRCTDKLERDRLILFLNKLILNKKNVKDVMDSNGVRILVDLLTLAHLHTSRATVPLQSNVLEAAPDMKRESE---KEWYFGNADKERRGPFSFEEMQEFWNTGILTAKTRCWAQGMDGWRPLQAIPQLKWC--LLATGQAVMNESDLATLILNMLITMCSYYPSRDQDNAIIRPLPKIKRMISDNACLPHIVQLLLTFDPILVEKVANLLYLVMQDNPNLQRLYLTGIFFFIMMYTGSNVLPVARFLKYTHLKQAFKSEEA-KGQDIVQRSVLGPVLPEAMVCYLENYEPERFSEIFLGEFDTPEAIWSSEMRRMMIEKIAAHIADFSPRLQSNTRALYQYCPIPVISFPQLDNELFCNIYYLRHLCDTTRFPNWPIRDPVKLLKDTLEAWKREVEKKPPSMSVDDAYEVL------NLPKGQGQ--HEESKIRKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSARIVDGPDPENIILILKTQSILFNLHKKELEPYKYAGYPMLIKTITMETEDEQLFSKTSPLLPASTELAFHTVSCSALNAEELRRENGIEILLEALSRCVAVLTASSKPEDMAVQVCGHTCRCYSVAAQFEECREKIIEQPNIIRDLCHILYYGKTLPKTAALAVQCVSSFAVDFFLQTHLFHAGVLWHLLGYLFGYDYTLEESGVQANQDTNQQEVANNLAKLSLVALSRLGGFTNGVEGAP-----PENPTIRKSLAAMLTPYISRKL----GTGTPAEQLRK------PPPDLEQRNSSRASRVVFFRSPFPS---QGENDKSFGADFVFSDHSKELIVGEIFVRVYNEQPTFPLEYPKAFAASLLDYVGSQAQYLH-----------TLLAMSHSNKVESQQHAERLRFAEMALEALRNVIKNNPGSETECIGHFKLLFSLLRVHGAGRVQQLVLEVVSTVTSNQECVGNIAESMVLSNLLLLLHSLPSSRQLVLETLHALTSNTKIVKEAMAKGALIYLLDLFCNCTHPQVRTQTAELFSKMTSDKLVGPKVRLTLMRFLPGVFMDAMRDNAEAAVHIFEGTHENPELIWNDSSREKVSTTVREMMLDHFKQQKDNPDVNWKLPDDFTVAYGAGQG-ELEVGGVFLRIFIAQPGWVLRKPREFLVSLLETLTELLEKNNPNG----EALETVTTAAVCLFSTQSQLADQVPPLGHLPRIIAALNHKNNAIP--KSSIRVIHVLSDNELCVRSMASLETIGPLMAAMKVRADMAGVACEALNRMFQKEQTDLVAQALRVDLVPYLLKLLEGVGLETIENPSATKAQIVKALKSMTRSLQYGEQVNEILSKSSVWSAFKDQKHDLFISDS-QTAGYLTGVSTPS 2206          

HSP 2 Score: 847.04 bits (2187), Expect = 0.000e+0
Identity = 434/872 (49.77%), Postives = 582/872 (66.74%), Query Frame = 2
Query:   32 MNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTHMQ-----EIQRKNKEAWRIVEK----KIDNLLMHWRSKIGINMKPMKDKDEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVG 2620
            + +N D  C+  TKH+WRG YKR+ ++GS GITTY+  TL+VTNQWPY +IC I P  K  +  +F L  R+   KK + ++FS++ R ++L EA+ +   F E      + N  K  W++   PV LEV    + QIDP+T+RVV  Y Y+++E   ++SD+  GF I   GFSRLH+F +  RD+ IR+  E A N + I L   KEA++ +  +  R+GKYS DE ITS AEF+VQK++        PV+RIL LTETCLVERDP +Y ++T++P  ++FALI D   PQ F  E++ G  R Y ST+RDSLLASLLDG R+SGNRDVCVKM  T R  R+G L +P++EEVES H++ L   P G  F +AVFRFNAN+SYSG+LHAVTQ+GLF+ENKEKLI  A+ AL+++E     ++A+ LE+QF A+RRLVASKAGFQAFTQL K RE LG K V AL+RNN  VTHAAID + AL+ PMH++YD+RQEQLNKAS++SS KFL+NLL+ F  +V  GTGALVIS +LDFLTF +C PY ET++G+ FD LL++V+  GR +FKLF HPS+AIVKGA L+M+A+I+E D  +   MQ LAL+EGALP+HL  S F  ++DQR L  RQL+R L+ LW   N +A  LLKR+LP GL+ YL+S++  P  +VD +  RDN++LA   +      E QR   +A + VEK    K D +LMHWR K+GI  K  ++ ++KPV LRKRR+RIK+  NW +F+Y+F  DHA+ NL+WN+KTREE RDALE E+  F  +R+                                        +  A  +SWN+ EF++ Y CL +EIK+G
Sbjct:    4 VKENKDLACFYTTKHSWRGKYKRVFSVGSHGITTYNPTTLEVTNQWPYGDICGIGPVGKG-QGTEFSLTFRKGSGKKSETLKFSTEHRTDLLTEALRFRTEFSEGKITGRRYNCYKHHWSDTRKPVSLEVTPGGIDQIDPHTNRVVCSYDYRNVEGFVEVSDYQGGFCILYGGFSRLHLFASEQRDDIIRSAIEHAANFIGIMLRLRKEALTFEGFVTDRLGKYSSDESITSLAEFVVQKISPRH---PEPVKRILALTETCLVERDPASYNIVTVKPFGEVFALICDADNPQVFTAEFIRGQIRKYSSTERDSLLASLLDGVRASGNRDVCVKMAPTQRGQRWGLLSMPVDEEVESLHLRFLAAPPNG-NFADAVFRFNANISYSGVLHAVTQDGLFSENKEKLINNAILALLSQEVELPTLNAE-LESQFQAIRRLVASKAGFQAFTQLPKFREKLGVKTVKALKRNNNGVTHAAIDMLCALMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFITNVDHGTGALVISSLLDFLTFALCAPYSETTEGQQFDMLLEMVATNGRTLFKLFQHPSMAIVKGADLVMKAIIEEGDKEIATKMQELALSEGALPRHLHTSLFTISSDQRMLTNRQLSRHLVGLWTAENPVAMNLLKRILPTGLLAYLDSSDSVPEKDVDRMHIRDNLKLATDQLNRNKVPEWQRIAGKAAKEVEKFAKEKADVVLMHWRDKMGIAQK--ENPNQKPVILRKRRQRIKIEANWELFYYRFQLDHARSNLIWNLKTREELRDALEGEMRAFGVDRE----------------------------------------LGNATVISWNHQEFEVKYECLSDEIKIG 827          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Medaka
Match: DNAJC13 (DnaJ heat shock protein family (Hsp40) member C13 [Source:NCBI gene;Acc:101164685])

HSP 1 Score: 1259.97 bits (3259), Expect = 0.000e+0
Identity = 679/1429 (47.52%), Postives = 966/1429 (67.60%), Query Frame = 2
Query: 2876 IRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNR-AKLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLS--------PENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEA-GLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTSFAQNT 7132
