Polypeptide N-acetylgalactosaminyltransferase

Overview
NamePolypeptide N-acetylgalactosaminyltransferase
Smed IDSMED30004761
Length (bp)2312
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Polypeptide N-acetylgalactosaminyltransferase (SMED30004761) t-SNE clustered cells

Violin plots show distribution of expression levels for Polypeptide N-acetylgalactosaminyltransferase (SMED30004761) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004761

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30004761SMESG000076075.1 dd_Smed_v4_10587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004761SMESG000076075.1 dd_Smed_v4_10587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30004761SMESG000076075.1 dd_Smed_v4_10587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:4123])

HSP 1 Score: 430.639 bits (1106), Expect = 5.344e-142
Identity = 225/504 (44.64%), Postives = 316/504 (62.70%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDD-ETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKS 2252
             PGE G+P  I K++     + + K  ++ +QFNL AS+ I++ RS+PD R + CK   + +NLPTTS+VIVFHNEAWSTLLRT+HS+I+RSP H+++EIVLVDDAS  + LK  L  YVK LK+ V ++R E R GL++AR+ GA  + G+V+TFLDAH EC  GWLEP+L RI  + RTVVCPII+ I+D+TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI R YF E+GTYD GM IWG EN+E+S RIW CGG LEI+ CSHVGHVFR  +PY++     +I+  N RRL EVW+DE+K  +Y ++    + D G+I  R+ LR KL+C  F WYL+N++P    P     +G I +  +   CLD+   + +  V +F CH +GGNQ+F  +    +RT + C   +KL     +  C        W+YD  +  L +   N C+   T E+ +V +      S  Q+W L++
Sbjct:   57 GPGEMGKPVVIPKED-----QEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETN-QCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCNGSRSQQWLLRN 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:HGNC Symbol;Acc:HGNC:23242])

HSP 1 Score: 426.787 bits (1096), Expect = 2.059e-140
Identity = 223/509 (43.81%), Postives = 320/509 (62.87%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDDETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKSFVTFKL 2270
             PGE G+   I KD+     + + K  ++ +QFNL ASD I++ RS+PD R + CK   + + LP TS+VIVFHNEAWSTLLRT++S+I+RSP +LL E++LVDDAS  + LK  L +YVK L++ VKI+R E R GL++AR+ GA  + G+V+TFLDAH EC  GWLEP+L RI E+ +TVVCPII+ I+D+TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI R YF E+GTYD GM IWG EN+EMS RIW CGG LEI+ CSHVGHVFR  +PY++      ++  N RRL EVW+DE+K+ +Y ++    + D G++  R  LR  LKC  F WYL+N++P    P     +G I +  +   CLD+ G + +  V +F CH +GGNQ+F  +    +RT + C   ++L    ++  C        W+YD E+ L  +K       + +++  V+TC+    S  QKW L+++   ++
Sbjct:   56 GPGEMGKAVLIPKDD-----QEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIPRRYYSLGEIRNVETN-QCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDLCLDVSRLNGPVIMLKCHHMRGNQLWEYDAESCLSVNK-----VADGSQHPTVETCN---DSTLQKWLLRNYTRMEI 548          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT6 (polypeptide N-acetylgalactosaminyltransferase 6 [Source:HGNC Symbol;Acc:HGNC:4128])

HSP 1 Score: 426.787 bits (1096), Expect = 1.390e-139
Identity = 229/484 (47.31%), Postives = 306/484 (63.22%), Query Frame = 3
Query:  756 NDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSI-PDQRSKECKEMKFLENLP--TTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQ--NTISVGVFDWKMQFNWQFADTINIQRLTRES-PVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYY----SLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDP-LSSKFMGSIESFASKGNCLDSG--NENSRTVKLFPCHNLGGNQLF-LISQTGFLRTINK--CF--SQNKLLLNTCDKDPVESRWKYDDETNLIYDK 2153
             DPNAPG  G+ F+  K + T  E  E + G++KH FN +ASDRIS++RS+ PD R  EC + KF    P  TTS++IVFHNEAWSTLLRT++S++  +P  LLKEI+LVDDAST EHLK +L  YVK L++V++VR E R GL+ AR++GA     EVLTFLDAH EC+ GWLEP+L RIAE+   VV P I +I+ NTFE +   Q     S G FDW + F W+       QR   E+ P+KSP  AGGLFSI ++YF  +GTYD  M+IWG ENVEMS R+W CGG LEIIPCS VGHVFR++SP+++ +    ++  NQ RL EVW+D YK+++Y               G+I  R++LR +L CH+F WYL NV+P ++ P L+  F G+I++  +   CLD G  N   + + ++ CH LGGNQ F   +Q      I K  C   S+  L L +C      S+   D+E  L  D+
Sbjct:  108 QDPNAPGADGKAFQ--KSKWTPLETQEKEEGYKKHCFNAFASDRISLQRSLGPDTRPPECVDQKFRRCPPLATTSVIIVFHNEAWSTLLRTVYSVLHTTPAILLKEIILVDDASTEEHLKEKLEQYVKQLQVVRVVRQEERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTVVVSPDIVTIDLNTFEFAKPVQRGRVHSRGNFDWSLTFGWETLPPHEKQRRKDETYPIKSPTFAGGLFSISKSYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKGTS-VIARNQVRLAEVWMDSYKKIFYRRNLQAAKMAQEKSFGDISERLQLREQLHCHNFSWYLHNVYPEMFVPDLTPTFYGAIKNLGTN-QCLDVGENNRGGKPLIMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQ 587          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT6 (polypeptide N-acetylgalactosaminyltransferase 6 [Source:HGNC Symbol;Acc:HGNC:4128])

HSP 1 Score: 426.787 bits (1096), Expect = 1.390e-139
Identity = 229/484 (47.31%), Postives = 306/484 (63.22%), Query Frame = 3
Query:  756 NDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSI-PDQRSKECKEMKFLENLP--TTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQ--NTISVGVFDWKMQFNWQFADTINIQRLTRES-PVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYY----SLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDP-LSSKFMGSIESFASKGNCLDSG--NENSRTVKLFPCHNLGGNQLF-LISQTGFLRTINK--CF--SQNKLLLNTCDKDPVESRWKYDDETNLIYDK 2153
             DPNAPG  G+ F+  K + T  E  E + G++KH FN +ASDRIS++RS+ PD R  EC + KF    P  TTS++IVFHNEAWSTLLRT++S++  +P  LLKEI+LVDDAST EHLK +L  YVK L++V++VR E R GL+ AR++GA     EVLTFLDAH EC+ GWLEP+L RIAE+   VV P I +I+ NTFE +   Q     S G FDW + F W+       QR   E+ P+KSP  AGGLFSI ++YF  +GTYD  M+IWG ENVEMS R+W CGG LEIIPCS VGHVFR++SP+++ +    ++  NQ RL EVW+D YK+++Y               G+I  R++LR +L CH+F WYL NV+P ++ P L+  F G+I++  +   CLD G  N   + + ++ CH LGGNQ F   +Q      I K  C   S+  L L +C      S+   D+E  L  D+
Sbjct:  108 QDPNAPGADGKAFQ--KSKWTPLETQEKEEGYKKHCFNAFASDRISLQRSLGPDTRPPECVDQKFRRCPPLATTSVIIVFHNEAWSTLLRTVYSVLHTTPAILLKEIILVDDASTEEHLKEKLEQYVKQLQVVRVVRQEERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTVVVSPDIVTIDLNTFEFAKPVQRGRVHSRGNFDWSLTFGWETLPPHEKQRRKDETYPIKSPTFAGGLFSISKSYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKGTS-VIARNQVRLAEVWMDSYKKIFYRRNLQAAKMAQEKSFGDISERLQLREQLHCHNFSWYLHNVYPEMFVPDLTPTFYGAIKNLGTN-QCLDVGENNRGGKPLIMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQ 587          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:HGNC Symbol;Acc:HGNC:23242])

HSP 1 Score: 423.705 bits (1088), Expect = 2.810e-139
Identity = 223/505 (44.16%), Postives = 314/505 (62.18%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDDE-TNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKSF 2255
             PGE G+   I KD+     + + K  ++ +QFNL ASD I++ RS+PD R + CK   + + LP TS+VIVFHNEAWSTLLRT++S+I+RSP +LL E++LVDDAS  + LK  L +YVK L++ VKI+R E R GL++AR+ GA  + G+V+TFLDAH EC  GWLEP+L RI E+ +TVVCPII+ I+D+TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI R YF E+GTYD GM IWG EN+EMS RIW CGG LEI+ CSHVGHVFR  +PY++      ++  N RRL EVW+DE+K+ +Y ++    + D G++  R  LR  LKC  F WYL+N++P    P     +G I +  +   CLD+ G + +  V +F CH +GGNQ+F  +    +RT + C   ++L    ++  C        W+YD E   L +   N C+   + E+  V T      S  Q+W L++ 
Sbjct:   56 GPGEMGKAVLIPKDD-----QEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIPRRYYSLGEIRNVETN-QCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDLCLDVSRLNGPVIMLKCHHMRGNQLWEYDAERLTLRHVNSNQCLDEPSEEDKMVPTMQDCSGSRSQQWLLRNM 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 458.373 bits (1178), Expect = 2.691e-152
Identity = 233/521 (44.72%), Postives = 323/521 (62.00%), Query Frame = 3
Query:  714 FKIEENEFTIYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPL-KIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRE-SPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKG-NCLDSGNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKC--FSQNKLLLNTCDKDPVESRWKYDDETN-LIYDKQNNCVAINTN-ENVEVQTCSFEVPSIEQKWHLKSF 2255
            F ++ N+  IY +  D    GE G+   ++K +L+  EKA+Y  G   + FN YASD ISV R++P     ECK  K+ ENLP TS++I FHNEAWS LLRT+HS+++R+P HLL+E+VLVDD S  +H K  L +Y+      VKI+R E R GL++AR+ GA   +GEVLT+LD+H EC  GW+EP+L+RI  +  TVVCP+I+ I+DNTFE  +      SVG FDW +QFNW      + +  TR   PV+SP MAGGLFSI + YF +LGTYDPG  IWG EN+E+S +IWMCGG LEI+PCSHVGHVFR RSPY W   ++ +L  N  RL EVWLD+YK  YY    N+   D G+I  R KLR  L C SF+WYL N++P L+ P  S   G + +   K   C+D      +TV ++ CHN GGNQ +++S+ G +R    C  ++ + +++  C        W+Y+ +T  L +     C+ +  +   +E+  C ++ P   Q W  K +
Sbjct:   95 FMVDPND-PIYKK-GDAAQAGELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQFGGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVN-VLKRNSIRLAEVWLDDYKTYYYERINNQ-LGDFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESVAKGEMRNAGGKNRQCIDYKPSGGKTVGMYQCHNQGGNQYWMLSKDGEIRRDESCVDYAGSDVMVFPCHGMKGNQEWRYNHDTGRLQHAVSQKCLGMTKDGAKLEMVACQYDDPY--QHWKFKEY 609          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 458.373 bits (1178), Expect = 2.691e-152
Identity = 233/521 (44.72%), Postives = 323/521 (62.00%), Query Frame = 3
Query:  714 FKIEENEFTIYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPL-KIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRE-SPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKG-NCLDSGNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKC--FSQNKLLLNTCDKDPVESRWKYDDETN-LIYDKQNNCVAINTN-ENVEVQTCSFEVPSIEQKWHLKSF 2255
            F ++ N+  IY +  D    GE G+   ++K +L+  EKA+Y  G   + FN YASD ISV R++P     ECK  K+ ENLP TS++I FHNEAWS LLRT+HS+++R+P HLL+E+VLVDD S  +H K  L +Y+      VKI+R E R GL++AR+ GA   +GEVLT+LD+H EC  GW+EP+L+RI  +  TVVCP+I+ I+DNTFE  +      SVG FDW +QFNW      + +  TR   PV+SP MAGGLFSI + YF +LGTYDPG  IWG EN+E+S +IWMCGG LEI+PCSHVGHVFR RSPY W   ++ +L  N  RL EVWLD+YK  YY    N+   D G+I  R KLR  L C SF+WYL N++P L+ P  S   G + +   K   C+D      +TV ++ CHN GGNQ +++S+ G +R    C  ++ + +++  C        W+Y+ +T  L +     C+ +  +   +E+  C ++ P   Q W  K +
Sbjct:   95 FMVDPND-PIYKK-GDAAQAGELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQFGGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVN-VLKRNSIRLAEVWLDDYKTYYYERINNQ-LGDFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESVAKGEMRNAGGKNRQCIDYKPSGGKTVGMYQCHNQGGNQYWMLSKDGEIRRDESCVDYAGSDVMVFPCHGMKGNQEWRYNHDTGRLQHAVSQKCLGMTKDGAKLEMVACQYDDPY--QHWKFKEY 609          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 458.373 bits (1178), Expect = 2.691e-152
Identity = 233/521 (44.72%), Postives = 323/521 (62.00%), Query Frame = 3
Query:  714 FKIEENEFTIYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPL-KIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRE-SPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKG-NCLDSGNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKC--FSQNKLLLNTCDKDPVESRWKYDDETN-LIYDKQNNCVAINTN-ENVEVQTCSFEVPSIEQKWHLKSF 2255
            F ++ N+  IY +  D    GE G+   ++K +L+  EKA+Y  G   + FN YASD ISV R++P     ECK  K+ ENLP TS++I FHNEAWS LLRT+HS+++R+P HLL+E+VLVDD S  +H K  L +Y+      VKI+R E R GL++AR+ GA   +GEVLT+LD+H EC  GW+EP+L+RI  +  TVVCP+I+ I+DNTFE  +      SVG FDW +QFNW      + +  TR   PV+SP MAGGLFSI + YF +LGTYDPG  IWG EN+E+S +IWMCGG LEI+PCSHVGHVFR RSPY W   ++ +L  N  RL EVWLD+YK  YY    N+   D G+I  R KLR  L C SF+WYL N++P L+ P  S   G + +   K   C+D      +TV ++ CHN GGNQ +++S+ G +R    C  ++ + +++  C        W+Y+ +T  L +     C+ +  +   +E+  C ++ P   Q W  K +
Sbjct:   95 FMVDPND-PIYKK-GDAAQAGELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQFGGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVN-VLKRNSIRLAEVWLDDYKTYYYERINNQ-LGDFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESVAKGEMRNAGGKNRQCIDYKPSGGKTVGMYQCHNQGGNQYWMLSKDGEIRRDESCVDYAGSDVMVFPCHGMKGNQEWRYNHDTGRLQHAVSQKCLGMTKDGAKLEMVACQYDDPY--QHWKFKEY 609          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 454.521 bits (1168), Expect = 7.379e-151
Identity = 235/528 (44.51%), Postives = 326/528 (61.74%), Query Frame = 3
Query:  699 IKNSSFKIEENEFTIYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPL-KIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRE-SPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS--GNE-NSRTVKLFPCHNLGGNQLFLISQTGFLRTINKC--FSQNKLLLNTCDKDPVESRWKYDDETN-LIYDKQNNCVAINTN-ENVEVQTCSFEVPSIEQKWHLKSF 2255
            +    F ++ N+  IY +  D    GE G+   ++K +L+  EKA+Y  G   + FN YASD ISV R++P     ECK  K+ ENLP TS++I FHNEAWS LLRT+HS+++R+P HLL+E+VLVDD S  +H K  L +Y+      VKI+R E R GL++AR+ GA   +GEVLT+LD+H EC  GW+EP+L+RI  +  TVVCP+I+ I+DNTFE  +      SVG FDW +QFNW      + +  TR   PV+SP MAGGLFSI + YF +LGTYDPG  IWG EN+E+S +IWMCGG LEI+PCSHVGHVFR RSPY W   ++ +L  N  RL EVWLD+YK  YY    N+   D G+I  R KLR  L C SF+WYL N++P L+ P  S   G + + A    CLDS  G E  ++ +  +PCH  GGNQ +++S+ G +R    C  ++ + +++  C        W+Y+ +T  L +     C+ +  +   +E+  C ++ P   Q W  K +
Sbjct:   90 LAKPKFMVDPND-PIYKK-GDAAQAGELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQFGGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVN-VLKRNSIRLAEVWLDDYKTYYYERINNQ-LGDFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESVAKGELRN-AQTSQCLDSAVGEEVENKAITPYPCHEQGGNQYWMLSKDGEIRRDESCVDYAGSDVMVFPCHGMKGNQEWRYNHDTGRLQHAVSQKCLGMTKDGAKLEMVACQYDDPY--QHWKFKEY 610          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 454.521 bits (1168), Expect = 7.379e-151
Identity = 235/528 (44.51%), Postives = 326/528 (61.74%), Query Frame = 3
Query:  699 IKNSSFKIEENEFTIYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPL-KIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRE-SPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS--GNE-NSRTVKLFPCHNLGGNQLFLISQTGFLRTINKC--FSQNKLLLNTCDKDPVESRWKYDDETN-LIYDKQNNCVAINTN-ENVEVQTCSFEVPSIEQKWHLKSF 2255
            +    F ++ N+  IY +  D    GE G+   ++K +L+  EKA+Y  G   + FN YASD ISV R++P     ECK  K+ ENLP TS++I FHNEAWS LLRT+HS+++R+P HLL+E+VLVDD S  +H K  L +Y+      VKI+R E R GL++AR+ GA   +GEVLT+LD+H EC  GW+EP+L+RI  +  TVVCP+I+ I+DNTFE  +      SVG FDW +QFNW      + +  TR   PV+SP MAGGLFSI + YF +LGTYDPG  IWG EN+E+S +IWMCGG LEI+PCSHVGHVFR RSPY W   ++ +L  N  RL EVWLD+YK  YY    N+   D G+I  R KLR  L C SF+WYL N++P L+ P  S   G + + A    CLDS  G E  ++ +  +PCH  GGNQ +++S+ G +R    C  ++ + +++  C        W+Y+ +T  L +     C+ +  +   +E+  C ++ P   Q W  K +
Sbjct:   90 LAKPKFMVDPND-PIYKK-GDAAQAGELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQFGGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVN-VLKRNSIRLAEVWLDDYKTYYYERINNQ-LGDFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESVAKGELRN-AQTSQCLDSAVGEEVENKAITPYPCHEQGGNQYWMLSKDGEIRRDESCVDYAGSDVMVFPCHGMKGNQEWRYNHDTGRLQHAVSQKCLGMTKDGAKLEMVACQYDDPY--QHWKFKEY 610          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant9 (gene:FBgn0050463 transcript:FBtr0087112)