            I++SYEFF++LY RFL   K  MKC+CL A++IVYGRC +EIGP  D +  + +L+R T++LERDRL+L L KLI+NK N++ ++D+NG+R+LVDL+T+AH+H +RA +P QSNV+EAA D + + +   KEW++   +KE+ GP SF+E+ +  + G +    + WAQG+D WR   ++PQ++W    L TGQAV   S++A+  L++L+ +C  YPS+DQ   IIRP+P+ K+ I+    L HIVQLLLTFDP LVEK+A LL +V  +NP   RLY+TG+F+FI+MY GSNVL +A FLK TH+ QAF+++E+ K  +IV RS++G +LPEAM+C+LEN+  E+F++I+LG++DTPE IW+SEMRR MIEKIA H+ +F+PRL SN RA YQY  IP+IS+PQL+NELFC  YYLRHLCDT RFP+WPIR PV LL+D L+AWK E+EKKPPSMSV +AYEVL      NL   Q     EES IRKAYF+L+ KYHPD+NP+GR+ FEK+N AY+FLC + A++  GPDP+NI L+LK+QSILF   +KE+E +KY+GYPMLIKTI  ETEDEQLF K +PLL    ELA+HTV+ SALNAEELRR++GI+ L  A SRCV ++TASS   D +V+VCG+    +SVAAQFE CR++I E P I RDL  +LY+  + + ++L  +CV+  + D +LQT +F  G ++HLL Y+F +DYTLEE GV  +++ ++QE+ N LA L+++A++RL G  +  +  N +          PEN  +R+ L AMLTPYI RK+    G  T  + + K        P L   N +R+    +  S   S     E D  FGA+F FS + KELI+GE+F+R+YNEQ  F LE P++F   LL ++ S+ +Y+            TLL  S+     + +  +R +  + AL AL NVI  NP    + IGHFK+LFSL+       +Q+  +EVV +VTS++EC+ +I  S VL +L+ LL SL S+  L+L+T+  + S T ++KE + +G LIY L + C+     V+   A L  KM +DKLVG ++R  L++FLP +F+D+M+DN E  VH+++  HENPELIWN+ +R+ +ST V E    +F++Q+ + +  W +PDDF V Y +     L VGGV+L ++++ PGW LR P EF   L     ++++K++ +     E LE  T A   L ++ S L D++P  G++ ++   LN  + + P  K+ + + + +S+++LCV +MA++ETI PLM AMKVR D  G+A E L R+FQ    +L+AQA+++ LV Y+L LLE  GL  +++P   KA  VKALK+M RS  +G QV  +L  SS+WS FKDQ HDL+++++ Q AGYLTG  V  AGYLT+    T
Sbjct:  851 IKRSYEFFNELYHRFLLTPKVTMKCLCLQALAIVYGRCFEEIGPFADTKYIVGMLDRCTDKLERDRLILFLNKLILNKKNVKDVMDSNGVRILVDLLTLAHLHTSRATVPLQSNVLEAAPDMKRESE---KEWYFGNADKERRGPFSFEEMQEFWNTGILTAKTRCWAQGMDGWRPLQAIPQLKWC--LLATGQAVMNESDLATLILNMLITMCSYYPSRDQDNAIIRPLPKIKRMISDNACLPHIVQLLLTFDPILVEKVANLLYLVMQDNPNLQRLYLTGIFFFIMMYTGSNVLPVARFLKYTHLKQAFKSEEA-KGQDIVQRSVLGPVLPEAMVCYLENYEPERFSEIFLGEFDTPEAIWSSEMRRMMIEKIAAHIADFSPRLQSNTRALYQYCPIPVISFPQLDNELFCNIYYLRHLCDTTRFPNWPIRDPVKLLKDTLEAWKREVEKKPPSMSVDDAYEVL------NLPKGQGQ--HEESKIRKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSARIVDGPDPENIILILKTQSILFNLHKKELEPYKYAGYPMLIKTITMETEDEQLFSKTSPLLPASTELAFHTVSCSALNAEELRRENGIEILLEALSRCVAVLTASSKPEDMAVQVCGHTCRCYSVAAQFEECREKIIEQPNIIRDLCHILYYGKV-RTAALAVQCVSSFAVDFFLQTHLFHAGVLWHLLGYLFGYDYTLEESGVQANQDTNQQEVANNLAKLSLVALSRLGGFAHTPDGNNPVAETNGVEGAPPENPTIRKSLAAMLTPYISRKL----GTGTPAEQLRK------PPPDLEQRNSSRASRVVFFRSPFPS---QGENDKSFGADFVFSDHSKELIVGEIFVRVYNEQPTFPLEYPKAFAASLLDYVGSQAQYLH-----------TLLAMSHSNKVESQQHAERLRFAEMALEALRNVIKNNPGSETECIGHFKLLFSLLRVHGAGRVQQLVLEVVSTVTSNQECVGNIAESMVLSNLLLLLHSLPSSRQLVLETLHALTSNTKIVKEAMAKGALIYLLDLFCNCTHPQVRTQTAELFSKMTSDKLVGPKVRLTLMRFLPGVFMDAMRDNAEAAVHIFEGTHENPELIWNDSSREKVSTTVREMMLDHFKQQKDNPDVNWKLPDDFTVAYGAGQG-ELEVGGVFLRIFIAQPGWVLRKPREFLVSLLETLTELLEKNNPNG----EALETVTTAAVCLFSTQSQLADQVPPLGHLPRIIAALNHKNNAIP--KSSIRVIHVLSDNELCVRSMASLETIGPLMAAMKVRADMAGVACEALNRMFQKEQTDLVAQALRVDLVPYLLKLLEGVGLETIENPSATKAQIVKALKSMTRSLQYGEQVNEILSKSSVWSAFKDQKHDLFISDS-QTAGYLTGPGV--AGYLTAGTGTT 2230          

HSP 2 Score: 818.92 bits (2114), Expect = 0.000e+0
Identity = 431/881 (48.92%), Postives = 578/881 (65.61%), Query Frame = 2
Query:   32 MNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWV-------TGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTHMQ-----EIQRKNKEAWRIVEK----KIDNLLMHWRSKIGINMK--PMKDKDEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVG 2620
            + +N D  C+  TKH+WRG YKR+ ++GS GITTY+  TL+VTNQWPY +IC I P  K  +  +F L  R+   KK + ++FS++ R ++L EA+ +   F E      + N  K  W++   PV LEV    + QIDP+T+RVV  Y Y+++E   ++SD+  GF I   GFSRLH+F +  RD+ IR+  E A N + I L   KEA++ +  +  R+GKYS DE ITS AEF+VQK++     P+ PV+RIL LTETCLVERDP +Y ++T++P  ++FALI D   PQ F  E++ G  R Y ST+RDSLLASLLDG R+SGNRDVCVKM  T R  R+G L +P++EEVES H++ L   P G  F +AVFRFNAN+SYSG+LHAVTQ+GLF+ENKEKLI  A+ AL+++E     ++A+ LE+QF A+RRLVASKAGFQAFTQL K RE LG K V AL+RNN  VTHAAID + AL+ PMH++YD+RQEQLNKAS++SS KFL+NLL+ F  +V  GTGALVIS +LDFLTF +C PY ET++G+ FD LL++V+  GR +FKLF HPS+AIVKGA L+M+A+I+E D  +   MQ LAL+EGALP+HL  S F  ++DQR L     NR  L+L V       TGN +    L R  P GL+ YL+S++  P  +VD +  RDN++LA   +      E QR   +A + VEK    K D +LMHWR K+GI  K   + + ++KPV LRKRR+RIK+  NW +F+Y+F  DHA+ NL+WN+KTREE RDALE E+  F  +R+                                        +  A  +SWN+ EF++ Y CL +EIK+G
Sbjct:    4 VKENKDLACFYTTKHSWRGKYKRVFSVGSHGITTYNPTTLEVTNQWPYGDICGIGPVGKG-QGTEFSLTFRKGSGKKSETLKFSTEHRTDLLTEALRFRTEFSEGKITGRRYNCYKHHWSDTRKPVSLEVTPGGIDQIDPHTNRVVCSYDYRNVEGFVEVSDYQGGFCILYGGFSRLHLFASEQRDDIIRSAIEHAANFIGIMLRLRKEALTFEGFVTDRLGKYSSDESITSLAEFVVQKISPRH--PE-PVKRILALTETCLVERDPASYNIVTVKPFGEVFALICDADNPQVFTAEFIRGQIRKYSSTERDSLLASLLDGVRASGNRDVCVKMAPTQRGQRWGLLSMPVDEEVESLHLRFLAAPPNG-NFADAVFRFNANISYSGVLHAVTQDGLFSENKEKLINNAILALLSQEVELPTLNAE-LESQFQAIRRLVASKAGFQAFTQLPKFREKLGVKTVKALKRNNNGVTHAAIDMLCALMCPMHDDYDLRQEQLNKASLLSSKKFLENLLEKFITNVDHGTGALVISSLLDFLTFALCAPYSETTEGQQFDMLLEMVATNGRTLFKLFQHPSMAIVKGADLVMKAIIEEGDKEIATKMQELALSEGALPRHLHTSLFTISSDQRMLT----NRSTLTLSVRSYRQDNTGNRIKNSYLPR--PTGLLAYLDSSDSVPEKDVDRMHIRDNLKLATDQLNRNKVPEWQRIAGKAAKEVEKFAKEKADVVLMHWRDKMGIAQKEVSLSNPNQKPVILRKRRQRIKIEANWELFYYRFQLDHARSNLIWNLKTREELRDALEGEMRAFGVDRE----------------------------------------LGNATVISWNHQEFEVKYECLSDEIKIG 832          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Planmine SMEST
Match: SMESG000061705.1 (SMESG000061705.1)

HSP 1 Score: 4825 bits (12514), Expect = 0.000e+0
Identity = 2377/2377 (100.00%), Postives = 2377/2377 (100.00%), Query Frame = 2
Query:   17 MLNPCMNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTHMQEIQRKNKEAWRIVEKKIDNLLMHWRSKIGINMKPMKDKDEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVGXXXXXXXXXXXXXVSRIIREKEYIASLENHSTVENGRHLSDRTSLNDQNIESQNGAESDTKSENSLNSKLAPNETEVGAVGGVIKIRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRAKLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEAGLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTSFAQNTPNKPF 7147
            MLNPCMNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTHMQEIQRKNKEAWRIVEKKIDNLLMHWRSKIGINMKPMKDKDEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVGDYYLRLLLEEDERVSRIIREKEYIASLENHSTVENGRHLSDRTSLNDQNIESQNGAESDTKSENSLNSKLAPNETEVGAVGGVIKIRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQLERDRLLLLLEKLIINKNNIELIIDANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRAKLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQEAAVEVVKSVTSSEECLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEAGLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTSFAQNTPNKPF
Sbjct:    1 MLNPCMNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTHMQEIQRKNKEAWRIVEKKIDNLLMHWRSKIGINMKPMKDKDEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVGDYYLRLLLEEDERVSRIIREKEYIASLENHSTVENGRHLSDRTSLNDQNIESQNGAESDTKSENSLNSKLAPNETEVGAVGGVIKIRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQLERDRLLLLLEKLIINKNNIELIIDANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRAKLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQEAAVEVVKSVTSSEECLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEAGLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTSFAQNTPNKPF 2377          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Planmine SMEST
Match: SMESG000061705.1 (SMESG000061705.1)

HSP 1 Score: 4813.82 bits (12485), Expect = 0.000e+0
Identity = 2372/2372 (100.00%), Postives = 2372/2372 (100.00%), Query Frame = 2
Query:   32 MNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTHMQEIQRKNKEAWRIVEKKIDNLLMHWRSKIGINMKPMKDKDEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVGXXXXXXXXXXXXXVSRIIREKEYIASLENHSTVENGRHLSDRTSLNDQNIESQNGAESDTKSENSLNSKLAPNETEVGAVGGVIKIRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQXXXXXXXXXXXXXXXXXXXXXXXXXANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRAKLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQXXXXXXXXXXXXXXXCLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEAGLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTSFAQNTPNKPF 7147
            MNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTHMQEIQRKNKEAWRIVEKKIDNLLMHWRSKIGINMKPMKDKDEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVGDYYLRLLLEEDERVSRIIREKEYIASLENHSTVENGRHLSDRTSLNDQNIESQNGAESDTKSENSLNSKLAPNETEVGAVGGVIKIRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQLERDRLLLLLEKLIINKNNIELIIDANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRAKLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQEAAVEVVKSVTSSEECLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEAGLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTSFAQNTPNKPF
Sbjct:    1 MNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVTNQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTSRVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVAEEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLATHRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQRFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLRFGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVTQEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKAGFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYDIRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTICPPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALIDEADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSLWVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTHMQEIQRKNKEAWRIVEKKIDNLLMHWRSKIGINMKPMKDKDEKPVCLRKRRKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRERDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVSWNYVEFKIIYRCLENEIKVGDYYLRLLLEEDERVSRIIREKEYIASLENHSTVENGRHLSDRTSLNDQNIESQNGAESDTKSENSLNSKLAPNETEVGAVGGVIKIRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPVNDCELFISLLERTTNQLERDRLLLLLEKLIINKNNIELIIDANGIRVLVDLITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGPLSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQAVFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTHIVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNVLSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPSEQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQYLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQAWKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQLSMKYHPDRNPDGREQFEKINTAYQFLCNRAKLWSGPDPKNIYLLLKSQSILFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYHTVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYITIFFSVAAQFEACRQRIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLSCDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLALLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEFKGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSECDHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLKSEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVNVIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQEAAVEVVKSVTSSEECLEDIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIYTLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSMKDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLNKKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLFSKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHKVFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKVRQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEAGLVNVKDPGQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTPQVAGYLTGRSVETAGYLTSFAQNTPNKPF 2372          
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Planmine SMEST
Match: SMESG000061691.1 (SMESG000061691.1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.251e-21
Identity = 47/60 (78.33%), Postives = 50/60 (83.33%), Query Frame = 2
Query:  167 WPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILAEAMDYSNLFQEK 346
            WPYSE+CSIE +SKNPK NKFVLWLRE  D  KKD  FSSDF VNILAE MDYS+LFQEK
Sbjct:  141 WPYSEMCSIESNSKNPKFNKFVLWLREVAD-MKKDKIFSSDFSVNILAETMDYSHLFQEK 199          
The following BLAST results are available for this feature:
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAJC130.000e+048.53DnaJ heat shock protein family (Hsp40) member C13 ... [more]
DNAJC130.000e+052.77DnaJ heat shock protein family (Hsp40) member C13 ... [more]