HSP 1 Score: 459.144 bits (1180), Expect = 3.881e-152
Identity = 232/526 (44.11%), Postives = 321/526 (61.03%), Query Frame = 3
Query:  723 EENEFTIYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECK-EMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRES-PVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKG-NCLDS---GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKC--FSQNKLLLNTCDKDPVESRWKYDDET-NLIYDKQNNCVAIN-TNENVEVQTCSFEVPSIEQKWHLKSFVTFKL 2270
            E+++  I P  N    PGE G+P R+ K E+++  K     GW K+ FN Y SD ISV R++PD R   CK E ++L NLP T ++I FHNEAW+ LLRT+HS++DRSP HL+ +I+LVDD S   HLK +L DY      V+I+R + R GL++ARI+GA      VLT+LD+H EC  GWLEP+L+RIA N+ TVVCP+I+ I+D T E        ++VG FDW +QF+W        +R    + PV SP MAGGLFSI R +F  LGTYD G  IWG EN+E+S + WMCGG LEI+PCSHVGH+FR RSPY W   ++ +L  N  RL EVW+DEY + YY   GN D+ D G++  R KLR  LKC SF+WYL N++P L+ P  S   G I +    G  CLD+        + V  +PCH  GGNQ +++S+ G +R  + C  ++   + L  C        W Y + T  L +     C+AI+ + + + ++ CS  +    Q+W L+++ + KL
Sbjct:  130 EDSKKVIDPPANFEENPGELGKPVRLPK-EMSDEMKKAVDDGWTKNAFNQYVSDLISVHRTLPDPRDAWCKDEARYLTNLPKTDVIICFHNEAWTVLLRTVHSVLDRSPEHLIGKIILVDDYSDMPHLKRQLEDYFAAYPKVQIIRGQKREGLIRARILGANHAKSPVLTYLDSHCECTEGWLEPLLDRIARNSTTVVCPVIDVISDETLEYHYRDSGGVNVGGFDWNLQFSWHPVPERERKRHNSTAEPVYSPTMAGGLFSIDREFFDRLGTYDSGFDIWGGENLELSFKTWMCGGTLEIVPCSHVGHIFRKRSPYKWRSGVN-VLKKNSVRLAEVWMDEYSQYYYHRIGN-DKGDWGDVSDRRKLRNDLKCKSFKWYLDNIYPELFIPGDSVAHGEIRNLGYGGRTCLDAPAGKKHQKKAVGTYPCHRQGGNQYWMLSKAGEIRRDDSCLDYAGKDVTLFGCHGGKGNQFWTYRENTKQLHHGTSGKCLAISESKDKLLMEECSASLS--RQQWTLENYDSSKL 650          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant9 (gene:FBgn0050463 transcript:FBtr0113380)

HSP 1 Score: 459.144 bits (1180), Expect = 3.881e-152
Identity = 232/526 (44.11%), Postives = 321/526 (61.03%), Query Frame = 3
Query:  723 EENEFTIYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECK-EMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRES-PVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKG-NCLDS---GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKC--FSQNKLLLNTCDKDPVESRWKYDDET-NLIYDKQNNCVAIN-TNENVEVQTCSFEVPSIEQKWHLKSFVTFKL 2270
            E+++  I P  N    PGE G+P R+ K E+++  K     GW K+ FN Y SD ISV R++PD R   CK E ++L NLP T ++I FHNEAW+ LLRT+HS++DRSP HL+ +I+LVDD S   HLK +L DY      V+I+R + R GL++ARI+GA      VLT+LD+H EC  GWLEP+L+RIA N+ TVVCP+I+ I+D T E        ++VG FDW +QF+W        +R    + PV SP MAGGLFSI R +F  LGTYD G  IWG EN+E+S + WMCGG LEI+PCSHVGH+FR RSPY W   ++ +L  N  RL EVW+DEY + YY   GN D+ D G++  R KLR  LKC SF+WYL N++P L+ P  S   G I +    G  CLD+        + V  +PCH  GGNQ +++S+ G +R  + C  ++   + L  C        W Y + T  L +     C+AI+ + + + ++ CS  +    Q+W L+++ + KL
Sbjct:  130 EDSKKVIDPPANFEENPGELGKPVRLPK-EMSDEMKKAVDDGWTKNAFNQYVSDLISVHRTLPDPRDAWCKDEARYLTNLPKTDVIICFHNEAWTVLLRTVHSVLDRSPEHLIGKIILVDDYSDMPHLKRQLEDYFAAYPKVQIIRGQKREGLIRARILGANHAKSPVLTYLDSHCECTEGWLEPLLDRIARNSTTVVCPVIDVISDETLEYHYRDSGGVNVGGFDWNLQFSWHPVPERERKRHNSTAEPVYSPTMAGGLFSIDREFFDRLGTYDSGFDIWGGENLELSFKTWMCGGTLEIVPCSHVGHIFRKRSPYKWRSGVN-VLKKNSVRLAEVWMDEYSQYYYHRIGN-DKGDWGDVSDRRKLRNDLKCKSFKWYLDNIYPELFIPGDSVAHGEIRNLGYGGRTCLDAPAGKKHQKKAVGTYPCHRQGGNQYWMLSKAGEIRRDDSCLDYAGKDVTLFGCHGGKGNQFWTYRENTKQLHHGTSGKCLAISESKDKLLMEECSASLS--RQQWTLENYDSSKL 650          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant9 (gene:FBgn0050463 transcript:FBtr0087113)

HSP 1 Score: 456.833 bits (1174), Expect = 2.909e-151
Identity = 232/524 (44.27%), Postives = 323/524 (61.64%), Query Frame = 3
Query:  723 EENEFTIYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECK-EMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRL-TRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS--GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKC--FSQNKLLLNTCDKDPVESRWKYDDET-NLIYDKQNNCVAIN-TNENVEVQTCSFEVPSIEQKWHLKSFVTFKL 2270
            E+++  I P  N    PGE G+P R+ K E+++  K     GW K+ FN Y SD ISV R++PD R   CK E ++L NLP T ++I FHNEAW+ LLRT+HS++DRSP HL+ +I+LVDD S   HLK +L DY      V+I+R + R GL++ARI+GA      VLT+LD+H EC  GWLEP+L+RIA N+ TVVCP+I+ I+D T E        ++VG FDW +QF+W        +R  +   PV SP MAGGLFSI R +F  LGTYD G  IWG EN+E+S + WMCGG LEI+PCSHVGH+FR RSPY W   ++ +L  N  RL EVW+DEY + YY   GN D+ D G++  R KLR  LKC SF+WYL N++P L+ P  S   G I +  + G CLD+   +E    V ++ CH  GGNQ +++S+ G +R  + C  ++   + L  C        W Y + T  L +     C+AI+ + + + ++ CS  +    Q+W L+++ + KL
Sbjct:  130 EDSKKVIDPPANFEENPGELGKPVRLPK-EMSDEMKKAVDDGWTKNAFNQYVSDLISVHRTLPDPRDAWCKDEARYLTNLPKTDVIICFHNEAWTVLLRTVHSVLDRSPEHLIGKIILVDDYSDMPHLKRQLEDYFAAYPKVQIIRGQKREGLIRARILGANHAKSPVLTYLDSHCECTEGWLEPLLDRIARNSTTVVCPVIDVISDETLEYHYRDSGGVNVGGFDWNLQFSWHPVPERERKRHNSTAEPVYSPTMAGGLFSIDREFFDRLGTYDSGFDIWGGENLELSFKTWMCGGTLEIVPCSHVGHIFRKRSPYKWRSGVN-VLKKNSVRLAEVWMDEYSQYYYHRIGN-DKGDWGDVSDRRKLRNDLKCKSFKWYLDNIYPELFIPGDSVAHGEIANVPN-GMCLDAKEKSEEETPVSIYECHGQGGNQYWMLSKAGEIRRDDSCLDYAGKDVTLFGCHGGKGNQFWTYRENTKQLHHGTSGKCLAISESKDKLLMEECSASLS--RQQWTLENYDSSKL 647          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant9 (gene:FBgn0050463 transcript:FBtr0113379)

HSP 1 Score: 456.833 bits (1174), Expect = 2.909e-151
Identity = 232/524 (44.27%), Postives = 323/524 (61.64%), Query Frame = 3
Query:  723 EENEFTIYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECK-EMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRL-TRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS--GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKC--FSQNKLLLNTCDKDPVESRWKYDDET-NLIYDKQNNCVAIN-TNENVEVQTCSFEVPSIEQKWHLKSFVTFKL 2270
            E+++  I P  N    PGE G+P R+ K E+++  K     GW K+ FN Y SD ISV R++PD R   CK E ++L NLP T ++I FHNEAW+ LLRT+HS++DRSP HL+ +I+LVDD S   HLK +L DY      V+I+R + R GL++ARI+GA      VLT+LD+H EC  GWLEP+L+RIA N+ TVVCP+I+ I+D T E        ++VG FDW +QF+W        +R  +   PV SP MAGGLFSI R +F  LGTYD G  IWG EN+E+S + WMCGG LEI+PCSHVGH+FR RSPY W   ++ +L  N  RL EVW+DEY + YY   GN D+ D G++  R KLR  LKC SF+WYL N++P L+ P  S   G I +  + G CLD+   +E    V ++ CH  GGNQ +++S+ G +R  + C  ++   + L  C        W Y + T  L +     C+AI+ + + + ++ CS  +    Q+W L+++ + KL
Sbjct:  130 EDSKKVIDPPANFEENPGELGKPVRLPK-EMSDEMKKAVDDGWTKNAFNQYVSDLISVHRTLPDPRDAWCKDEARYLTNLPKTDVIICFHNEAWTVLLRTVHSVLDRSPEHLIGKIILVDDYSDMPHLKRQLEDYFAAYPKVQIIRGQKREGLIRARILGANHAKSPVLTYLDSHCECTEGWLEPLLDRIARNSTTVVCPVIDVISDETLEYHYRDSGGVNVGGFDWNLQFSWHPVPERERKRHNSTAEPVYSPTMAGGLFSIDREFFDRLGTYDSGFDIWGGENLELSFKTWMCGGTLEIVPCSHVGHIFRKRSPYKWRSGVN-VLKKNSVRLAEVWMDEYSQYYYHRIGN-DKGDWGDVSDRRKLRNDLKCKSFKWYLDNIYPELFIPGDSVAHGEIANVPN-GMCLDAKEKSEEETPVSIYECHGQGGNQYWMLSKAGEIRRDDSCLDYAGKDVTLFGCHGGKGNQFWTYRENTKQLHHGTSGKCLAISESKDKLLMEECSASLS--RQQWTLENYDSSKL 647          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant5 (gene:FBgn0031681 transcript:FBtr0079026)

HSP 1 Score: 436.802 bits (1122), Expect = 9.847e-144
Identity = 230/506 (45.45%), Postives = 318/506 (62.85%), Query Frame = 3
Query:  771 PGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIV-RSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCF----SQNKLLLNTCDKDPVESRWKYDDETNLI-YDKQNNCVAINTNENVE---VQTCSFEVPSIEQKWHLKS 2252
            PGE G+P +I  D + +  K ++K    ++QFNL ASD IS+ RS+ D R + C+   +   LPTTSIVIVFHNEAW+TLLRT+ S+I+RSP  LLKEI+LVDDAS  + L  +L +YV  L +   V R+E R GL++AR++GAE  SGEV+TFLDAH EC  GWLEP+L RI +N RTVVCPII+ I+D TFE      +T   G F+WK+ F W    +  + R    R +P+++P MAGGLFSI + YFYE+G+YD GM IWG EN+EMS RIW CGGILEIIPCSHVGHVFR +SPY++   + KI+  N  R+ EVWLDE+++ YYS++    +   G++  R  LR +LKC SF+WYL+NV+P    PL   ++G I + A    CLD+ G + +  V +  CH LGGNQ+F  ++   + + + C     S   + +  C        W YD E   I +     C+   T ++     ++ CS+      Q+W ++S
Sbjct:  129 PGEMGKPVKIPAD-MKDLMKEKFK----ENQFNLLASDMISLNRSLTDVRHEGCRRKHYASKLPTTSIVIVFHNEAWTTLLRTVWSVINRSPRALLKEIILVDDASERDFLGKQLEEYVAKLPVKTFVLRTEKRSGLIRARLLGAEHVSGEVITFLDAHCECTEGWLEPLLARIVQNRRTVVCPIIDVISDETFEYITASDSTW--GGFNWKLNFRWYRVPSREMARRNNDRTAPLRTPTMAGGLFSIDKDYFYEIGSYDEGMDIWGGENLEMSFRIWQCGGILEIIPCSHVGHVFRDKSPYTFPGGVAKIVLHNAARVAEVWLDEWRDFYYSMSTGARKASAGDVSDRKALRDRLKCKSFRWYLENVYPESLMPLDYYYLGEIRN-AETETCLDTMGRKYNEKVGISYCHGLGGNQVFAYTKRQQIMSDDLCLDASSSNGPVNMVRCHNMGGNQEWVYDAEEKWIRHTNTGQCLQRATRDDANTPLLRPCSY---GKGQQWLMES 623          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt1 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2360])

HSP 1 Score: 432.18 bits (1110), Expect = 9.473e-143
Identity = 221/505 (43.76%), Postives = 322/505 (63.76%), Query Frame = 3
Query:  765 NAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDD-ETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKS 2252
            + PGE G+P  I KD+     + + K  ++ +QFNL AS+ I++ RS+PD R + CK   + ++LP TS+VIVFHNEAW+TLLRT+HS+IDRSP HLL+EIVLVDDAS  + LK +L  YV+ L++ V++VR E R GL++AR+ GA  ++G+V+TFLDAH EC  GWLEP+L RI  + +TVVCPII+ I+D+TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI R YF E+GTYD GM IWG EN+E+S RIW CGG LEI+ CSHVGHVFR  +PY++     +I+  N RRL EVW+DE+K  +Y ++    + D G+I  R  LR++L+C  F WYL+NV+P    P     +G I +  +   CLD+   + +  V +F CH +GGNQ+F  +    +RT + C   +KL    ++  C        W+YD  + +L++   N C+   + ++ +V +      +  Q+W L++
Sbjct:   54 DGPGEMGKPVVIAKDQ-----QEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVIDRSPRHLLEEIVLVDDASERDFLKRQLEHYVRKLEVPVRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTTGWLEPLLSRIKLDKKTVVCPIIDVISDDTFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQRLQCKPFSWYLENVYPDSQIPRHYYSLGEIRNVETN-QCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVMMLKCHHLKGNQLWEYDPVKLSLVHVNSNQCLDKASEDDSQVPSVRDCSGARSQQWLLRN 550          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt1 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2360])