DNAJC136.138e-3343.28DnaJ heat shock protein family (Hsp40) member C13 ... [more]
DNAJC134.447e-1856.25DnaJ heat shock protein family (Hsp40) member C13 ... [more]
DNAJA45.662e-641.67DnaJ heat shock protein family (Hsp40) member A4 [... [more]
back to top
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rme-80.000e+039.65Endocytosis protein RME-8; Receptor Mediated Endoc... [more]
rme-80.000e+039.43Endocytosis protein RME-8; Receptor Mediated Endoc... [more]
dnj-123.924e-648.72DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-123.924e-648.72DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
back to top
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rme-84.385e-9843.37gene:FBgn0015477 transcript:FBtr0339370[more]
Rme-84.540e-9843.44gene:FBgn0015477 transcript:FBtr0088618[more]
back to top
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
smad30.000e+048.60SMAD family member 3 [Source:Xenbase;Acc:XB-GENE-4... [more]
smad30.000e+048.60SMAD family member 3 [Source:Xenbase;Acc:XB-GENE-4... [more]
smad30.000e+048.58SMAD family member 3 [Source:Xenbase;Acc:XB-GENE-4... [more]
smad30.000e+048.46SMAD family member 3 [Source:Xenbase;Acc:XB-GENE-4... [more]
back to top
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnajc130.000e+048.48DnaJ heat shock protein family (Hsp40) member C13 ... [more]
Dnajc130.000e+048.48DnaJ heat shock protein family (Hsp40) member C13 ... [more]
Dnajc133.897e-3241.79DnaJ heat shock protein family (Hsp40) member C13 ... [more]
Dnajc131.490e-1933.33DnaJ heat shock protein family (Hsp40) member C13 ... [more]
Dnajc134.237e-1956.25DnaJ heat shock protein family (Hsp40) member C13 ... [more]
back to top
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75165|DJC13_HUMAN0.000e+048.53DnaJ homolog subfamily C member 13 OS=Homo sapiens... [more]
sp|F4IVL6|GRV2_ARATH1.768e-16629.54DnaJ homolog subfamily C GRV2 OS=Arabidopsis thali... [more]
sp|Q7VG06|DNAJ_HELHP3.311e-644.23Chaperone protein DnaJ OS=Helicobacter hepaticus (... [more]
sp|B5ENA2|DNAJ_ACIF57.718e-638.36Chaperone protein DnaJ OS=Acidithiobacillus ferroo... [more]
sp|B7J7X8|DNAJ_ACIF27.718e-638.36Chaperone protein DnaJ OS=Acidithiobacillus ferroo... [more]
back to top
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4M1F00.000e+041.01Endosomal trafficking protein, putative OS=Schisto... [more]
A0A1V9X6Z50.000e+043.17DnaJsubfamily C member 13-like OS=Tropilaelaps mer... [more]
A0A068WUS30.000e+039.61DnaJ subfamily C 3 OS=Echinococcus granulosus OX=6... [more]
W6UNW00.000e+039.49DnaJ subfamily C member protein OS=Echinococcus gr... [more]
A0A068XZX10.000e+039.36DnaJ subfamily C 3 OS=Echinococcus multilocularis ... [more]
back to top
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
DNAJC130.000e+049.02DnaJ heat shock protein family (Hsp40) member C13 ... [more]
dnajb21.920e-641.18DnaJ heat shock protein family (Hsp40) member B2 [... [more]
back to top
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
DNAJC130.000e+048.74DnaJ heat shock protein family (Hsp40) member C13 ... [more]
back to top
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO278395.996e-1544.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
DNAJC130.000e+048.07DnaJ heat shock protein family (Hsp40) member C13 ... [more]
DNAJC130.000e+047.69DnaJ heat shock protein family (Hsp40) member C13 ... [more]
DNAJC130.000e+048.02DnaJ heat shock protein family (Hsp40) member C13 ... [more]
DNAJC130.000e+047.52DnaJ heat shock protein family (Hsp40) member C13 ... [more]
back to top
BLAST of DnaJ heat shock protein family (Hsp40) member C13 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000061705.10.000e+0100.00SMESG000061705.1[more]
SMESG000061705.10.000e+0100.00SMESG000061705.1[more]
SMESG000061691.12.251e-2178.33SMESG000061691.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004783 ID=SMED30004783|Name=DnaJ heat shock protein family (Hsp40) member C13|organism=Schmidtea mediterranea sexual|type=transcript|length=7422bp
ATAAAATTGAATGACAATGCTTAATCCTTGTATGAATAAAAATGTTGATG
AAACATGCTACTGTGTAACGAAACATGCATGGAGAGGAAATTATAAAAGA
TTGATAACTCTCGGATCACTAGGAATTACAACATATCATTCTGAAACACT
AAAAGTGACAAATCAATGGCCATATAGTGAAATTTGTAGTATTGAGCCAG
ATAGTAAAAATCCAAAATCCAATAAATTTGTTTTGTGGCTTCGCGAAGCA
GGAGATAAGAAAAAAAAAGATATGAGATTTTCATCAGATTTTAGAGTGAA
TATACTTGCCGAAGCAATGGATTACAGTAATTTATTTCAAGAAAAAACTC
GTCCTAGATTGAAAGTGAATTCAAACAAATTCCGCTGGAATGAAAAATGT
GTTCCAGTAATATTGGAAGTCAACAGTCATTGCGTTTCTCAAATTGACCC
AAACACGAGCCGAGTGGTTTCTATGTATTATTATAAAGACATTGAAATGC
TTGCAAAGATATCGGATCATAATCAGGGATTTGTCATCGCATGTAACGGA
TTCAGTCGCTTGCACATATTTTATGCAAATAACAGGGATGAATTTATTCG
AACAGTTGCCGAAGAGGCTTTTAATAAGATGGCAATATGCTTGCATGAAG
CCAAAGAAGCCATATCAATGGATTATGTCTTGGAGCACAGAATGGGTAAA
TATAGTCAGGATGAGCATATTACTTCACACGCAGAATTTATGGTCCAGAA
ATTAGCAACTCACAGATATGGGCCAGATAATCCTGTACAGCGGATTCTCT
GTCTAACAGAAACTTGTTTAGTGGAAAGAGATCCTGAAACATATATTTTA
ATAACTCTCCGACCACTATGTGATATTTTTGCTCTGATTCGTGATCCACA
AGAGCCCCAGAGATTCATAATTGAATATGTTCATGGTTTAAACAGAACTT
ATTTGTCCACTGACCGAGATTCATTATTGGCATCTTTACTTGATGGGGCA
CGTTCTAGTGGTAATCGAGATGTGTGCGTTAAAATGAAAAAGACAGATAG
ATGTTTAAGATTTGGACCTTTGATTGTACCAATGGAAGAAGAAGTAGAAT
CTCAGCATATGAAGATGCTCCAACAAACACCAGGAGGAATGGGTTTTAAC
GAAGCAGTTTTTAGATTCAATGCAAATGTTTCTTACAGTGGGCTTTTACA
CGCAGTTACTCAAGAAGGTCTTTTTGCAGAAAATAAAGAAAAACTAATTA
AAGGAGCTTTAAGTGCTTTAATAAATAGAGAAGGAAATCAAGAGGAGATA
TCAGCTCAAGATTTAGAAGCCCAATTTCATGCACTCAGACGACTTGTAGC
ATCGAAAGCAGGATTTCAAGCATTTACTCAACTTAATAAAATGCGGGAGA
CACTGGGTAGAAAAGTTGTTCTTGCACTTAGGCGTAATAATGAAGCCGTG
ACCCATGCGGCAATTGATACAATTAACGCACTAATTCAACCGATGCATGA
AAATTATGATATCAGACAAGAACAACTAAATAAAGCCAGTATTATGTCAA
GTTCCAAATTTTTACAAAATCTTCTAGACATGTTCTCATTGCATGTGTTA
CGAGGCACCGGCGCTTTAGTTATCAGCGTTATGCTTGATTTTTTGACCTT
TACGATTTGCCCACCCTATTGTGAAACATCCGATGGGGAGTATTTTGACA
ATTTACTGAAATTGGTTTCAGAACGAGGTCGAGTAATGTTTAAATTATTT
CATCACCCTAGTCTAGCTATTGTTAAAGGAGCCAGTCTAATTATGCAAGC
ATTGATAGATGAAGCTGATCCTTCGGTTGGTGAGTCTATGCAAACATTGG
CTTTGGCCGAAGGAGCATTACCACAGCATTTACTTAATTCATGCTTTGCT
CGCAATAACGATCAAAGGAGCCTTGCATTTAGACAATTAAATAGACAACT
TTTGTCTCTTTGGGTAACAGGAAATGTATTAGCAAAAGAGTTATTAAAAA
GAGTGTTGCCTCCTGGGCTTATTTTGTATCTGAATAGTACCGAAGATCCG
CCTATATCAAATGTGGATTATTTGTTTGAAAGAGACAATATGGAATTAGC
TCAAACTCATATGCAAGAAATACAGCGGAAAAATAAGGAAGCCTGGCGTA
TTGTTGAGAAGAAAATTGATAATCTCCTTATGCACTGGCGATCAAAAATT
GGAATAAATATGAAGCCGATGAAAGATAAAGATGAGAAACCGGTTTGTTT
GAGGAAAAGAAGAAAGAGAATCAAAGTTTTGGATAATTGGAGGATGTTTT
TCTATCAATTTTATCAGGATCATGCTAAACCAAATCTGTTATGGAACATG
AAGACTCGCGAAGAATTTAGAGATGCTTTAGAAAAAGAAATTACCGATTT
TAAAAGAGAACGTGATTTTTGTGCTAATATAGAAATAAACGAAAAAACTA
CGGATCCTGATGCTGTTGATGAAAATTCTAGTGCGTCAAATGAGATAAAT
CTTGATTCAAATAAAAAGAAAATTCTTGATGATTTAATATCCCAAGCCGC
AAAGGTCTCGTGGAATTACGTTGAATTCAAAATTATCTATCGATGCCTGG
AAAATGAGATTAAAGTTGGTGATTATTATTTGCGGCTATTGTTAGAAGAA
GATGAACGTGTTTCACGTATTATCCGCGAAAAGGAATATATTGCGTCACT
GGAAAACCATTCTACCGTTGAAAATGGTCGTCACTTGAGTGATAGAACAA
GCTTGAATGATCAGAATATCGAAAGCCAAAATGGTGCTGAATCCGATACG
AAATCAGAAAATTCATTAAATAGCAAATTGGCTCCAAATGAAACAGAAGT
TGGAGCGGTTGGAGGTGTCATAAAAATTCGCCAAAGCTACGAATTTTTTC
ATGATCTTTATCGTCGATTCCTTCAATATCATAAGCCAGAGATGAAATGC
ATGTGCCTCTATGCCATGTCGATTGTTTACGGAAGGTGCCACCAGGAAAT
CGGACCTGTAAATGATTGTGAATTATTCATTAGTCTCCTAGAACGAACTA
CCAATCAGTTGGAGCGTGATCGTTTATTGCTATTACTCGAAAAACTTATT
ATTAACAAGAATAATATAGAACTTATAATTGATGCTAATGGTATACGGGT
TTTAGTGGACTTGATAACAATTGCGCATATGCATGTCAATCGTGCCCATA
TGCCTCAACAGTCAAACGTTATAGAAGCTGCCGGAGATGCCCAGAGCAAG
CAGGATGATCATTATAAAGAATGGTTTTATCAAGAAAAAAACAAAGAACA
AATTGGCCCTTTAAGCTTTAAAGAATTAATCAAATTACATGACGAAGGAA
CCATAAAACCTGATGTGAAAGTTTGGGCGCAGGGTTTAGATCAATGGCGT
TCATTTGCCAGTGTTCCACAGATCAGGTGGTCCAATTCAAAACTATACAC
TGGGCAGGCTGTTTTTACATTTTCTGAAGTCGCTTCTAAGGCTCTATCTA
TTCTTGTCGGTATTTGTCGAGCTTATCCTAGTAAAGATCAACTTGGTGGT
ATTATTAGACCAATGCCTCGTTGCAAAAAACAAATTACTCAGCCTGTTTT
ATTAACACATATTGTGCAGTTGCTTTTGACATTCGATCCATTTCTGGTGG
AGAAAATCGCTCTTCTTTTAAATATGGTTTTCGATGAAAATCCTTATCGG
TCGAGACTTTATATTACTGGTGTATTTTACTTTATCCTCATGTATGTTGG
TAGCAATGTATTGAGCATTGCTGAATTCCTCAAAATTACTCACATGTTTC
AAGCGTTTAGGAATGATGAGTCTAACAAAGAATCCAATATCGTTTCTCGT
TCGATTATGGGAAATATTTTACCCGAGGCAATGATTTGTTTCCTTGAAAA
CCATCCTTCAGAACAATTTGCTCAGATATATCTCGGAGATTATGACACTC