HSP 1 Score: 432.18 bits (1110), Expect = 9.473e-143
Identity = 221/505 (43.76%), Postives = 322/505 (63.76%), Query Frame = 3
Query:  765 NAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDD-ETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKS 2252
            + PGE G+P  I KD+     + + K  ++ +QFNL AS+ I++ RS+PD R + CK   + ++LP TS+VIVFHNEAW+TLLRT+HS+IDRSP HLL+EIVLVDDAS  + LK +L  YV+ L++ V++VR E R GL++AR+ GA  ++G+V+TFLDAH EC  GWLEP+L RI  + +TVVCPII+ I+D+TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI R YF E+GTYD GM IWG EN+E+S RIW CGG LEI+ CSHVGHVFR  +PY++     +I+  N RRL EVW+DE+K  +Y ++    + D G+I  R  LR++L+C  F WYL+NV+P    P     +G I +  +   CLD+   + +  V +F CH +GGNQ+F  +    +RT + C   +KL    ++  C        W+YD  + +L++   N C+   + ++ +V +      +  Q+W L++
Sbjct:   54 DGPGEMGKPVVIAKDQ-----QEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVIDRSPRHLLEEIVLVDDASERDFLKRQLEHYVRKLEVPVRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTTGWLEPLLSRIKLDKKTVVCPIIDVISDDTFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQRLQCKPFSWYLENVYPDSQIPRHYYSLGEIRNVETN-QCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVMMLKCHHLKGNQLWEYDPVKLSLVHVNSNQCLDKASEDDSQVPSVRDCSGARSQQWLLRN 550          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt13 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 [Source:ZFIN;Acc:ZDB-GENE-091204-444])

HSP 1 Score: 431.409 bits (1108), Expect = 1.554e-142
Identity = 227/505 (44.95%), Postives = 313/505 (61.98%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDDE-TNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKSF 2255
            APGE G+   I K+E     + + K  ++ +QFNL ASD I++ RS+PD R   CK   + ++LP TSIVIVFHNEAWSTLLRT+HS I+RSP  LL EI+LVDDAS  + LK +L DYV  L++ V+I+R E R GL++AR+ GA  T G+V+TFLDAH EC  GWLEP++ RI E+ R VVCPII+ I+D TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI RTYF E+GTYD GM IWG EN+EMS RIW CGG LEI+ CSHVGHVFR  +PYS+     +++  N RRL EVW+DE+K+ +Y ++    R D G++  R  LR  LKC  F WYL+NV+P    P     +G I +  +   C+D+ G + +  V  F CH +GGNQ+F  +    +RT + C   ++L    ++  C        ++YD E   L++   N C+ + + E+  V T         Q+W L++ 
Sbjct:   56 APGEMGKAVVIPKEE-----QDKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKTYPDDLPNTSIVIVFHNEAWSTLLRTVHSAINRSPRQLLYEILLVDDASERDFLKEKLEDYVATLEVPVRILRMEQRTGLIRARLRGAAATRGQVITFLDAHCECTTGWLEPLMARIKEDRRAVVCPIIDVISDETFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRTYFEEIGTYDSGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSSRKALRESLKCKPFSWYLENVYPDSQIPRRYYSLGEIRNVETN-QCVDNMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTDDLCLDASRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLKDCSGRRSQQWILRNM 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt13 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 [Source:ZFIN;Acc:ZDB-GENE-091204-444])

HSP 1 Score: 424.091 bits (1089), Expect = 1.935e-140
Identity = 214/440 (48.64%), Postives = 287/440 (65.23%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL 2075
            APGE G+   I K+E     + + K  ++ +QFNL ASD I++ RS+PD R   CK   + ++LP TSIVIVFHNEAWSTLLRT+HS I+RSP  LL EI+LVDDAS  + LK +L DYV  L++ V+I+R E R GL++AR+ GA  T G+V+TFLDAH EC  GWLEP++ RI E+ R VVCPII+ I+D TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI RTYF E+GTYD GM IWG EN+EMS RIW CGG LEI+ CSHVGHVFR  +PYS+     +++  N RRL EVW+DE+K+ +Y ++    R D G++  R  LR  LKC  F WYL+NV+P    P     +G I +  +   C+D+ G + +  V  F CH +GGNQ+F  +    +RT + C   ++L
Sbjct:   56 APGEMGKAVVIPKEE-----QDKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKTYPDDLPNTSIVIVFHNEAWSTLLRTVHSAINRSPRQLLYEILLVDDASERDFLKEKLEDYVATLEVPVRILRMEQRTGLIRARLRGAAATRGQVITFLDAHCECTTGWLEPLMARIKEDRRAVVCPIIDVISDETFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRTYFEEIGTYDSGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSSRKALRESLKCKPFSWYLENVYPDSQIPRRYYSLGEIRNVETN-QCVDNMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTDDLCLDASRL 487          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: GALNT3 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GalNAc-T3) [Source:NCBI gene;Acc:100331984])

HSP 1 Score: 427.172 bits (1097), Expect = 6.241e-140
Identity = 216/434 (49.77%), Postives = 292/434 (67.28%), Query Frame = 3
Query:  756 NDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSI-PDQRSKECKEMKF--LENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFE---ASNLGQNTISVGVFDWKMQFNWQ-FADTINIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDR----YDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDP-LSSKFMGSIESFASKGNCLDSG--NENSRTVKLFPCHNLGGNQLF 2015
             +P+APG  G+ F  + D L+ SE+ E + G EKH FNLYASDRIS+ R + PD R  EC E  F     LPTTS++IVFHNEAWSTLLRT++S++  SP   LKEI+LVDDAS  EHLK +L++++K L IV++VR   R GL+ AR++GA   +G+ LTFLDAH EC+ GWLEP+L RIAEN+  VV P I +I+ NTFE    S  GQ+  + G FDW + F W+   D    +R     P+K+P  AGGLFSI R YFY +G+YD  M+IWG EN+EMS R+W CGG LEIIPCS VGHVFR++SP+++ +   +++  NQ RL EVW+D+YKE++Y       +    +  G++  R+ LR +L+C SF WYLKNV+P ++ P L+    G+I +   K  CLD G  NE  + + ++PCH +GGNQ F
Sbjct:  110 QNPSAPGASGKAF--HTDNLSSSEQKEKERGEEKHCFNLYASDRISLSRDLGPDTRPPECIEQTFRRCPPLPTTSVIIVFHNEAWSTLLRTVYSVLHTSPALFLKEIILVDDASVDEHLKDKLDEFLKQLHIVRVVRQHERKGLITARLLGASVATGDTLTFLDAHCECFHGWLEPLLARIAENSSAVVSPDITTIDLNTFEFMKPSPYGQHH-NRGNFDWGLSFGWETLPDHERRRRKDETYPIKTPTFAGGLFSISRDYFYHIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKGT-QVIARNQVRLAEVWMDDYKEIFYRRNQQAAQIAKEHSFGDVSRRVDLRERLQCKSFSWYLKNVYPEVFMPDLNPLQFGAIRNMG-KEACLDVGESNEGGKPLIMYPCHGMGGNQYF 538          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 435.647 bits (1119), Expect = 6.225e-144
Identity = 228/510 (44.71%), Postives = 323/510 (63.33%), Query Frame = 3
Query:  753 LNDPN-APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADT--INIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDD-ETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKS 2252
            LN P+  PGE G+P  I K+E     + + K  ++ +QFNL AS+ I++ RS+PD R + CK   + ++LPTTS+VIVFHNEAW+TLLRT+HS+I+RSP HLL+EI+LVDDAS  E LK  L  YVK L + V ++R E R GL++AR+ GA  + G+V+TFLDAH EC  GWLEP+L RI  + RTVVCPII+ I+D+TFE   +  + ++ G F+WK+ F W       ++ +R  R  PV++P MAGGLFSI R YF E+GTYD GM IWG EN+E+S RIW CGG LEI+ CSHVGHVFR  +PY++     +I+  N RRL EVW+DE+K  +Y ++    + D G+I  R+ LR KL+C  F WYL+NV+P    P     +G I +  +   CLD+   + +  V +F CH +GGNQ+F  + +  +RT + C   +KL    ++  C        W+YD  +  L++   N C+     E+ +V +      S  Q+W L++
Sbjct:   53 LNKPHEGPGEMGKPVVIPKEE-----QEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKLTVPVHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIPRHYYSLGEIRNVETN-QCLDNMARKENEKVGIFNCHGMGGNQVFSYTASKEIRTDDLCLDVSKLNGPVIMLKCHHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDCSGSRSQQWLLRN 554          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 433.721 bits (1114), Expect = 3.133e-143
Identity = 225/504 (44.64%), Postives = 319/504 (63.29%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADT--INIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDD-ETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKS 2252
             PGE G+P  I K+E     + + K  ++ +QFNL AS+ I++ RS+PD R + CK   + ++LPTTS+VIVFHNEAW+TLLRT+HS+I+RSP HLL+EI+LVDDAS  E LK  L  YVK L + V ++R E R GL++AR+ GA  + G+V+TFLDAH EC  GWLEP+L RI  + RTVVCPII+ I+D+TFE   +  + ++ G F+WK+ F W       ++ +R  R  PV++P MAGGLFSI R YF E+GTYD GM IWG EN+E+S RIW CGG LEI+ CSHVGHVFR  +PY++     +I+  N RRL EVW+DE+K  +Y ++    + D G+I  R+ LR KL+C  F WYL+NV+P    P     +G I +  +   CLD+   + +  V +F CH +GGNQ+F  + +  +RT + C   +KL    ++  C        W+YD  +  L++   N C+     E+ +V +      S  Q+W L++
Sbjct:   52 GPGEMGKPVVIPKEE-----QEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKLTVPVHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIPRHYYSLGEIRNVETN-QCLDNMARKENEKVGIFNCHGMGGNQVFSYTASKEIRTDDLCLDVSKLNGPVIMLKCHHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDCSGSRSQQWLLRN 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 433.721 bits (1114), Expect = 3.195e-143
Identity = 225/504 (44.64%), Postives = 319/504 (63.29%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADT--INIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDD-ETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKS 2252
             PGE G+P  I K+E     + + K  ++ +QFNL AS+ I++ RS+PD R + CK   + ++LPTTS+VIVFHNEAW+TLLRT+HS+I+RSP HLL+EI+LVDDAS  E LK  L  YVK L + V ++R E R GL++AR+ GA  + G+V+TFLDAH EC  GWLEP+L RI  + RTVVCPII+ I+D+TFE   +  + ++ G F+WK+ F W       ++ +R  R  PV++P MAGGLFSI R YF E+GTYD GM IWG EN+E+S RIW CGG LEI+ CSHVGHVFR  +PY++     +I+  N RRL EVW+DE+K  +Y ++    + D G+I  R+ LR KL+C  F WYL+NV+P    P     +G I +  +   CLD+   + +  V +F CH +GGNQ+F  + +  +RT + C   +KL    ++  C        W+YD  +  L++   N C+     E+ +V +      S  Q+W L++
Sbjct:   56 GPGEMGKPVVIPKEE-----QEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKLTVPVHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIPRHYYSLGEIRNVETN-QCLDNMARKENEKVGIFNCHGMGGNQVFSYTASKEIRTDDLCLDVSKLNGPVIMLKCHHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDCSGSRSQQWLLRN 551          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 433.721 bits (1114), Expect = 3.366e-143
Identity = 225/504 (44.64%), Postives = 319/504 (63.29%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADT--INIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDD-ETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKS 2252
             PGE G+P  I K+E     + + K  ++ +QFNL AS+ I++ RS+PD R + CK   + ++LPTTS+VIVFHNEAW+TLLRT+HS+I+RSP HLL+EI+LVDDAS  E LK  L  YVK L + V ++R E R GL++AR+ GA  + G+V+TFLDAH EC  GWLEP+L RI  + RTVVCPII+ I+D+TFE   +  + ++ G F+WK+ F W       ++ +R  R  PV++P MAGGLFSI R YF E+GTYD GM IWG EN+E+S RIW CGG LEI+ CSHVGHVFR  +PY++     +I+  N RRL EVW+DE+K  +Y ++    + D G+I  R+ LR KL+C  F WYL+NV+P    P     +G I +  +   CLD+   + +  V +F CH +GGNQ+F  + +  +RT + C   +KL    ++  C        W+YD  +  L++   N C+     E+ +V +      S  Q+W L++
Sbjct:   59 GPGEMGKPVVIPKEE-----QEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKLTVPVHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIPRHYYSLGEIRNVETN-QCLDNMARKENEKVGIFNCHGMGGNQVFSYTASKEIRTDDLCLDVSKLNGPVIMLKCHHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDCSGSRSQQWLLRN 554          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 433.335 bits (1113), Expect = 3.834e-143
Identity = 225/504 (44.64%), Postives = 319/504 (63.29%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADT--INIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDD-ETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKS 2252
             PGE G+P  I K+E     + + K  ++ +QFNL AS+ I++ RS+PD R + CK   + ++LPTTS+VIVFHNEAW+TLLRT+HS+I+RSP HLL+EI+LVDDAS  E LK  L  YVK L + V ++R E R GL++AR+ GA  + G+V+TFLDAH EC  GWLEP+L RI  + RTVVCPII+ I+D+TFE   +  + ++ G F+WK+ F W       ++ +R  R  PV++P MAGGLFSI R YF E+GTYD GM IWG EN+E+S RIW CGG LEI+ CSHVGHVFR  +PY++     +I+  N RRL EVW+DE+K  +Y ++    + D G+I  R+ LR KL+C  F WYL+NV+P    P     +G I +  +   CLD+   + +  V +F CH +GGNQ+F  + +  +RT + C   +KL    ++  C        W+YD  +  L++   N C+     E+ +V +      S  Q+W L++
Sbjct:   57 GPGEMGKPVVIPKEE-----QEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKLTVPVHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIPRHYYSLGEIRNVETN-QCLDNMARKENEKVGIFNCHGMGGNQVFSYTASKEIRTDDLCLDVSKLNGPVIMLKCHHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDCSGSRSQQWLLRN 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:MGI Symbol;Acc:MGI:894693])

HSP 1 Score: 435.261 bits (1118), Expect = 5.727e-144
Identity = 226/504 (44.84%), Postives = 317/504 (62.90%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDD-ETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKS 2252
             PGE G+P  I K++     + + K  ++ +QFNL AS+ I++ RS+PD R + CK   + +NLPTTS+VIVFHNEAWSTLLRT+HS+I+RSP H+++EIVLVDDAS  + LK  L  YVK LK+ V ++R E R GL++AR+ GA  + G+V+TFLDAH EC  GWLEP+L RI  + RTVVCPII+ I+D+TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI R YF E+GTYD GM IWG EN+E+S RIW CGG LEI+ CSHVGHVFR  +PY++     +I+  N RRL EVW+DE+K  +Y ++    + D G+I  R+ LRRKL+C  F WYL+N++P    P     +G I +  +   CLD+   + +  V +F CH +GGNQ+F  +    +RT + C   +KL     +  C        W+YD  +  L +   N C+   T E+ +V +      S  Q+W L++
Sbjct:   57 GPGEMGKPVVIPKED-----QEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETN-QCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRSQQWLLRN 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:MGI Symbol;Acc:MGI:894693])

HSP 1 Score: 435.261 bits (1118), Expect = 5.727e-144
Identity = 226/504 (44.84%), Postives = 317/504 (62.90%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDD-ETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKS 2252
             PGE G+P  I K++     + + K  ++ +QFNL AS+ I++ RS+PD R + CK   + +NLPTTS+VIVFHNEAWSTLLRT+HS+I+RSP H+++EIVLVDDAS  + LK  L  YVK LK+ V ++R E R GL++AR+ GA  + G+V+TFLDAH EC  GWLEP+L RI  + RTVVCPII+ I+D+TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI R YF E+GTYD GM IWG EN+E+S RIW CGG LEI+ CSHVGHVFR  +PY++     +I+  N RRL EVW+DE+K  +Y ++    + D G+I  R+ LRRKL+C  F WYL+N++P    P     +G I +  +   CLD+   + +  V +F CH +GGNQ+F  +    +RT + C   +KL     +  C        W+YD  +  L +   N C+   T E+ +V +      S  Q+W L++
Sbjct:   57 GPGEMGKPVVIPKED-----QEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETN-QCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRSQQWLLRN 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:MGI Symbol;Acc:MGI:894693])

HSP 1 Score: 435.261 bits (1118), Expect = 5.727e-144
Identity = 226/504 (44.84%), Postives = 317/504 (62.90%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDD-ETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKS 2252
             PGE G+P  I K++     + + K  ++ +QFNL AS+ I++ RS+PD R + CK   + +NLPTTS+VIVFHNEAWSTLLRT+HS+I+RSP H+++EIVLVDDAS  + LK  L  YVK LK+ V ++R E R GL++AR+ GA  + G+V+TFLDAH EC  GWLEP+L RI  + RTVVCPII+ I+D+TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI R YF E+GTYD GM IWG EN+E+S RIW CGG LEI+ CSHVGHVFR  +PY++     +I+  N RRL EVW+DE+K  +Y ++    + D G+I  R+ LRRKL+C  F WYL+N++P    P     +G I +  +   CLD+   + +  V +F CH +GGNQ+F  +    +RT + C   +KL     +  C        W+YD  +  L +   N C+   T E+ +V +      S  Q+W L++
Sbjct:   57 GPGEMGKPVVIPKED-----QEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETN-QCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRSQQWLLRN 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt6 (polypeptide N-acetylgalactosaminyltransferase 6 [Source:MGI Symbol;Acc:MGI:1891640])