CAGAAACAATATGGAATAGTGAAATGAGACGATTCATGATAGAAAAGATC
GCTTGCCATTTAATGGAGTTTACTCCTAGGCTCCCATCAAATAATAGAGC
TACTTATCAGTATTTGGCAATTCCTATTATTAGTTATCCTCAACTAGAGA
ATGAGCTGTTTTGCGGAAGCTATTATTTGCGCCATTTGTGTGATACCGTC
AGATTTCCAGATTGGCCAATCAGATCACCAGTGTCCTTGCTTCGAGATAT
TTTACAAGCTTGGAAAAATGAAATTGAGAAAAAGCCACCGTCAATGTCAG
TTAAGGAAGCTTACGAAGTTTTGAAATTGAAATTTAATGAAAACCTTTCG
AGTGATCAAACCAGTAGAACTCAAGAGGAAAGTCTTATCAGAAAAGCTTA
CTTCCAATTATCCATGAAATATCATCCTGACAGAAATCCGGATGGCAGGG
AACAATTTGAGAAGATTAATACAGCTTATCAATTTTTGTGTAATCGTGCT
AAATTGTGGTCGGGACCCGATCCAAAAAATATTTATTTATTGTTGAAATC
ACAGAGTATTTTATTTCAGAGGTGTAGAAAAGAAATTGAGGTTCACAAGT
ATTCTGGCTATCCCATGCTAATAAAAACAATCCTAAGCGAAACAGAAGAT
GAACAACTTTTTCAAAAGGAAACTCCTTTATTGGGCGTTTGTGCTGAGTT
AGCTTATCACACAGTAAATGTCAGTGCTCTGAATGCTGAAGAATTGCGAA
GGCAAGATGGAATTCAGGCGTTACAAGCTGCTTTCAGTCGGTGTGTAACT
ATAATTACAGCAAGTAGTACTTCGTCGGATTTTTCTGTTCGTGTCTGTGG
ATATATCACCATTTTCTTTTCTGTTGCTGCCCAATTTGAGGCCTGTCGAC
AACGTATTCAAGAAATTCCCCAGATTGGCAGAGATTTAATTCGTTTATTA
TATTTCAAAAATCTACCACAATTATCTAGTTTAGTTTGTCGTTGCGTTGC
CGATCTGTCTTGTGATATCTGGCTTCAGACAAGCATGTTTGAAAACGGTG
CTATTTATCACTTACTTCCGTATGTTTTTCAGTTTGACTACACACTGGAA
GAAGGAGGTGTAGCACGTTCCGAAGAAAATCATAAACAAGAAATACTTAA
TAGATTAGCTTTATTAGCAATGCTTGCCATTACAAGACTTGCAGGATCAG
TTAATGAAGAAAATCAGCCCAATCATCTTCTTTCGCCAGAAAATAAACAT
GTCAGACAATGCTTGGTTGCTATGTTAACTCCTTATATTCAAAGAAAAAT
TGCAGAATTTAAAGGAGATCTAACCAGTATTAAAGTTATTCTAAAACTAC
TCACATCAAACTCTGAAACTCCATATTTATTTTGGGATAACCGAACCAGA
TCAGAATTGAAAAAATATCTAGAATCACAACAAGAGAGCTTAATTAAAAC
GAGCGAATGTGACCATCATTTTGGGGCAGAATTCAAATTTTCTCTCTATC
AAAAAGAACTGATTATCGGTGAAGTATTTATTCGGCTTTACAATGAACAA
AAGGGTTTCGTCCTCGAGAATCCAAGAAGTTTTACAATAGATTTATTGTT
ATTTCTCAAATCCGAAGTTGAGTACATGGACGCATCTGTCGGCACGAATC
AACTTACCAAACCAACATTATTGACATCTTCAAATGGTACTGTAACAGTT
AATAACGAAGTTCTTAAAAGGTCTCAAAAGATCCAATCAGCTCTTGCAGC
CTTAGTCAATGTTATCGTTACGAATCCAGAAATTAATATACAATTAATTG
GACATTTTAAAATGCTCTTTTCCCTTATGACTTACCGTCTTTTCCCCGCA
ATTCAAGAAGCAGCGGTTGAAGTAGTGAAGTCGGTTACATCCAGTGAAGA
ATGCCTCGAAGACATTGGTGCTTCTAATGTCCTTGTTCATCTGGTACGCC
TTCTGGAAAGTCTACAAAGCAATCCAATATTAATTCTCGACACGATTTCA
CGAGTCTGTTCGGTTACAAGTCTTCTAAAAGAACTCGTTTATAGAGGTTG
TCTTATTTACACATTGGGTGTACTCTGCTCTTCAAATAAATCAAATGTGA
AAATTGTTGCAGCTGGACTTCTGGGGAAAATGATGACCGACAAGTTAGTT
GGAAACAGGATTCGAGCAATTCTTCTTCAGTTTCTCCCATTAATATTTTT
GGACTCAATGAAAGATAACCCGGAAACATTTGTCCATCTTTATGACAATC
GACATGAAAATCCTGAACTCATTTGGAATGAAGATACTAGGAAATGTCTA
TCTACAGTTGTTTTTGAAAAAAAATCTGCGTATTTCGAAGAACAAGAAAA
AGATTTAAATAAGAAATGGAGTGTTCCTGATGATTTCCGTGTACCATATG
AATCTATTATTAACATCGGTCTCAGTGTAGGTGGGGTTTATCTTCATCTC
TATGTTTCAAGTCCTGGTTGGGCTCTCAGAAATCCCGATGAATTTTGCAA
TCAATTATTTTCCAAGTGGTTTGACATAATACAAAAATCATCAAATTCCA
CATCAGTCGCTCATGAACACCTTGAACTGACAACTGATGCGCTAGCTAAT
CTATTGAATTCCCATTCCGGTCTTCTTGATAGGCTACCCAAAAAGGGATA
TGTTCATAAAGTCTTTCAAATGCTCAATGATAATTCTACCAGTGAACCCA
TTTTGAAAGCCGGTCTTCTAATAGCCTATCAAATGTCCAACAGCAAACTA
TGTGTGGCAACAATGGCAACTATTGAAACTATACGCCCTTTGATGTTGGC
AATGAAAGTTAGACAAGATCAATTGGGTTTAGCTGGGGAAACTTTGTTCC
GTTTATTTCAATCGGGTACCGACGAATTGATTGCACAAGCCATAAAAATG
AAATTAGTCGAATATGTTCTTGGTTTGTTGGAAGCAGGTTTGGTAAATGT
GAAAGATCCTGGTCAAGTGAAAGCCTATTTTGTTAAAGCTCTGAAGGCAA
TGCAAAGGAGCCCTACATTTGGCGCACAGGTAACCACACTTCTAGAAAAT
AGTTCAATTTGGTCTCAATTTAAAGATCAAAGTCATGATCTCTATTTGAC
AAACACGCCCCAAGTTGCTGGCTATTTAACAGGGAGATCTGTCGAAACGG
CTGGCTATCTTACTTCTTTTGCTCAAAATACTCCAAATAAACCATTTTAA
ATTGACATTTGACTTACAATGAACTATTACTGACAACATATGTCCTTTAT
TATTATCCTTTGATGTTAATTGAAATTTGTTGACTTACTTCTATTTTTCA
TGTGTAAATGAGTATATTTATTTGTTATTTGACTTGAATTCAAATATTTT
CCGCAGCCACTGCTGCTACAATAGGAAAATGTATTATTGAAATAAATGAT
ATTTTTTATTGTTACAAAAAATTTTAATTTTTTGTTTAATATCAAGTAAA
TGTCGGCTGGCTATAGATGACC
back to top

protein sequence of SMED30004783-orf-1

>SMED30004783-orf-1 ID=SMED30004783-orf-1|Name=SMED30004783-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2380bp
MTMLNPCMNKNVDETCYCVTKHAWRGNYKRLITLGSLGITTYHSETLKVT
NQWPYSEICSIEPDSKNPKSNKFVLWLREAGDKKKKDMRFSSDFRVNILA
EAMDYSNLFQEKTRPRLKVNSNKFRWNEKCVPVILEVNSHCVSQIDPNTS
RVVSMYYYKDIEMLAKISDHNQGFVIACNGFSRLHIFYANNRDEFIRTVA
EEAFNKMAICLHEAKEAISMDYVLEHRMGKYSQDEHITSHAEFMVQKLAT