HSP 1 Score: 434.491 bits (1116), Expect = 9.448e-143
Identity = 234/484 (48.35%), Postives = 310/484 (64.05%), Query Frame = 3
Query:  756 NDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSI-PDQRSKECKEMKF--LENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQ--NTISVGVFDWKMQFNWQFADTINIQRLTRES-PVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRY----DIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDP-LSSKFMGSIESFASKGNCLDSG--NENSRTVKLFPCHNLGGNQLF-LISQTGFLRTINK--CF--SQNKLLLNTCDKDPVESRWKYDDETNLIYDK 2153
             DPN+PG  G+ F+  K E T  E  E + G++KH FN +ASDRIS++RS+ PD R  EC + KF     LPTTS++IVFHNEAWSTLLRT++S++  SP  LLKEI+LVDDAST EHLK RL  YV+ L+IV++VR   R GL+ AR++GA     EVLTFLDAH EC+ GWLEP+L RIAE+   VV P I +I+ NTF+ S   Q     S G FDW + F W+       QR   E+ P+KSP  AGGLFSI + YF  +GTYD  M+IWG ENVEMS R+W CGG LEIIPCS VGHVFR++SP+++ +    ++  NQ RL EVW+D+YK+++Y       +     + G+I  R++LR +L+CH+F WYL NV+P ++ P L+  F G+I++  +   CLD G  N   + + ++ CHNLGGNQ F   SQ      I K  C   S + L L +C      SR   D+E  L  D+
Sbjct:  108 QDPNSPGADGKAFQ--KKEWTNLETKEKEEGYKKHCFNAFASDRISLQRSLGPDTRPPECVDQKFRRCPPLPTTSVIIVFHNEAWSTLLRTVYSVLHTSPAILLKEIILVDDASTDEHLKERLEQYVQQLQIVRVVRQRERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTAVVSPDIVTIDLNTFQFSRPVQRGKAHSRGNFDWSLTFGWEMLPEHEKQRRKDETYPIKSPTFAGGLFSISKAYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKGTS-VIARNQVRLAEVWMDDYKKIFYRRNLQAAKMVQENNFGDISERLRLREQLRCHNFSWYLHNVYPEMFVPDLNPTFYGAIKNLGTN-QCLDVGENNRGGKPLIMYVCHNLGGNQYFEYTSQRDLRHNIGKQLCLHASGSTLGLRSCQFVGKNSRVPKDEEWELTQDQ 587          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt6 (polypeptide N-acetylgalactosaminyltransferase 6 [Source:MGI Symbol;Acc:MGI:1891640])

HSP 1 Score: 434.491 bits (1116), Expect = 9.448e-143
Identity = 234/484 (48.35%), Postives = 310/484 (64.05%), Query Frame = 3
Query:  756 NDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSI-PDQRSKECKEMKF--LENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQ--NTISVGVFDWKMQFNWQFADTINIQRLTRES-PVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRY----DIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDP-LSSKFMGSIESFASKGNCLDSG--NENSRTVKLFPCHNLGGNQLF-LISQTGFLRTINK--CF--SQNKLLLNTCDKDPVESRWKYDDETNLIYDK 2153
             DPN+PG  G+ F+  K E T  E  E + G++KH FN +ASDRIS++RS+ PD R  EC + KF     LPTTS++IVFHNEAWSTLLRT++S++  SP  LLKEI+LVDDAST EHLK RL  YV+ L+IV++VR   R GL+ AR++GA     EVLTFLDAH EC+ GWLEP+L RIAE+   VV P I +I+ NTF+ S   Q     S G FDW + F W+       QR   E+ P+KSP  AGGLFSI + YF  +GTYD  M+IWG ENVEMS R+W CGG LEIIPCS VGHVFR++SP+++ +    ++  NQ RL EVW+D+YK+++Y       +     + G+I  R++LR +L+CH+F WYL NV+P ++ P L+  F G+I++  +   CLD G  N   + + ++ CHNLGGNQ F   SQ      I K  C   S + L L +C      SR   D+E  L  D+
Sbjct:  108 QDPNSPGADGKAFQ--KKEWTNLETKEKEEGYKKHCFNAFASDRISLQRSLGPDTRPPECVDQKFRRCPPLPTTSVIIVFHNEAWSTLLRTVYSVLHTSPAILLKEIILVDDASTDEHLKERLEQYVQQLQIVRVVRQRERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTAVVSPDIVTIDLNTFQFSRPVQRGKAHSRGNFDWSLTFGWEMLPEHEKQRRKDETYPIKSPTFAGGLFSISKAYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKGTS-VIARNQVRLAEVWMDDYKKIFYRRNLQAAKMVQENNFGDISERLRLREQLRCHNFSWYLHNVYPEMFVPDLNPTFYGAIKNLGTN-QCLDVGENNRGGKPLIMYVCHNLGGNQYFEYTSQRDLRHNIGKQLCLHASGSTLGLRSCQFVGKNSRVPKDEEWELTQDQ 587          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q8MRC9|GALT9_DROME (Putative polypeptide N-acetylgalactosaminyltransferase 9 OS=Drosophila melanogaster OX=7227 GN=Pgant9 PE=1 SV=2)

HSP 1 Score: 459.144 bits (1180), Expect = 3.890e-151
Identity = 232/526 (44.11%), Postives = 321/526 (61.03%), Query Frame = 3
Query:  723 EENEFTIYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECK-EMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRES-PVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKG-NCLDS---GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKC--FSQNKLLLNTCDKDPVESRWKYDDET-NLIYDKQNNCVAIN-TNENVEVQTCSFEVPSIEQKWHLKSFVTFKL 2270
            E+++  I P  N    PGE G+P R+ K E+++  K     GW K+ FN Y SD ISV R++PD R   CK E ++L NLP T ++I FHNEAW+ LLRT+HS++DRSP HL+ +I+LVDD S   HLK +L DY      V+I+R + R GL++ARI+GA      VLT+LD+H EC  GWLEP+L+RIA N+ TVVCP+I+ I+D T E        ++VG FDW +QF+W        +R    + PV SP MAGGLFSI R +F  LGTYD G  IWG EN+E+S + WMCGG LEI+PCSHVGH+FR RSPY W   ++ +L  N  RL EVW+DEY + YY   GN D+ D G++  R KLR  LKC SF+WYL N++P L+ P  S   G I +    G  CLD+        + V  +PCH  GGNQ +++S+ G +R  + C  ++   + L  C        W Y + T  L +     C+AI+ + + + ++ CS  +    Q+W L+++ + KL
Sbjct:  130 EDSKKVIDPPANFEENPGELGKPVRLPK-EMSDEMKKAVDDGWTKNAFNQYVSDLISVHRTLPDPRDAWCKDEARYLTNLPKTDVIICFHNEAWTVLLRTVHSVLDRSPEHLIGKIILVDDYSDMPHLKRQLEDYFAAYPKVQIIRGQKREGLIRARILGANHAKSPVLTYLDSHCECTEGWLEPLLDRIARNSTTVVCPVIDVISDETLEYHYRDSGGVNVGGFDWNLQFSWHPVPERERKRHNSTAEPVYSPTMAGGLFSIDREFFDRLGTYDSGFDIWGGENLELSFKTWMCGGTLEIVPCSHVGHIFRKRSPYKWRSGVN-VLKKNSVRLAEVWMDEYSQYYYHRIGN-DKGDWGDVSDRRKLRNDLKCKSFKWYLDNIYPELFIPGDSVAHGEIRNLGYGGRTCLDAPAGKKHQKKAVGTYPCHRQGGNQYWMLSKAGEIRRDDSCLDYAGKDVTLFGCHGGKGNQFWTYRENTKQLHHGTSGKCLAISESKDKLLMEECSASLS--RQQWTLENYDSSKL 650          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q95ZJ1|GALT5_CAEEL (Polypeptide N-acetylgalactosaminyltransferase 5 OS=Caenorhabditis elegans OX=6239 GN=gly-5 PE=2 SV=2)

HSP 1 Score: 452.595 bits (1163), Expect = 6.485e-149
Identity = 234/529 (44.23%), Postives = 325/529 (61.44%), Query Frame = 3
Query:  699 IKNSSFKIEENEFTIYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPL-KIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRE-SPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASK-GNCLD---SGNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKC--FSQNKLLLNTCDKDPVESRWKYDDETN-LIYDKQNNCVAINTN-ENVEVQTCSFEVPSIEQKWHLKSF 2255
            +    F ++ N+  IY +  D    GE G+   ++K +L+  EKA+Y  G   + FN YASD ISV R++P     ECK  K+ ENLP TS++I FHNEAWS LLRT+HS+++R+P HLL+E+VLVDD S  +H K  L +Y+      VKI+R E R GL++AR+ GA   +GEVLT+LD+H EC  GW+EP+L+RI  +  TVVCP+I+ I+DNTFE  +      SVG FDW +QFNW      + +  TR   PV+SP MAGGLFSI + YF +LGTYDPG  IWG EN+E+S +IWMCGG LEI+PCSHVGHVFR RSPY W   ++ +L  N  RL EVWLD+YK  YY    N+   D G+I  R KLR  L C SF+WYL N++P L+ P  S   G + + A +   CLD     +E +R V  + CH  GGNQ +++S+ G +R    C  ++ + +++  C        W+Y+ +T  L +     C+ +  +   +E+  C ++ P   Q W  K +
Sbjct:   90 LAKPKFMVDPND-PIYKK-GDAAQAGELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQFGGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVN-VLKRNSIRLAEVWLDDYKTYYYERINNQ-LGDFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESVAKGEVRNSAVQPARCLDCMVGRHEKNRPVGTYQCHGQGGNQYWMLSKDGEIRRDESCVDYAGSDVMVFPCHGMKGNQEWRYNHDTGRLQHAVSQKCLGMTKDGAKLEMVACQYDDPY--QHWKFKEY 612          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|O08912|GALT1_MOUSE (Polypeptide N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=Galnt1 PE=1 SV=1)

HSP 1 Score: 435.261 bits (1118), Expect = 4.006e-143
Identity = 226/504 (44.84%), Postives = 317/504 (62.90%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDD-ETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKS 2252
             PGE G+P  I K++     + + K  ++ +QFNL AS+ I++ RS+PD R + CK   + +NLPTTS+VIVFHNEAWSTLLRT+HS+I+RSP H+++EIVLVDDAS  + LK  L  YVK LK+ V ++R E R GL++AR+ GA  + G+V+TFLDAH EC  GWLEP+L RI  + RTVVCPII+ I+D+TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI R YF E+GTYD GM IWG EN+E+S RIW CGG LEI+ CSHVGHVFR  +PY++     +I+  N RRL EVW+DE+K  +Y ++    + D G+I  R+ LRRKL+C  F WYL+N++P    P     +G I +  +   CLD+   + +  V +F CH +GGNQ+F  +    +RT + C   +KL     +  C        W+YD  +  L +   N C+   T E+ +V +      S  Q+W L++
Sbjct:   57 GPGEMGKPVVIPKED-----QEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETN-QCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRSQQWLLRN 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q6WV17|GALT5_DROME (Polypeptide N-acetylgalactosaminyltransferase 5 OS=Drosophila melanogaster OX=7227 GN=Pgant5 PE=1 SV=2)

HSP 1 Score: 436.802 bits (1122), Expect = 9.871e-143
Identity = 230/506 (45.45%), Postives = 318/506 (62.85%), Query Frame = 3
Query:  771 PGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIV-RSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCF----SQNKLLLNTCDKDPVESRWKYDDETNLI-YDKQNNCVAINTNENVE---VQTCSFEVPSIEQKWHLKS 2252
            PGE G+P +I  D + +  K ++K    ++QFNL ASD IS+ RS+ D R + C+   +   LPTTSIVIVFHNEAW+TLLRT+ S+I+RSP  LLKEI+LVDDAS  + L  +L +YV  L +   V R+E R GL++AR++GAE  SGEV+TFLDAH EC  GWLEP+L RI +N RTVVCPII+ I+D TFE      +T   G F+WK+ F W    +  + R    R +P+++P MAGGLFSI + YFYE+G+YD GM IWG EN+EMS RIW CGGILEIIPCSHVGHVFR +SPY++   + KI+  N  R+ EVWLDE+++ YYS++    +   G++  R  LR +LKC SF+WYL+NV+P    PL   ++G I + A    CLD+ G + +  V +  CH LGGNQ+F  ++   + + + C     S   + +  C        W YD E   I +     C+   T ++     ++ CS+      Q+W ++S
Sbjct:  129 PGEMGKPVKIPAD-MKDLMKEKFK----ENQFNLLASDMISLNRSLTDVRHEGCRRKHYASKLPTTSIVIVFHNEAWTTLLRTVWSVINRSPRALLKEIILVDDASERDFLGKQLEEYVAKLPVKTFVLRTEKRSGLIRARLLGAEHVSGEVITFLDAHCECTEGWLEPLLARIVQNRRTVVCPIIDVISDETFEYITASDSTW--GGFNWKLNFRWYRVPSREMARRNNDRTAPLRTPTMAGGLFSIDKDYFYEIGSYDEGMDIWGGENLEMSFRIWQCGGILEIIPCSHVGHVFRDKSPYTFPGGVAKIVLHNAARVAEVWLDEWRDFYYSMSTGARKASAGDVSDRKALRDRLKCKSFRWYLENVYPESLMPLDYYYLGEIRN-AETETCLDTMGRKYNEKVGISYCHGLGGNQVFAYTKRQQIMSDDLCLDASSSNGPVNMVRCHNMGGNQEWVYDAEEKWIRHTNTGQCLQRATRDDANTPLLRPCSY---GKGQQWLMES 623          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q29121|GALT1_PIG (Polypeptide N-acetylgalactosaminyltransferase 1 OS=Sus scrofa OX=9823 GN=GALNT1 PE=2 SV=1)

HSP 1 Score: 432.95 bits (1112), Expect = 3.056e-142
Identity = 225/504 (44.64%), Postives = 316/504 (62.70%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDD-ETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKS 2252
             PGE G+P  I K++     + + K  ++ +QFNL AS+ I++ RS+PD R + CK   + +NLPTTS+VIVFHNEAWSTLLRT+HS+I+RSP H+L+EIVLVDDAS  + LK  L  YVK LK+ V ++R E R GL++AR+ GA  + G+V+TFLDAH EC  GWLEP+L RI  + +TVVCPII+ I+D+TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI R YF E+GTYD GM IWG EN+E+S RIW CGG LEI+ CSHVGHVFR  +PY++     +I+  N RRL EVW+DE+K  +Y ++    + D G+I  R+ LR KL+C  F WYL+N++P    P     +G I +  +   CLD+   + +  V +F CH +GGNQ+F  +    +RT + C   +KL     +  C        W+YD  +  L +   N C+   T E+ +V +      S  Q+W L++
Sbjct:   57 GPGEMGKPVVIPKED-----QDKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMLEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRKTVVCPIIDVISDDTFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKTFFYIISPGVTKVDYGDISSRLGLRHKLQCRPFSWYLENIYPDSQIPRHYSSLGEIRNVETN-QCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCSGSRSQQWLLRN 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A433TY64 (Polypeptide N-acetylgalactosaminyltransferase OS=Elysia chlorotica OX=188477 GN=EGW08_005780 PE=3 SV=1)

HSP 1 Score: 493.426 bits (1269), Expect = 4.179e-162
Identity = 233/492 (47.36%), Postives = 327/492 (66.46%), Query Frame = 3
Query:  759 DPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQ-FADTINIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDSGNEN---SRTVKLFPCHNLGGNQLFLISQTGFLRTINKCF---SQNKLLLNTCDKDPVESRWKYDDETNLIYDKQNNCVAINTN-ENVEVQTCS 2210
            D NAPGE GR   I K++L+E E+ +Y  GW+ + +N YASD IS+ RS+PD R KEC+ +++L+ LP TS+VI FHNEAWS LLRT+HS+IDRSP HLLKEI+LVDD S  EHL   L DY+  L  VKIVR + R GL++AR+ G    + +V+TFLD+H EC  GWLEP+L+RIA N   VVCP+I+ I+D T        ++ S+G FDW MQF+W    D +   R +   PV SP MAGGLFSI R YF +LGTYDPGM IWG EN+E+S R+WMCGG+LEI+PCSHVGH+FR RSPY W   ++ ++  N  R+ EVW+D+YK  YY    N D  D G++  R +LR+ LKC SF+WY+++V+P L+ P  S   G + S A K  C+DS  ++    +TVK++PCHN GGNQ +++S++G +R  + C      + +++  C        W+Y ++  L +     C  ++T+ + ++++ C+
Sbjct:  143 DSNAPGENGRAVSITKEKLSEEERKKYDEGWKNNAYNQYASDMISLHRSLPDTRDKECRSIEYLKKLPDTSVVICFHNEAWSVLLRTVHSVIDRSPPHLLKEIILVDDFSDMEHLGKPLEDYMAKLGKVKIVRGKQREGLIRARLSGFSVATADVVTFLDSHCECTKGWLEPLLDRIARNESYVVCPVIDVIDDETLRYQYSKASSTSIGGFDWNMQFSWHAIPDYLRKTRSSDVMPVPSPTMAGGLFSISRKYFEKLGTYDPGMDIWGGENLELSFRVWMCGGVLEIVPCSHVGHIFRKRSPYKWRSGVN-VVKKNAIRVAEVWMDDYKNYYYERF-NYDLGDYGDVSARKELRKNLKCKSFKWYIEHVYPELFVPGESIASGEVRSKA-KPMCVDSPADHRNYHKTVKMWPCHNQGGNQFWMLSKSGEIRRDDGCLDYSGGDGVIIYPCHGQKGNQEWQYREDNALFHVNTQKCAEVSTDGKALQMKKCT 631          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A210QQN1 (Polypeptide N-acetylgalactosaminyltransferase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19572 PE=3 SV=1)

HSP 1 Score: 488.034 bits (1255), Expect = 5.869e-160
Identity = 232/516 (44.96%), Postives = 333/516 (64.53%), Query Frame = 3
Query:  705 NSSFKIEENEFTIYPRLN-----DPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRES--PVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDSGNEN---SRTVKLFPCHNLGGNQLFLISQTGFLRTINKCF---SQNKLLLNTCDKDPVESRWKYDDETNLIYDKQNNCVAINTN-ENVEVQTCS 2210
            N   ++EE      P+       DPNAPGE G+   I+K++L+ +E+ +Y  GW+ + FN+YASD IS+ RS+PD R  ECK +++ E LP TS+V+ FHNEAW+ LLRT+HSIIDRSP HLL+E+VLVDD S  +HLK  L  Y+  L  VK+VR++ R GL++AR++G   +SG+VLT+LD+H EC  GWLEP+L+RIA NN  VVCP+I+ I D++F+       + S+G FDW +QFNW        QR   +   PV+SP MAGGLFSI R YF ++GTYDPGM IWG EN+EMS R+WMCGG LEIIPCSHVGH+FR RSPY W   ++ ++  N  RL EVW+D+YK  YY    N D  + G++  R  LR+KL C  F W++KN++P L+ P  +   G I + A K  C+DS  ++    + V ++PCHN GGNQ +++S+ G +R  + C        +++  C        W Y ++  +++     C+ ++ + + + ++TC+
Sbjct:  115 NKVKRVEEKPLKYIPKEQNRQEVDPNAPGENGKAVVIDKEKLSPTERKKYDDGWQNNAFNMYASDMISLHRSLPDVRDSECKSLQYQEKLPDTSVVVCFHNEAWTVLLRTVHSIIDRSPPHLLREVVLVDDFSDMDHLKEPLETYMAKLGKVKVVRTKKREGLIRARLLGYSASSGDVLTYLDSHCECTEGWLEPLLDRIATNNSIVVCPVIDVIEDDSFKYQYGSAKSTSIGGFDWNLQFNWHAIPEYERQRRQNKDYLPVRSPTMAGGLFSISREYFTKIGTYDPGMDIWGGENLEMSFRVWMCGGTLEIIPCSHVGHIFRKRSPYKWRSGVN-VVKKNSIRLAEVWMDDYKNYYYERFNN-DLGEYGDVSERKALRKKLNCKPFDWFVKNIYPDLFVPGEAVASGEIRNKA-KPMCVDSSVDSHNFHKPVNMWPCHNQGGNQYWMLSKGGEIRRDDGCLDFSGGESVIIYPCHSQKGNQEWVYREDNTILHANTQKCMEVSVDGQKLLMRTCT 627          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A2R5LF21 (Polypeptide N-acetylgalactosaminyltransferase OS=Ornithodoros turicata OX=34597 PE=3 SV=1)

HSP 1 Score: 487.263 bits (1253), Expect = 6.358e-160
Identity = 240/519 (46.24%), Postives = 333/519 (64.16%), Query Frame = 3
Query:  741 IYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRE-SPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKG-NCLDS--GNEN-SRTVKLFPCHNLGGNQLFLISQTGFLRTINKC--FSQNKLLLNTCDKDPVESRWKYDDETNLI-YDKQNNCVAINTN-ENVEVQTCSFEVPSIEQKWHLKSFVTFKL 2270
            + P     ++PGE GRP ++N   LT  +    K GW+++ FN Y SD IS+ RS+PD R  ECK+ K+LE+LP+TS+VI FHNEAWS LLRT+HS+IDRSP  LLKE++LVDD S   HLK +L DYV  L  VKIVR++ R GL++AR++GA  ++G V+T+LD+H EC  GWLEP+L+RIA N+ TVVCP+I+ IND TFE        ++VG FDW +QF+W        +R      PV SP MAGGLF+I + +F +LGTYD G  IWG EN+E+S + WMCGG LEI+PCSHVGHVFR RSPY W   ++ +L  N  RL EVWLDE+ + YY   GN D  D G++  R  LR +LKC SF WY++N++P L+ P  +   G + + A  G  CLDS  G E+  + V ++PCH  GGNQ +++S+ G +R    C  F+   ++L  C        W YD + + I +     C+ ++ N + V +++CS    S+ Q+W  ++F   K+
Sbjct:  105 VLPPPRSADSPGEMGRPVKLNN--LTAEQDKVVKQGWDRNAFNQYISDMISLHRSLPDVRDTECKDEKYLEDLPSTSVVICFHNEAWSVLLRTVHSVIDRSPPKLLKEVILVDDFSDMAHLKRQLEDYVAHLPKVKIVRAQKREGLIRARLLGAAASTGAVITYLDSHCECTEGWLEPLLDRIARNSTTVVCPVIDVINDATFEYHYRDSGGVNVGGFDWNLQFSWHAVPERERKRRKHSWDPVWSPTMAGGLFAIDKAFFEKLGTYDSGFDIWGGENLELSFKTWMCGGTLEIVPCSHVGHVFRKRSPYRWRSGVN-VLRRNSVRLAEVWLDEHAKYYYQRIGN-DLGDFGDVSPRKALRNQLKCKSFDWYVRNIYPELFVPGDAVASGEVRNMAEGGRTCLDSPAGRESMHKAVGMYPCHGQGGNQYWMLSKEGEIRRDEACLDFAGGDVILYPCHGSRGNQLWMYDHDAHTIQHSSSRKCLQMSENRQKVSMESCS---GSLRQQWVFQNFDASKM 616          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A2T7PAH9 (Polypeptide N-acetylgalactosaminyltransferase OS=Pomacea canaliculata OX=400727 GN=C0Q70_09701 PE=3 SV=1)

HSP 1 Score: 488.034 bits (1255), Expect = 6.668e-160
Identity = 227/492 (46.14%), Postives = 323/492 (65.65%), Query Frame = 3
Query:  759 DPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRE-SPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDSGNEN---SRTVKLFPCHNLGGNQLFLISQTGFLRTINKCF---SQNKLLLNTCDKDPVESRWKYDDETNLIYDKQNNCVAINTN-ENVEVQTCS 2210
            DPN PGE G+   I+KD+L   E+ ++  GW+K+ +N YASD IS+ RS+PD R  EC+++K+ ENLP TS+V+ FHNEAWS LLRT+HSI+DRSP HLLKEI++VDD S  +HLK+ L +YV  LK V++VR++ R GL++AR++G    + +V+TFLD+H EC  GWLEP+L+RIAEN   VVCP+I+ I D T +         S+G FDW +QF W        +R   + +P++SP MAGGLF+I R YF ELGTYDPGM IWG EN+E+S R+WMCGG+LEIIPCSHVGH+FR RSPY W   ++ ++  N  RL EVW+DEY+  YY    N D  D G++  R  LR++L C  F+WY+KNV+P L+ P  +   G I S A K  C+DS  ++    + V ++PCH  GGNQ +++S++G +R  + C      N +++  C        W Y ++  L +     C  ++ + + + ++ C+
Sbjct:  143 DPNGPGESGKAVVIDKDKLAPDERKKFDDGWQKNAYNQYASDMISLHRSLPDVRDTECRDLKYRENLPDTSVVVCFHNEAWSVLLRTVHSILDRSPPHLLKEIIMVDDFSDMDHLKAPLEEYVIKLKKVRVVRTKQREGLIRARLLGFSAATAQVVTFLDSHCECTEGWLEPLLDRIAENKSNVVCPVIDVIEDETLKYQYGSAKATSIGGFDWNLQFTWHGIPEYERKRRGNDVAPIRSPTMAGGLFAISREYFEELGTYDPGMDIWGGENLELSFRVWMCGGVLEIIPCSHVGHIFRKRSPYKWRTGVN-VVKKNSIRLAEVWMDEYRNYYYERFNN-DLGDYGDVSERKALRQRLHCKDFRWYIKNVYPDLFVPGEAIASGEIRSKA-KPMCIDSPADHHNYHKPVNMWPCHGQGGNQYWMLSKSGEIRRDDGCLDYSGGNDVIIYPCHGQKGNQEWSYREDNTLYHVNTQKCAEVSVDGKTLTMKQCT 631          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A1W0WTK6 (Polypeptide N-acetylgalactosaminyltransferase OS=Hypsibius dujardini OX=232323 GN=BV898_07357 PE=3 SV=1)

HSP 1 Score: 484.952 bits (1247), Expect = 3.773e-159
Identity = 240/513 (46.78%), Postives = 326/513 (63.55%), Query Frame = 3
Query:  759 DPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMK--FLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQ-FADTINIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKG-NCLDSG---NENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKC--FSQNKLLLNTCDKDPVESRWKYDDETN-LIYDKQNNCVAINTN-ENVEVQTCSFEVPSIEQKWHLKSFVTF 2264
            +P+ PGE G+   + K++L   EK  +  GW+ + FN YASD ISV+RS+PD R   CKE +  +L +LP TS+++ FHNEAWS LLRT+HS++DRSP HLLKEIVLVDD S  EHLK  L DY+     VKI+R+  RVGL++AR+IGAE   G+VLTFLD+H EC  GWLEP+L+RIA N  TVVCP+I+ I+D+TFE      +   VG FDW +QFNW    D    +R     PV+SP MAGGLFSI R +F  +GTYD G  IWG EN+E+S + WMCGG LEIIPCSHVGH+FR RSPY W   ++ +L  N  RL EVWLDE+K+ YY    N D  D G++  R  LR +LKC SF WYLKN++P L+ P  +   G + +    G +CLDS    N+  + + ++PCH  GGNQ + +S+ G +R    C  F+   +++  C        W Y+ ET  + +   N C+ ++T+ + ++V  C  +  +  QKW  +  +T 
Sbjct:   99 NPDGPGELGKAVTMKKEDLGPKEKTLFDDGWQNNAFNQYASDMISVKRSLPDVRDDRCKEEESGYLTDLPDTSVIVCFHNEAWSVLLRTVHSVLDRSPSHLLKEIVLVDDDSDMEHLKKPLEDYMAKYPKVKIIRAGKRVGLIRARLIGAENAIGKVLTFLDSHCECVQGWLEPLLDRIARNWTTVVCPVIDVIDDSTFEYHYGRASGTQVGGFDWNLQFNWHGIPDHEKQRRKYDTDPVQSPTMAGGLFSIDRKFFQRVGTYDDGFDIWGGENLELSFKTWMCGGTLEIIPCSHVGHIFRKRSPYKWRTGVN-VLKRNSIRLAEVWLDEHKKYYYQRI-NNDLGDFGDVSARKSLREELKCQSFDWYLKNIYPELFIPGEAVGSGEVRNLGDGGRHCLDSASKKNDYHKPITMYPCHKQGGNQYWSLSKEGEIRRDEACIDFAGKDVVVYPCHGQKGNQLWNYNHETGRMFHPTSNKCMEMHTDHKTIKVNACDDD--NERQKWKFQETLTL 607          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:103039482])

HSP 1 Score: 435.261 bits (1118), Expect = 4.908e-144
Identity = 227/505 (44.95%), Postives = 317/505 (62.77%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDDE-TNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKSF 2255
             PGE G+   I KD+     + + K  ++ +QFNL ASD I++ RS+PD R   CK   + ++LP TSIVIVFHNEAWSTLLRT+HS+I+RSP HLL EI+LVDDAS  + LK +L DYVK L++ V+I+R E R GL++AR+ GA  T G+V+TFLDAH EC  GWLEP+L RI E+ + VVCPII+ I+D TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI R+YF E+GTYDPGM IWG EN+EMS RIW CGG LEI+ CSHVGHVFR  +PYS+     +++  N RRL EVW+DE+K+ +Y ++    R D G++  R  LR  L+C  F WYL+N++P    P     +G I +  +   C+D+ G + +  V  F CH +GGNQ+F  +    +RT + C   ++L    ++  C        ++YD E   L++   N C+ + + E+  V T      S  Q+W L++ 
Sbjct:   56 GPGEMGKAVIIPKDD-----QEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYPDDLPNTSIVIVFHNEAWSTLLRTVHSVINRSPRHLLVEILLVDDASERDFLKKKLEDYVKTLEVPVRILRMEQRSGLIRARLRGAAATRGQVITFLDAHCECTVGWLEPLLSRIKEDRKAVVCPIIDVISDETFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRSYFEEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSARKALREALQCKPFSWYLENIYPDSQIPRRYFSLGEIRNVETN-QCVDNMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTDDLCLDVSRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRSQQWLLRNM 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:103031512])

HSP 1 Score: 432.95 bits (1112), Expect = 3.397e-143
Identity = 224/513 (43.66%), Postives = 325/513 (63.35%), Query Frame = 3
Query:  741 IYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDD-ETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKS 2252
            + PR +D   PGE G+P  I K++       + K  ++ +QFNL AS+ I++ RS+PD R + CK   + ++LP TS+VIVFHNEAW+TLLRT+HS+I+RSP HLL+E+VLVDDAS  + LK +L  YV+ L++ V+IVR E R GL++AR+ GA  ++G+V+TFLDAH EC  GWLEP+L RI ++ +TVVCPII+ I+D+TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI R YF E+GTYD GM IWG EN+E+S RIW CGG LEI+ CSHVGHVFR  +PY++     +I+  N RRL EVW+DE+K  +Y ++    + D G+I  R  LR+KL+C  F WYL+NV+P    P     +G I +  +   CLD+   + +  V +F CH +GGNQ+F  +    +RT + C   +KL    ++  C        W YD  + +L++   N C+   + ++ +V +      S  Q+W L++
Sbjct:   48 VVPRPHD--GPGEMGKPVVIPKEQ-----HEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKNKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLEEVVLVDDASERDFLKRKLEQYVRKLEVPVRIVRMEQRSGLIRARLKGASLSTGQVITFLDAHCECTMGWLEPLLSRIKQDKKTVVCPIIDVISDDTFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDIATRASLRQKLQCKPFSWYLENVYPDSQIPRHYYSLGEIRNVETN-QCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVMMLKCHHLKGNQLWDYDPLKLSLVHVNSNQCLDKASEDDSQVPSVRDCTGSRSQQWLLRN 550          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:103039482])

HSP 1 Score: 427.172 bits (1097), Expect = 8.513e-141
Identity = 225/511 (44.03%), Postives = 318/511 (62.23%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDDETN-LIYDKQNNCVAINTNENVEVQ-TCSFEVPSIEQKWHLKSFVTFKL 2270
             PGE G+   I KD+     + + K  ++ +QFNL ASD I++ RS+PD R   CK   + ++LP TSIVIVFHNEAWSTLLRT+HS+I+RSP HLL EI+LVDDAS  + LK +L DYVK L++ V+I+R E R GL++AR+ GA  T G+V+TFLDAH EC  GWLEP+L RI E+ + VVCPII+ I+D TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI R+YF E+GTYDPGM IWG EN+EMS RIW CGG LEI+ CSHVGHVFR  +PYS+     +++  N RRL EVW+DE+K+ +Y ++    R D G++  R  LR  L+C  F WYL+N++P    P     +G I +  +   C+D+ G + +  V  F CH +GGNQ+F  +    +RT + C   ++L    ++  C        ++YD E    ++    +C+ I+  E+     T  +   S  Q W L+++   ++
Sbjct:   56 GPGEMGKAVIIPKDD-----QEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYPDDLPNTSIVIVFHNEAWSTLLRTVHSVINRSPRHLLVEILLVDDASERDFLKKKLEDYVKTLEVPVRILRMEQRSGLIRARLRGAAATRGQVITFLDAHCECTVGWLEPLLSRIKEDRKAVVCPIIDVISDETFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRSYFEEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSARKALREALQCKPFSWYLENIYPDSQIPRRYFSLGEIRNVETN-QCVDNMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTDDLCLDVSRLNGPVVMLKCHHMKGNQMFEYDAEKGTFMHIITQSCLTISRLEDGTYGPTVEYCDDSPLQTWVLRNYTRLEV 558          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:103039482])