HRYGPDNPVQRILCLTETCLVERDPETYILITLRPLCDIFALIRDPQEPQ
RFIIEYVHGLNRTYLSTDRDSLLASLLDGARSSGNRDVCVKMKKTDRCLR
FGPLIVPMEEEVESQHMKMLQQTPGGMGFNEAVFRFNANVSYSGLLHAVT
QEGLFAENKEKLIKGALSALINREGNQEEISAQDLEAQFHALRRLVASKA
GFQAFTQLNKMRETLGRKVVLALRRNNEAVTHAAIDTINALIQPMHENYD
IRQEQLNKASIMSSSKFLQNLLDMFSLHVLRGTGALVISVMLDFLTFTIC
PPYCETSDGEYFDNLLKLVSERGRVMFKLFHHPSLAIVKGASLIMQALID
EADPSVGESMQTLALAEGALPQHLLNSCFARNNDQRSLAFRQLNRQLLSL
WVTGNVLAKELLKRVLPPGLILYLNSTEDPPISNVDYLFERDNMELAQTH
MQEIQRKNKEAWRIVEKKIDNLLMHWRSKIGINMKPMKDKDEKPVCLRKR
RKRIKVLDNWRMFFYQFYQDHAKPNLLWNMKTREEFRDALEKEITDFKRE
RDFCANIEINEKTTDPDAVDENSSASNEINLDSNKKKILDDLISQAAKVS
WNYVEFKIIYRCLENEIKVGDYYLRLLLEEDERVSRIIREKEYIASLENH
STVENGRHLSDRTSLNDQNIESQNGAESDTKSENSLNSKLAPNETEVGAV
GGVIKIRQSYEFFHDLYRRFLQYHKPEMKCMCLYAMSIVYGRCHQEIGPV
NDCELFISLLERTTNQLERDRLLLLLEKLIINKNNIELIIDANGIRVLVD
LITIAHMHVNRAHMPQQSNVIEAAGDAQSKQDDHYKEWFYQEKNKEQIGP
LSFKELIKLHDEGTIKPDVKVWAQGLDQWRSFASVPQIRWSNSKLYTGQA
VFTFSEVASKALSILVGICRAYPSKDQLGGIIRPMPRCKKQITQPVLLTH
IVQLLLTFDPFLVEKIALLLNMVFDENPYRSRLYITGVFYFILMYVGSNV
LSIAEFLKITHMFQAFRNDESNKESNIVSRSIMGNILPEAMICFLENHPS
EQFAQIYLGDYDTPETIWNSEMRRFMIEKIACHLMEFTPRLPSNNRATYQ
YLAIPIISYPQLENELFCGSYYLRHLCDTVRFPDWPIRSPVSLLRDILQA
WKNEIEKKPPSMSVKEAYEVLKLKFNENLSSDQTSRTQEESLIRKAYFQL
SMKYHPDRNPDGREQFEKINTAYQFLCNRAKLWSGPDPKNIYLLLKSQSI
LFQRCRKEIEVHKYSGYPMLIKTILSETEDEQLFQKETPLLGVCAELAYH
TVNVSALNAEELRRQDGIQALQAAFSRCVTIITASSTSSDFSVRVCGYIT
IFFSVAAQFEACRQRIQEIPQIGRDLIRLLYFKNLPQLSSLVCRCVADLS
CDIWLQTSMFENGAIYHLLPYVFQFDYTLEEGGVARSEENHKQEILNRLA
LLAMLAITRLAGSVNEENQPNHLLSPENKHVRQCLVAMLTPYIQRKIAEF
KGDLTSIKVILKLLTSNSETPYLFWDNRTRSELKKYLESQQESLIKTSEC
DHHFGAEFKFSLYQKELIIGEVFIRLYNEQKGFVLENPRSFTIDLLLFLK
SEVEYMDASVGTNQLTKPTLLTSSNGTVTVNNEVLKRSQKIQSALAALVN
VIVTNPEINIQLIGHFKMLFSLMTYRLFPAIQEAAVEVVKSVTSSEECLE
DIGASNVLVHLVRLLESLQSNPILILDTISRVCSVTSLLKELVYRGCLIY
TLGVLCSSNKSNVKIVAAGLLGKMMTDKLVGNRIRAILLQFLPLIFLDSM
KDNPETFVHLYDNRHENPELIWNEDTRKCLSTVVFEKKSAYFEEQEKDLN
KKWSVPDDFRVPYESIINIGLSVGGVYLHLYVSSPGWALRNPDEFCNQLF
SKWFDIIQKSSNSTSVAHEHLELTTDALANLLNSHSGLLDRLPKKGYVHK
VFQMLNDNSTSEPILKAGLLIAYQMSNSKLCVATMATIETIRPLMLAMKV
RQDQLGLAGETLFRLFQSGTDELIAQAIKMKLVEYVLGLLEAGLVNVKDP
GQVKAYFVKALKAMQRSPTFGAQVTTLLENSSIWSQFKDQSHDLYLTNTP
QVAGYLTGRSVETAGYLTSFAQNTPNKPF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0071203WASH complex
GO:0005765lysosomal membrane
GO:0005768endosome
GO:0005769early endosome
GO:0005829cytosol
GO:0005886plasma membrane
GO:0010008endosome membrane
GO:0016020membrane
GO:0030667secretory granule membrane
GO:0031901early endosome membrane
GO:0035577azurophil granule membrane
GO:0043231intracellular membrane-bounded organelle
GO:0070062extracellular exosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036869J_dom_sf
IPR001623DnaJ_domain
IPR011989ARM-like
IPR025640GYF_2
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0001649osteoblast differentiation
GO:0006810transport
GO:0007032endosome organization
GO:0015031protein transport
GO:0043312neutrophil degranulation
GO:1902954regulation of early endosome to recycling endosome transport
GO:2000641regulation of early endosome to late endosome transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001623DnaJ domainSMARTSM00271dnaj_3coord: 1413..1479
e-value: 4.9E-15
score: 66.0
IPR001623DnaJ domainPFAMPF00226DnaJcoord: 1416..1479
e-value: 2.8E-12
score: 46.6
IPR001623DnaJ domainPROSITEPS50076DNAJ_2coord: 1414..1494
score: 13.45
IPR001623DnaJ domainCDDcd06257DnaJcoord: 1414..1476
e-value: 7.22831E-13
score: 62.9481
IPR025640GYF domain 2PFAMPF14237GYF_2coord: 1086..1135
e-value: 1.2E-13
score: 50.6
IPR036869Chaperone J-domain superfamilyGENE3DG3DSA:1.10.287.110coord: 1408..1480
e-value: 1.4E-12
score: 49.2
IPR036869Chaperone J-domain superfamilySUPERFAMILYSSF46565Chaperone J-domaincoord: 1410..1479
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 903..936
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 910..936
NoneNo IPR availablePANTHERPTHR36983FAMILY NOT NAMEDcoord: 9..886
coord: 951..2374
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 968..2042