HSP 1 Score: 416.772 bits (1070), Expect = 2.475e-137
Identity = 209/425 (49.18%), Postives = 279/425 (65.65%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGN------CLDSGNENSRTVKLFPCHNLGGNQLF 2015
             PGE G+   I KD+     + + K  ++ +QFNL ASD I++ RS+PD R   CK   + ++LP TSIVIVFHNEAWSTLLRT+HS+I+RSP HLL EI+LVDDAS  + LK +L DYVK L++ V+I+R E R GL++AR+ GA  T G+V+TFLDAH EC  GWLEP+L RI E+ + VVCPII+ I+D TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI R+YF E+GTYDPGM IWG EN+EMS RIW CGG LEI+ CSHVGHVFR  +PYS+     +++  N RRL EVW+DE+K+ +Y ++    R D G++  R  LR  L+C  F WYL+N++P    P     +G + S+ +         CLD    N   V L  CH++ GNQ+F
Sbjct:   56 GPGEMGKAVIIPKDD-----QEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYPDDLPNTSIVIVFHNEAWSTLLRTVHSVINRSPRHLLVEILLVDDASERDFLKKKLEDYVKTLEVPVRILRMEQRSGLIRARLRGAAATRGQVITFLDAHCECTVGWLEPLLSRIKEDRKAVVCPIIDVISDETFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRSYFEEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSARKALREALQCKPFSWYLENIYPDSQIPRRYFSLGEVFSYTADKEIRTDDLCLDVSRLNGPVVML-KCHHMKGNQMF 472          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: GALNT3 (polypeptide N-acetylgalactosaminyltransferase 3 [Source:NCBI gene;Acc:103045087])

HSP 1 Score: 417.542 bits (1072), Expect = 2.791e-136
Identity = 219/435 (50.34%), Postives = 295/435 (67.82%), Query Frame = 3
Query:  753 LNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSI-PDQRSKECKEMKF--LENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFE---ASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRES-PVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRY----DIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDP-LSSKFMGSIESFASKGNCLDSG--NENSRTVKLFPCHNLGGNQLF 2015
            L +P+APG  G+PF  + D L+  E+ E + G EKH FNLYASDRIS+ R + PD R  EC E  F     LPTTS++IVFHNEAWSTLLRT++S++  SP  LLKE++LVDDAS    LK  L++Y+K L IV++VR   R GL+ AR++GA   +G+ LTFLDAH EC+ GWLEP+L RIAEN   VV P I +I+ NTFE    S  GQN  + G FDW + F W+       QR   E+ P+K+PA AGGLFSI + YFY +G+YD  M+IWG EN+EMS R+W CGG LEIIPCS VGHVFR++SP+++ +   +++  NQ RL EVW+D+YKE++Y       +       G++  R+ LR +L+C SF WYLKNV+P ++ P L+    G+I++   K +CLD+G  NE  +T+ ++PCH +GGNQ F
Sbjct:  110 LQNPSAPGASGKPF--HTDNLSPEEQKEKEQGEEKHCFNLYASDRISLSRDLGPDTRPPECIEQTFRRCPPLPTTSVIIVFHNEAWSTLLRTVYSVLHTSPALLLKEVILVDDASIDGRLKGELDEYLKQLHIVRVVRQLERKGLITARLLGASVATGDTLTFLDAHCECFHGWLEPLLARIAENYTAVVSPDITTIDLNTFEFMKPSPYGQNH-NRGNFDWGLSFGWESLPDHEKQRRKDETYPIKTPAFAGGLFSISKDYFYHIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIIPCSIVGHVFRTKSPHTFPKGT-QVIARNQVRLAEVWMDDYKEIFYRRNQQASQMAKERSFGDVSKRLDLRERLQCKSFSWYLKNVYPEVFMPDLNPLQFGAIKNIG-KDSCLDAGENNEGGKTLIMYPCHGMGGNQYF 539          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008097.1 (pep scaffold:Pmarinus_7.0:GL476358:506472:520895:1 gene:ENSPMAG00000007303.1 transcript:ENSPMAT00000008097.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 420.624 bits (1080), Expect = 4.117e-138
Identity = 222/468 (47.44%), Postives = 300/468 (64.10%), Query Frame = 3
Query:  681 SEEEVKIKNSSFKIEENEFTIYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSI-PDQRSKECKEMKF--LENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTIS--VGVFDWKMQFNWQ-FADTINIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRY----DIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDP-LSSKFMGSIESFASKGNCLDSG---NENSRTVKLFPCHNLGGNQLFLISQTGFLR 2042
            S E+  +       E   F   P L D NAPG  GR ++   D+L+  EKA  + G EKH FN+YASD++S+ R + PD R  EC E KF    ++P+TS++IVFHNEAWSTLLRT+HS++  SP  LLKEI+LVDDAS  ++LK  L++YVK   IVK+VR + R GL+ AR++GA    GEVLTFLDAH EC+ GWLEP+L RI +N  +VV P I +I+ NTFE +     + +   G FDW + F W+         R  +  P++SP  AGGLFSI + YF  LGTYD  M+IWG EN+EMS R+W CGG LEIIPCS VGHVFR++SP+++ + +  ++T N  RL EVW+D+YK+++Y               G++  R +LR KL+C +F WYL NV+P ++ P L     G+I++ A KGNCLD+G   NE  + + L+PCH +GGNQ F  S    LR
Sbjct:   92 SAEQACLSGFYSAAELRPFQERPSL-DANAPGASGRAYKT--DDLSPEEKAIKEKGMEKHCFNVYASDKVSLHRDLGPDTRPPECIEQKFKRCPSMPSTSVIIVFHNEAWSTLLRTVHSVMYTSPSVLLKEIILVDDASVDDYLKGPLDEYVKQFGIVKVVRQQERKGLITARLLGASVAQGEVLTFLDAHCECFNGWLEPLLARIRQNETSVVSPDISTIDMNTFEVNKPSAYSPAHNRGNFDWGLTFGWEPIPSRERTLRKDQTYPIRSPTFAGGLFSISKKYFEYLGTYDDQMEIWGGENIEMSFRVWQCGGQLEIIPCSIVGHVFRTKSPHTFPQGVS-VITRNLVRLAEVWMDDYKDIFYRRNSQAAEIVKNKAYGDVTWRKRLRDKLQCKNFTWYLTNVYPEMFVPDLHPNIFGAIKNKA-KGNCLDTGSFQNEVGKPLILYPCHGMGGNQYFEYSSQKELR 554          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: poc1bl (POC1 centriolar protein homolog B (Chlamydomonas), like [Source:ZFIN;Acc:ZDB-GENE-050306-41])

HSP 1 Score: 399.823 bits (1026), Expect = 8.770e-131
Identity = 209/507 (41.22%), Postives = 303/507 (59.76%), Query Frame = 3
Query:  759 DPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKF-LENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQ-FADTINIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSL--TGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLS-SKFMGSIESFASKGNCLD----SGNENSRTVKLFPCHNLGGNQLFLISQTGFLR---TINKCF----SQNKLLLNTCDKD----PVESRWKYDDETNLIYDKQNNCVAI----NTNENVEVQTC 2207
            D  A GE  +  R+N  E +   K E +S  E++  N+Y SDRIS+ R IPD R  ECK  KF    LPTTS+VI F+NEAWSTLLRT+HS+++ SP  LL+EI+LVDD S   +LKS L DY+  L+ V++VR+  R GL++AR++GA   +G+VLTFLD H EC PGW+EP+L+RI E    VVCP+I++I+ NTFE   +  +  ++G FDW++ F W    +    +R +R  P++SP MAGGLF++ + YF  +GTYD GM++WG EN+E+S R+W CGG LE+ PCSHVGHVF  ++PY     +      N  R  EVW+D YKE +Y+    G +++Y  G++  R  LR KL C SF+WYLKN++P L+ P     F G+I++   +  C+D      N     + L+PCH  GGNQ F  +    LR       C      + ++ +  C  D    P    W + ++  +    +N C+      +   ++E++ C
Sbjct:   73 DERALGEWAKAARLNLPEGSSERKLEEESI-ERYALNIYLSDRISLHRHIPDGRMYECKAQKFDYRRLPTTSVVIAFYNEAWSTLLRTVHSVLESSPAVLLREIILVDDFSDRAYLKSPLEDYISTLERVRLVRTTQREGLVRARLLGATHATGQVLTFLDCHCECVPGWIEPLLQRIWEKETAVVCPVIDTIDWNTFEFY-MQTSEPAIGGFDWRLTFQWHGVPEHERSRRASRIEPIQSPTMAGGLFAVSKKYFDHIGTYDQGMEVWGGENLELSFRVWQCGGSLEVHPCSHVGHVFPKKAPYPRPRFLQ-----NTVRAAEVWMDSYKEHFYNRNPPGRKEKY--GDLSERKTLREKLGCKSFEWYLKNIYPDLHVPEDRPGFHGAIQNKGIQSECIDYNAPDNNPTGAMLSLYPCHGQGGNQFFEYTTRKDLRFNSATELCAEVRDGKPQVAMRHCPPDSQSNPPSVMWDFREDGTVYNAHRNACLTAFRKPDGRADIEIRPC 570          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000477.1 (pep scaffold:Pmarinus_7.0:GL501308:12705:54064:-1 gene:ENSPMAG00000000418.1 transcript:ENSPMAT00000000477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 387.111 bits (993), Expect = 1.778e-127
Identity = 197/455 (43.30%), Postives = 279/455 (61.32%), Query Frame = 3
Query:  930 CKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDDETN---LIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKSFVT 2261
            CK   + + LP TS+VIVFHNEAWSTLLRT+HSII RSP H+L+EI+LVDDAS  + LKS L +Y   L + V IVR E+R GL++AR+ GA  + G+V+TFLDAH EC  GWLEP+L RI  + + VVCPII+ I+D TFE   L  + ++ G F+WK+ F W       + R    R  PV+SP MAGGLF+I R YF E+GTYD GM IWG EN+EMS RIW CGG LEI+ CSHVGHVFR  +PY++     +++  N RRL EVW+D +K+ +Y ++    + + G++  R  LR +LKC  F W+L+NV+P+   P     +G + +  +   CLD+ G + +  + +F CH++GGNQ+F  +    LRT + C   +++    L+  C        W YD +     + +   N C+   T ++ +V T         Q+W L++   
Sbjct:    1 CKTKVYPDGLPKTSVVIVFHNEAWSTLLRTVHSIIGRSPRHMLEEIILVDDASERDFLKSPLEEYASKLPVPVHIVRMESRSGLIRARLRGAAVSRGQVITFLDAHCECTTGWLEPLLARIKADRKNVVCPIIDVISDETFEY--LAGSDMTYGGFNWKLNFRWYPVPQSEMDRRKGDRTIPVRSPTMAGGLFAIDRDYFQEIGTYDAGMDIWGGENLEMSFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQVINKNNRRLAEVWMDNFKDFFYIISPGVTKVEYGDVSQRKALRDRLKCKPFSWFLENVYPNSQIPRHYYSLGEVRNVETN-QCLDNMGRKENEKIGIFNCHSMGGNQVFSYTADKELRTDDLCLDVSRMNGPVLMLKCHHMKGNQLWDYDQQMQKLIMRHTNSNQCLDKATEQDRQVPTMRECDGGRSQQWILRNMTV 452          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: galnt12 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 12 [Source:ZFIN;Acc:ZDB-GENE-060503-704])

HSP 1 Score: 381.333 bits (978), Expect = 2.733e-124
Identity = 200/431 (46.40%), Postives = 275/431 (63.81%), Query Frame = 3
Query:  759 DPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKF-LENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFE-ASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRESP---VKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDP--LSSKFMGSIESFASKGNCLDSG--NENSRT---VKLFPCHNLGGNQLF 2015
            D NA GE G+  R+N   L   EK + +    KHQ N+Y SDRIS+ R +P++ +  C+E K+    LPTTS+VI F+NEAWSTLLRT+HS+++ SP  LL EI+LVDD S  EHL+ RL  Y+  L+ V++VR+  R GL++AR++GA   +G+VLTFLD H EC+ GWLEP+LERIAE    VVCP+I+ I  NTFE   N G+  I  G FDW++ F W        +R  R+SP   ++SP MAGGLF++ + YF  LGTYD GM++WG EN+E S RIW CGG LE+ PCSHVGHVF  ++PYS  +++      N  R  EVW+D YKE+YY    +      G++  R  LR +L+C +F+W+L+NV+P ++ P     KF G +++      C D    +EN  T   + L+ CH +G NQ F
Sbjct:   23 DSNALGEMGKAVRLN---LEGEEKRKEEESINKHQINIYVSDRISLHRQLPEKWNPLCREKKYNYRQLPTTSVVIAFYNEAWSTLLRTVHSVLETSPDALLNEIILVDDYSDREHLRDRLEQYIATLRKVRLVRARKREGLVRARLLGAGVATGDVLTFLDCHCECHVGWLEPLLERIAEEESAVVCPVIDVIEWNTFEYMGNAGEPQI--GGFDWRLVFTWHTVPGHEQKR--RKSPIDVIRSPTMAGGLFAVSKKYFDYLGTYDTGMEVWGGENLEFSFRIWQCGGTLEVHPCSHVGHVFPKQAPYSRSKAL-----ANSVRAAEVWMDGYKELYYHRNPHARMEPFGDVTERRNLRERLQCKTFKWFLENVYPDIHVPEDRPGKF-GMLKNRGLSNYCFDYNPPDENQVTGQRIILYGCHGMGQNQFF 440          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: galnt2 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-041111-110])

HSP 1 Score: 331.643 bits (849), Expect = 6.992e-107
Identity = 168/387 (43.41%), Postives = 237/387 (61.24%), Query Frame = 3
Query:  930 CKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQF--ADTINIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENV------EMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFS 2063
            C+   +  +LP TS++I FHNEA STLLRT+ S++++SP HL++EI+LVDD S            +  ++ VK +R+E R GLM++R+ GA+     +LTFLD+H EC   WLEP+LER+AE+   VVCPII+ IN + F+   +G +    G F+W + F W +   +    ++ T  SP+++P +AGGLF + + YF ELG YD  M IWG EN+      E+S R+W CGG LEIIPCS VGHVFR + PYS+      +   N RR  EVW+DEYK  YY+   +      GNIQGR++LR KLKC  F+WYL NV+P L  P   K   +  +     NCLD+ G+    TV ++ CHN GGNQ +  ++   L+ I+ C +
Sbjct:    1 CRYQTWGPSLPATSVIITFHNEARSTLLRTVVSVLNKSPAHLIREIILVDDYSD----DPEDGKLLAKIEKVKTIRNEKREGLMRSRVRGADIAESAILTFLDSHCECNEHWLEPLLERVAEDRTRVVCPIIDVINMDNFQY--VGASADLKGGFEWNLVFKWDYLTPEQRKARQTTPTSPIRTPMIAGGLFVMEKAYFEELGKYDMMMDIWGGENLGSAPRAEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYSFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARSVSFGNIQGRLELREKLKCKPFKWYLDNVYPELRVP--DKQDVAFGALQQGANCLDTMGHFADGTVGVYECHNAGGNQEWAFTKEKSLKHIDLCLT 379          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO43861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXK4])

HSP 1 Score: 383.259 bits (983), Expect = 2.227e-126
Identity = 186/401 (46.38%), Postives = 267/401 (66.58%), Query Frame = 3
Query:  828 KAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRESP-VKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSW----GESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQL 2012
            K + + G+E H FNL ASD +S+ R +PD R+  CK  K+  +LP +SI+I FHNEAWSTLLRT+HS+I+R+P  LL+EI+L+DDAS  + LK +L +YV  LK+V+I+R   R GL++AR+ GA    G +LTFLDAH EC  GWLEP+  +IAEN+  VV P+I+ I+D TF    + +     GVF W+++F W+      ++R   E+  +++P MAGGLFSI + YF ++GTYD GM IWG EN+E+S RIWMCGG +E++PCS VGHVFR R PYS+    G + D +++ N  R+ +VW+DEYK+ +Y++  +  R    ++  R+ LR KLKC +F+WYL NV+P L  P ++          S   CLD+ G ++   + L+ CH  GGNQ+
Sbjct:   14 KEKEEEGYELHSFNLVASDMMSLYRRLPDYRNDACKAKKYPLHLPKSSIIICFHNEAWSTLLRTVHSVINRTPPRLLEEILLIDDASNRDELKEKLEEYVAKLKVVRIIRLSKRQGLIRARLKGAAAAKGSILTFLDAHCECSKGWLEPLAAKIAENSSNVVMPVIDEISDTTFYYHAVPE-PFHRGVFRWRLEFGWKPVPQYEMERRKDEADGIRTPVMAGGLFSIDKNYFEKIGTYDTGMDIWGGENLEISFRIWMCGGAIEMLPCSRVGHVFRPRFPYSFPARPGHNTD-VVSNNLMRVADVWMDEYKKHFYNIRFDLKRKQHDDVSQRLALREKLKCKNFKWYLDNVYPELEVPDTNFAASGQVRNPSSDMCLDTLGKKDDTPLGLYQCHGQGGNQV 412          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO31035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ28])

HSP 1 Score: 380.563 bits (976), Expect = 7.907e-125
Identity = 200/435 (45.98%), Postives = 267/435 (61.38%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRESP---VKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIE-SFASKGNCLDSGNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCF 2060
             PGE G P     ++ ++ + A  + G     FN + SD+IS+ R+I D R + CK+  +  NLP  S+VIVFHNE WSTL+RT+H+++ RSP H+L+EIV+VDD S  + LK +L+DY K L  +KIVR++ RVGL+KAR+IGA    GEV+ FLDAH EC  GWL P+LERIA N RT VCP I+ I+  TF+   +  +    G F+W+  F+++       +   R  P   VKSP MAGGLF+I R +F ELG YDPGM IWG E  E+S ++W CGG LE IPCS VGHV+R   PY++ +  D  L +N RR+ EVW+DEYK+  Y         D G+I  R+ LR++LKC SF+WYL+NV     D + +K     +     K  CLDS       V L  CHN+GGNQ F  +    LRT   CF
Sbjct:    1 GPGENGEPVETKAEDESKKDAAYSEFG-----FNQFVSDQISLERTISDTRHQACKQRSYPINLPKASVVIVFHNEGWSTLMRTVHTVLLRSPPHMLQEIVMVDDFSNKDFLKQKLDDYTKKLGKIKIVRTKERVGLIKARVIGANNAVGEVVIFLDAHCECNKGWLPPLLERIALNRRTAVCPTIDFIDHKTFQYKPM--DPYIRGTFNWR--FDYKERAVRPEEMAKRRDPTQEVKSPVMAGGLFAINREFFSELGQYDPGMFIWGGEQYEISFKLWQCGGQLENIPCSRVGHVYRHHVPYTYPKH-DATL-VNFRRVAEVWMDEYKDWLYDKRPEIKSVDYGDISDRIALRKRLKCKSFKWYLENV---ANDTVKTKLCACFQVRNQGKNMCLDSMGRKDGHVGLASCHNMGGNQAFQYTYIRELRTDETCF 421          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO37266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG81])

HSP 1 Score: 375.555 bits (963), Expect = 3.226e-122
Identity = 208/490 (42.45%), Postives = 293/490 (59.80%), Query Frame = 3
Query:  828 KAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFL--ENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTF--EASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRESP-VKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRS-RSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDR-YDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGN--CLDS-GNENSRTVKLFPCHNLGGNQLFLISQTG-FLRTINKCFSQ------NKLLLNTCDKDPVESRWKYDDETN-LIYDKQNNCVAINTN-ENVEVQTCSFEVPSIEQKW 2240
            K      ++ H FN+  SDRIS+ R + D R  +CK    L    LPTTS++I FHNEA S LLRT+HS+++ SP  L+ +I+LVDD S ++ LK  L D++  L  VK++R  +R GL+ AR+ GAEE  GEVLTFLD+H E  PGWLEP+L RIAE+ R VVCP+IE IN + F  +AS++       G F W + F W+       +R   E+  ++SP MAGGLF+I + YFY+LG+YD  M+IWG EN+EMS RIWMCGG LEI+PCS VGHVFR   SPY + +     L  N  RL EVW+DEYK+ YY      +R  DIG+I  R+ LR++L C SF+WYL N++P + + L  K         +K +  CLD+ G +N + V L+ CH +GGNQ F ++++   L   +KC         + + + TC        WK++     +++    NC+ I+ + + + V  C     S  Q+W
Sbjct:   16 KEHAAHAFDNHSFNVMLSDRISLDRRLKDVRGPKCKRKHKLYPRALPTTSVIICFHNEALSVLLRTVHSVLNESPPRLIADIILVDDYSEYDDLKQPLIDHISMLNKVKLIRMPSRQGLVPARLRGAEEARGEVLTFLDSHCEATPGWLEPLLVRIAEDRRNVVCPVIEVINADDFRYQASDVIHER---GGFTWDLFFTWKAIPEAEKKRRKDETDYIRSPTMAGGLFAIHKKYFYDLGSYDSKMEIWGGENLEMSFRIWMCGGQLEIVPCSRVGHVFRKYTSPYKFPKGTTTTLARNFNRLAEVWMDEYKDHYYRKKTEEERNVDIGDISDRVALRKRLGCKSFKWYLDNIYPDMTNKLPPKSYLYSHQIRNKESSLCLDTLGEKNIKRVGLYTCHGMGGNQFFTLTKSNEILFNDDKCLDSPNGDPGSYVEMITCHGLKGNQEWKHNKRMGTIVHVWTENCLDISQDGQFIIVNPCD---GSSTQRW 499          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO45830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV8])

HSP 1 Score: 370.548 bits (950), Expect = 1.196e-121
Identity = 191/405 (47.16%), Postives = 260/405 (64.20%), Query Frame = 3
Query:  822 SEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDAS---TFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASN-LGQNTISVGVFDWKMQFNWQFADTINIQRLTRES-PVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGE-SIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDP-LSSKFMGSIESFASKGNCLD--SGNENSRTVKLFPCHNLGGNQ 2009
            SEK   K  +  +QFN  AS ++++ RSIPD R + C  + +   LPT S++I+FHNEAWSTLLRT+HS++ RSP +LL+EIVLVDD S   T+ HL S+L  Y+     V+++R+  R GL++AR+IGA++  GEVL FLD+H E   GWLEP+L RI EN   VV P IE I+  TF  ++  G N  + G+F+W++ F W+       +R   +S P++SP MAGGLF+I ++YFYE+G+YD  M  WG ENVE+S RIWMCGG LEIIPCS VGHVFR   PY  GE +ID+    N  RL EVW+D+YK+++Y++       D G++ GR  LR +L C SF+WYL NV   L  P L     G I +  +   CLD  + NE      ++ CH +G NQ
Sbjct:    1 SEKEIEKERFRLYQFNELASSKVALDRSIPDNRPQSCLSLSYPTKLPTASVIIIFHNEAWSTLLRTVHSVLARSPPYLLREIVLVDDHSRLDTYGHLGSKLESYISQFTKVQLIRAPKREGLIRARLIGAKQAKGEVLVFLDSHCEANLGWLEPLLARIGENRSIVVTPDIEVIDLRTFGYTHEHGAN--NRGIFNWELTFKWRGIPEYERRRRKSDSDPIRSPTMAGGLFAIDKSYFYEIGSYDTEMSFWGGENVEISFRIWMCGGSLEIIPCSKVGHVFRESQPYKIGEGAIDR----NNMRLAEVWMDDYKKIFYAMRPQLKGKDYGDVSGRKALRERLMCKSFKWYLDNVISELAIPDLYPIGRGEIRNLGTN-TCLDTLAKNEAGGEPGMYMCHGMGNNQ 398          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO45829 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV7])

HSP 1 Score: 360.147 bits (923), Expect = 4.058e-116
Identity = 195/472 (41.31%), Postives = 274/472 (58.05%), Query Frame = 3
Query:  774 GEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMK--FLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRE--SPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRS-RSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDP-LSSKFMGSIESFASKGNCLDSGN---ENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNK------LLLNTCDKDPVESRWKYDDETNLI 2144
            G GG+P  +     +E  K   +  +  H FN   SD+IS+ R++ D RS+ CK     +   LPTTS++I FH E  S LLRT+HS+I+R+P  LL E+++VDD S    L   L+D+V     VK++R + R GL++AR+ GA    G+VLTFLD+H E  PGW EP+L RIA + R VVCP IE IN +TF A     N    G F W + F W+       Q+L  +   P+++P MAGGLFSI R YF+++G+YD  M IWG EN+E+S R+WMCGG LEI+ CS VGHVFR   SPY + + +++ LT N  RL EVW+DEYK++YY+        D G+I  R++LR++LKC SF+WY+ N++P +  P L     G + +  S   CLDS     E++  V ++ CH  GGNQ+        +     CF  +K      + L  C        WK+D E   +
Sbjct:    8 GGGGKPAFLE----SEENKKLAEKYFANHSFNWLLSDKISLDRTLDDVRSERCKAKHNTYPAKLPTTSVIICFHKERLSVLLRTVHSVINRTPPELLAEVIVVDDFSQDAKLGKPLDDHVAQFTKVKVLRMKKREGLVRARLQGANTAKGDVLTFLDSHCEATPGWAEPLLARIAADRRNVVCPAIEVINADTF-AYQGSTNADQRGGFSWDLFFKWK-GIPPEEQKLRNDDSDPIRTPTMAGGLFSIHRQYFFDIGSYDEEMDIWGGENLELSFRVWMCGGRLEIVTCSRVGHVFRKYTSPYKFPDGVERTLTKNFNRLAEVWMDEYKDLYYNKKPQAKNSDYGDISKRLELRKRLKCKSFKWYINNIYPDVQMPELDPPARGEVRN-PSSNQCLDSLGAKPEHNARVGIYTCHGQGGNQVSKYMPRELIFEEENCFDVSKTHPGAPVELMKCHGMRGNQEWKHDREKGTL 472          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 435.647 bits (1119), Expect = 3.384e-144
Identity = 227/505 (44.95%), Postives = 315/505 (62.38%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDDE-TNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKSF 2255
             PGE G+   I KD+     + + K  ++ +QFNL ASD I++ RS+PD R   CK   + ++LPTTSIVIVFHNEAWSTLLRT+HS+I RSP HLL EIVLVDDAS  + LK +L  YV+ L++ VKI+R E R GL++AR+ GA  T+G+V+TFLDAH EC  GWLEP+L RI E+   VVCPII+ I+D TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI + YF E+G+YDPGM IWG EN+EMS RIW CGG LEI+ CSHVGHVFR  +PYS+     +++  N RRL EVW+DE+K+ +Y ++    R D G++  R  LR  LKC  F WYL+N++P    P     +G I +  +   C+D+ G + +  V  F CH +GGNQ+F  +    +RT + C   ++L    ++  C        ++YD E   L++   N C+ + + E+  V T      S  Q+W L++ 
Sbjct:   56 GPGEMGKAVNIAKDD-----QEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTLEVPVKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVMRVDYGDVSSRKALREALKCKPFAWYLENIYPDSQIPRRYYSLGEIRNVETN-QCVDNMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTDDLCLDVSRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRSQQWLLRNM 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 435.647 bits (1119), Expect = 3.384e-144
Identity = 227/505 (44.95%), Postives = 315/505 (62.38%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDDE-TNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKSF 2255
             PGE G+   I KD+     + + K  ++ +QFNL ASD I++ RS+PD R   CK   + ++LPTTSIVIVFHNEAWSTLLRT+HS+I RSP HLL EIVLVDDAS  + LK +L  YV+ L++ VKI+R E R GL++AR+ GA  T+G+V+TFLDAH EC  GWLEP+L RI E+   VVCPII+ I+D TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI + YF E+G+YDPGM IWG EN+EMS RIW CGG LEI+ CSHVGHVFR  +PYS+     +++  N RRL EVW+DE+K+ +Y ++    R D G++  R  LR  LKC  F WYL+N++P    P     +G I +  +   C+D+ G + +  V  F CH +GGNQ+F  +    +RT + C   ++L    ++  C        ++YD E   L++   N C+ + + E+  V T      S  Q+W L++ 
Sbjct:   56 GPGEMGKAVNIAKDD-----QEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTLEVPVKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVMRVDYGDVSSRKALREALKCKPFAWYLENIYPDSQIPRRYYSLGEIRNVETN-QCVDNMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTDDLCLDVSRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRSQQWLLRNM 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 435.647 bits (1119), Expect = 3.384e-144
Identity = 227/505 (44.95%), Postives = 315/505 (62.38%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDDE-TNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKSF 2255
             PGE G+   I KD+     + + K  ++ +QFNL ASD I++ RS+PD R   CK   + ++LPTTSIVIVFHNEAWSTLLRT+HS+I RSP HLL EIVLVDDAS  + LK +L  YV+ L++ VKI+R E R GL++AR+ GA  T+G+V+TFLDAH EC  GWLEP+L RI E+   VVCPII+ I+D TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI + YF E+G+YDPGM IWG EN+EMS RIW CGG LEI+ CSHVGHVFR  +PYS+     +++  N RRL EVW+DE+K+ +Y ++    R D G++  R  LR  LKC  F WYL+N++P    P     +G I +  +   C+D+ G + +  V  F CH +GGNQ+F  +    +RT + C   ++L    ++  C        ++YD E   L++   N C+ + + E+  V T      S  Q+W L++ 
Sbjct:   56 GPGEMGKAVNIAKDD-----QEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTLEVPVKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVMRVDYGDVSSRKALREALKCKPFAWYLENIYPDSQIPRRYYSLGEIRNVETN-QCVDNMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTDDLCLDVSRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRSQQWLLRNM 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 435.647 bits (1119), Expect = 3.384e-144
Identity = 227/505 (44.95%), Postives = 315/505 (62.38%), Query Frame = 3
Query:  768 APGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDDE-TNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKSF 2255
             PGE G+   I KD+     + + K  ++ +QFNL ASD I++ RS+PD R   CK   + ++LPTTSIVIVFHNEAWSTLLRT+HS+I RSP HLL EIVLVDDAS  + LK +L  YV+ L++ VKI+R E R GL++AR+ GA  T+G+V+TFLDAH EC  GWLEP+L RI E+   VVCPII+ I+D TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI + YF E+G+YDPGM IWG EN+EMS RIW CGG LEI+ CSHVGHVFR  +PYS+     +++  N RRL EVW+DE+K+ +Y ++    R D G++  R  LR  LKC  F WYL+N++P    P     +G I +  +   C+D+ G + +  V  F CH +GGNQ+F  +    +RT + C   ++L    ++  C        ++YD E   L++   N C+ + + E+  V T      S  Q+W L++ 
Sbjct:   56 GPGEMGKAVNIAKDD-----QEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTLEVPVKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVMRVDYGDVSSRKALREALKCKPFAWYLENIYPDSQIPRRYYSLGEIRNVETN-QCVDNMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTDDLCLDVSRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRSQQWLLRNM 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:101166578])

HSP 1 Score: 432.565 bits (1111), Expect = 4.323e-143
Identity = 224/505 (44.36%), Postives = 320/505 (63.37%), Query Frame = 3
Query:  765 NAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKI-VKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLT--RESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS-GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKL----LLNTCDKDPVESRWKYDD-ETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKS 2252
            + PGEGG+P  I K+      + + K  ++ +QFNL AS+ I++ RS+PD R + CK   + ++LP TS+VIVFHNEAWSTLLRT+HS+IDRSP  LL+EIVLVDDAS  + LK +L  YV+ L++ V++VR E R GL++AR+ GA  ++G+V+TFLDAH EC  GWLEP+L RI ++ RTVVCPII+ I+D+TFE   +  + ++ G F+WK+ F W       + R    R  PV++P MAGGLFSI R YF E+GTYD GM IWG EN+E+S RIW CGG LEI+ CSHVGHVFR  +PY++     +I+  N RRL EVW+DE+K  +Y ++    + D G+I  R  LR+KL+C  F WYL+N++P    P     +G I +  +   CLD+   + +  V +F CH +GGNQ+F  +    +RT + C   +KL    ++  C        W+YD  +  L++   N C+   + E+        +VPS+    H++S
Sbjct:   54 DGPGEGGKPVVIPKEN-----QEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKNKLYPDDLPRTSVVIVFHNEAWSTLLRTVHSVIDRSPRSLLEEIVLVDDASERDFLKRQLEQYVRRLEVPVRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTLGWLEPLLTRIKQDKRTVVCPIIDVISDDTFEY--MAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTIPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQKLQCKPFSWYLENIYPDSQIPRHYYSLGEIRNVETN-QCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVMMLKCHHLKGNQLWEYDPVKLTLVHVNSNQCLDKASEEDS-------QVPSVRDCTHVRS 543          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000076075.1 (SMESG000076075.1)

HSP 1 Score: 1447.18 bits (3745), Expect = 0.000e+0
Identity = 708/712 (99.44%), Postives = 709/712 (99.58%), Query Frame = 3
Query:  162 MKSXXXXXXXXNSTTGVLFLVVCWMVTFIIFIGFSELENTESRFKDLFIPETFQNSIKNFDSPANKNRVEPTKLLNLLRKHFEKFNSEDFNKIKEIVPDNKQIESSLQNDFQKIYPKPPEVLDLPEQKNDSNGLTTKETSKTIFKNKLADQENVTLSRNSLQQTVENATERTISEEEVKIKNSSFKIEENEFTIYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDSGNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKLLLNTCDKDPVESRWKYDDETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKSFVTFKLPYDGSQDDQ 2297
            MKSL KFFKLLNSTTGVLFLVVCWMVTFIIFIGFSELE+TESRFKDLFIPETFQNSIKNFDSPANKNRVEPTKLLNLLRKHFEKFNSEDFNKIKEIVPDNKQIESSLQNDFQKIYPKPPEVLDLPEQKNDSNGLTTKETSKTIFKNKL DQENVTLSRNSLQQTVENATER ISEEEVKIKNSSFKIEENEFTIYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDSGNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKLLLNTCDKDPVESRWKYDDETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKSFVTFKLPYDGSQDDQ
Sbjct:    1 MKSLLKFFKLLNSTTGVLFLVVCWMVTFIIFIGFSELEDTESRFKDLFIPETFQNSIKNFDSPANKNRVEPTKLLNLLRKHFEKFNSEDFNKIKEIVPDNKQIESSLQNDFQKIYPKPPEVLDLPEQKNDSNGLTTKETSKTIFKNKLVDQENVTLSRNSLQQTVENATERIISEEEVKIKNSSFKIEENEFTIYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDSGNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKLLLNTCDKDPVESRWKYDDETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKSFVTFKLPYDGSQDDQ 712          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000076075.1 (SMESG000076075.1)

HSP 1 Score: 1416.36 bits (3665), Expect = 0.000e+0
Identity = 685/688 (99.56%), Postives = 686/688 (99.71%), Query Frame = 3
Query:  234 MVTFIIFIGFSELENTESRFKDLFIPETFQNSIKNFDSPANKNRVEPTKLLNLLRKHFEKFNSEDFNKIKEIVPDNKQIESSLQNDFQKIYPKPPEVLDLPEQKNDSNGLTTKETSKTIFKNKLADQENVTLSRNSLQQTVENATERTISEEEVKIKNSSFKIEENEFTIYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDSGNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKLLLNTCDKDPVESRWKYDDETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKSFVTFKLPYDGSQDDQ 2297
            MVTFIIFIGFSELE+TESRFKDLFIPETFQNSIKNFDSPANKNRVEPTKLLNLLRKHFEKFNSEDFNKIKEIVPDNKQIESSLQNDFQKIYPKPPEVLDLPEQKNDSNGLTTKETSKTIFKNKL DQENVTLSRNSLQQTVENATER ISEEEVKIKNSSFKIEENEFTIYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDSGNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKLLLNTCDKDPVESRWKYDDETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKSFVTFKLPYDGSQDDQ
Sbjct:    1 MVTFIIFIGFSELEDTESRFKDLFIPETFQNSIKNFDSPANKNRVEPTKLLNLLRKHFEKFNSEDFNKIKEIVPDNKQIESSLQNDFQKIYPKPPEVLDLPEQKNDSNGLTTKETSKTIFKNKLVDQENVTLSRNSLQQTVENATERIISEEEVKIKNSSFKIEENEFTIYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTINIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDSGNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKLLLNTCDKDPVESRWKYDDETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKSFVTFKLPYDGSQDDQ 688          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000081451.1 (SMESG000081451.1)

HSP 1 Score: 466.077 bits (1198), Expect = 9.089e-156
Identity = 234/501 (46.71%), Postives = 319/501 (63.67%), Query Frame = 3
Query:  771 PGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQ-FADTINIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDS---GNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKC--FSQNKLLLNTCDKDPVESRWKYDDETNLIYDKQNNCVAI-NTNENVEVQTCSFEVPSIEQKWHLKS 2252
            PGE G+P  I+   LT+ EK ++  GW+ + FN YAS+ IS+ R +PD R +ECK  K+   LP TS+++ FHNEAWS LLR++HSII+RSP HLLKE++LVDD S+ EHLKS L +Y+  LKIVKIVR+  R GL++AR++GA   SGEVLTFLD+HIEC  GWLEP+L+ IA++ + V  P+I+ I+D+T +  +     + VG F W + FNW    D   I R   + PV +P MAGGLFSI + YF  LG YDPG  IWG EN+E+S +IWMCGGI+ IIPCS VGH+FR RSPYSW   ++ +L +N  RL EVWLDEYKE YY +  N D  D GNI  R+ LR+ L+C  F+WYL N++P L+ P  +   G I +   K  C+D    G++ +  +  +PCHN GGNQ +++S+TG +R    C  F   +L    C        WKY +   +     N C+ +   ++ + +  CS    S+ QKW   S
Sbjct:   87 PGEDGKPVVIDVKNLTKEEKEKFDLGWKNNAFNEYASNLISIHRHLPDMRDEECKNYKYATKLPETSVILCFHNEAWSVLLRSVHSIINRSPKHLLKEVILVDDFSSMEHLKSPLEEYISQLKIVKIVRATKREGLIRARLLGASAASGEVLTFLDSHIECTEGWLEPLLDPIAQSWKNVTVPVIDVISDDTLQYMHSSAKQVQVGGFSWNLIFNWHVIPDRDKIGRKPTD-PVNTPTMAGGLFSISKKYFDHLGGYDPGFDIWGGENLELSFKIWMCGGIMRIIPCSSVGHIFRKRSPYSWKPKVN-VLKVNLVRLAEVWLDEYKEFYY-MRINHDLGDYGNISERVALRKNLQCKPFKWYLDNIYPDLFVPSDALNSGEIRNMV-KPMCVDGNIDGHDQTVPIISYPCHNQGGNQFWMLSKTGEIRRDLSCLDFDGKQLTGYPCHGALGNQFWKYMESKQIRQMNHNLCIELAEKDDKLIMAPCS---NSLRQKWLFPS 580          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000025206.1 (SMESG000025206.1)

HSP 1 Score: 456.062 bits (1172), Expect = 2.165e-151
Identity = 227/500 (45.40%), Postives = 313/500 (62.60%), Query Frame = 3
Query:  765 NAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQ-FADTINIQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDSGNENSRT----VKLFPCHNLGGNQLFLISQTGFLRTINKCFSQN---KLLLNTCDKDPVESRWKYDDETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKW 2240
            N PGE GR  +I++  L+  EK +Y  GW+ H +N YAS+ ISVRR +PD R K C   K+L+ LP TS+++ FHNEAWS LLR++HSI+DRSP  L++EI+LVDD ST +HL   L +YV  LK VKI+R++ R GL++AR+IG     GEVLTFLD+HIEC  GWLEP+L+RIA N   V  P+I+ I+D T        + + VG FDW +QFNW    +  N +R  +  PV SP MAGGLFSI + YF  LGTYD G  IWG EN+E+S +IWMCGG LEIIPCSHVGH+FR RSPYSWG     +L  N  RL EVWLD+YK+ YY+   N D  + G++  R KLR+KL C +F+WYL NV+P L+ P  S   G + +  + G CLD+  ++  +    V ++PCH  GGNQ +++S+ G +R    C   N    +++  C        W +     + ++    C+ ++   +  + +   ++    QKW
Sbjct:  115 NGPGEMGRDVKIDEKLLSSQEKEKYDKGWKDHAYNEYASNMISVRRKLPDYRHKLCLTYKYLKPLPRTSVILCFHNEAWSALLRSVHSILDRSPPELIEEIILVDDKSTMKHLFEPLENYVSQLKKVKIIRTKKREGLIRARLIGGSIAKGEVLTFLDSHIECTQGWLEPLLDRIARNWSNVPVPVIDIIDDTTLALHVAEADDVQVGGFDWNLQFNWHVIPERENARREKKTDPVSSPTMAGGLFSISKKYFEYLGTYDSGFDIWGGENLEISFKIWMCGGKLEIIPCSHVGHIFRKRSPYSWGSG--NVLRKNSIRLAEVWLDDYKKYYYTRF-NFDLGNFGDVSERKKLRQKLNCTTFKWYLDNVYPELFVPSESLRSGEVRNPVT-GMCLDASIDSKESGPNKVIMYPCHKQGGNQYWMLSKGGEIRRDEGCMDYNGVESVIIYPCHGSKGNQHWSFTHLNQIRHELHGQCMEVSPGGDKLLMSVCTDID--RQKW 608          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000081429.1 (SMESG000081429.1)

HSP 1 Score: 446.047 bits (1146), Expect = 7.132e-148
Identity = 239/594 (40.24%), Postives = 355/594 (59.76%), Query Frame = 3
Query:  456 DNKQIESSLQNDFQK-----IYPKPPEVLDLPEQKNDSNGLTTKETSKTIFKNKLADQENVTLSRNSLQQTVENATERTISEEEVKIKNSSFKIEENEFTIYPRLNDPNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIPDQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLKEIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEETSGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASNLGQNTISVGVFDWKMQFNWQFADTIN-IQRLTRESPVKSPAMAGGLFSIMRTYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRSPYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRMKLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDSGNENSRTVKLFPCHNLGGNQLFLISQTGFLRTINKC--FSQNKLLLNTCDKDPVESRWKYDDETNLIYDKQNNCVAIN-TNENVEVQTCS 2210
            +N Q E+  ++DF+      IYP+  E+    E K   N L   + S+ +  ++   Q         +  T+ N  +     ++  I    FK   N   +          GE G    +N+  ++ S+ + Y  GW+ + FN + S++IS+ R++PD R K+C   K+ +NLP TS++I FHNEAWS LLR++HSII RSP +LLKEI+LVDD S  +HLKS+L +Y+  LKIVKIVR+  R GL++AR+IG+   +GE+LTFLD+HIEC PGWLEP+L+ IA+N   V  P+I++I+ +TFE ++     I VG F W + F W +  T + + RL  + PV SP MAGGLFSI + YF  LG YDPG  IWG EN+E+S +IWMCGG L I+PCS VGH+FR +SPYS   S    L  N  RL EVWLD+YK+ YYS     +R +IG++  R+ LR+ L CH+F+WY+ N++P ++ P  +   G I++ A+   C+++ +  S  +  +PCH LGGNQ +L+S++G +R    C  F  + L+   C  +     WKY +   +     N C+ +N T + + +  C+
Sbjct:    9 ENFQRENQAEDDFKNSEKTYIYPRRDEIKLSDEDKRIENNLIKFDESRAVISSETLIQ---------VSSTIYNKNKEKNENDDNFIAVPDFKKNINNKML----------GENGIAEYVNETNISPSDLSRYNEGWKNYCFNEFLSNKISITRNLPDFREKQCFSYKYSDNLPQTSVIICFHNEAWSVLLRSVHSIISRSPKNLLKEIILVDDFSHLDHLKSQLEEYMAQLKIVKIVRTTQREGLIRARMIGSRTATGEILTFLDSHIECTPGWLEPLLDPIAQNWSNVTIPVIDNIDKSTFEFAHQSSEYIQVGGFTWDLVFTWHYIPTRDKVGRLPTD-PVNSPTMAGGLFSISKKYFEYLGEYDPGFDIWGGENLEISFKIWMCGGTLRIVPCSVVGHIFRMKSPYS-STSKKDFLKNNLVRLAEVWLDDYKQFYYSRI-KFNRSEIGDLSDRINLRKNLNCHNFKWYIDNIYPDMFIPSDAVNKGEIKNLATNI-CIEAKSYESNPILPYPCHGLGGNQYWLMSKSGEIRHDYMCIDFDGSHLISFGCHGNLGNQFWKYTESKQIKQMNHNLCLELNETGDGLGLSPCT 579          
The following BLAST results are available for this feature:
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNT15.344e-14244.64polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
GALNT132.059e-14043.81polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
GALNT61.390e-13947.31polypeptide N-acetylgalactosaminyltransferase 6 [S... [more]
GALNT61.390e-13947.31polypeptide N-acetylgalactosaminyltransferase 6 [S... [more]
GALNT132.810e-13944.16polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gly-52.691e-15244.72Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
gly-52.691e-15244.72Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
gly-52.691e-15244.72Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
gly-57.379e-15144.51Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
gly-57.379e-15144.51Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pgant93.881e-15244.11gene:FBgn0050463 transcript:FBtr0087112[more]
Pgant93.881e-15244.11gene:FBgn0050463 transcript:FBtr0113380[more]
Pgant92.909e-15144.27gene:FBgn0050463 transcript:FBtr0087113[more]
Pgant92.909e-15144.27gene:FBgn0050463 transcript:FBtr0113379[more]
Pgant59.847e-14445.45gene:FBgn0031681 transcript:FBtr0079026[more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galnt19.473e-14343.76UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt19.473e-14343.76UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt131.554e-14244.95UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt131.935e-14048.64UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
GALNT36.241e-14049.77UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galnt16.225e-14444.71polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt13.133e-14344.64polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt13.195e-14344.64polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt13.366e-14344.64polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt13.834e-14344.64polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Galnt15.727e-14444.84polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
Galnt15.727e-14444.84polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
Galnt15.727e-14444.84polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
Galnt69.448e-14348.35polypeptide N-acetylgalactosaminyltransferase 6 [S... [more]
Galnt69.448e-14348.35polypeptide N-acetylgalactosaminyltransferase 6 [S... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8MRC9|GALT9_DROME3.890e-15144.11Putative polypeptide N-acetylgalactosaminyltransfe... [more]
sp|Q95ZJ1|GALT5_CAEEL6.485e-14944.23Polypeptide N-acetylgalactosaminyltransferase 5 OS... [more]
sp|O08912|GALT1_MOUSE4.006e-14344.84Polypeptide N-acetylgalactosaminyltransferase 1 OS... [more]
sp|Q6WV17|GALT5_DROME9.871e-14345.45Polypeptide N-acetylgalactosaminyltransferase 5 OS... [more]
sp|Q29121|GALT1_PIG3.056e-14244.64Polypeptide N-acetylgalactosaminyltransferase 1 OS... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A433TY644.179e-16247.36Polypeptide N-acetylgalactosaminyltransferase OS=E... [more]
A0A210QQN15.869e-16044.96Polypeptide N-acetylgalactosaminyltransferase OS=M... [more]
A0A2R5LF216.358e-16046.24Polypeptide N-acetylgalactosaminyltransferase OS=O... [more]
A0A2T7PAH96.668e-16046.14Polypeptide N-acetylgalactosaminyltransferase OS=P... [more]
A0A1W0WTK63.773e-15946.78Polypeptide N-acetylgalactosaminyltransferase OS=H... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galnt134.908e-14444.95polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt13.397e-14343.66polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt138.513e-14144.03polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt132.475e-13749.18polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
GALNT32.791e-13650.34polypeptide N-acetylgalactosaminyltransferase 3 [S... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008097.14.117e-13847.44pep scaffold:Pmarinus_7.0:GL476358:506472:520895:1... [more]
poc1bl8.770e-13141.22POC1 centriolar protein homolog B (Chlamydomonas),... [more]
ENSPMAT00000000477.11.778e-12743.30pep scaffold:Pmarinus_7.0:GL501308:12705:54064:-1 ... [more]
galnt122.733e-12446.40UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt26.992e-10743.41UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO438612.227e-12646.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310357.907e-12545.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372663.226e-12242.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458301.196e-12147.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458294.058e-11641.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galnt133.384e-14444.95polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt133.384e-14444.95polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt133.384e-14444.95polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt133.384e-14444.95polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt14.323e-14344.36polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076075.10.000e+099.44SMESG000076075.1[more]
SMESG000076075.10.000e+099.56SMESG000076075.1[more]
SMESG000081451.19.089e-15646.71SMESG000081451.1[more]
SMESG000025206.12.165e-15145.40SMESG000025206.1[more]
SMESG000081429.17.132e-14840.24SMESG000081429.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004761 ID=SMED30004761|Name=Polypeptide N-acetylgalactosaminyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=2312bp
TCAAAGTAAGTCAAGAGTGAAAGTATTGATCTTAGTTTAAACAAACAATT
ATGTAAACTGAGTAATAAGAATTTAACCACGTCCTTGTTTATAAAATGCC
ATATGTTACCAATCATTAAATTTGGTTTTAATTTCTTTTTATTTTATTTG
AATTCCCTATAATGAAATCTCTCAAAAAATTCTTCAAGTTGTTGAACTCA
ACCACCGGTGTTTTATTCCTCGTGGTCTGTTGGATGGTTACATTTATCAT
CTTTATTGGGTTCTCCGAGCTCGAAAATACTGAAAGTCGGTTTAAAGACC
TTTTCATTCCGGAAACATTTCAAAATTCAATTAAAAATTTTGATTCACCA
GCCAACAAAAATCGAGTTGAACCGACGAAGCTTTTGAATTTATTAAGGAA
ACATTTTGAAAAATTTAATTCTGAAGATTTTAATAAAATAAAAGAAATTG
TTCCTGACAACAAACAAATCGAGTCCAGTTTACAAAATGATTTCCAAAAA
ATTTATCCAAAACCACCAGAAGTCTTAGATTTGCCAGAGCAGAAAAATGA
TTCAAATGGGCTAACCACAAAAGAAACCTCAAAAACAATTTTTAAAAACA
AATTAGCTGATCAAGAAAATGTTACTCTTTCCAGAAACAGTCTTCAACAA
ACAGTTGAAAATGCGACGGAAAGAACAATTTCGGAGGAAGAAGTGAAAAT
TAAAAATAGTTCATTCAAAATTGAGGAAAATGAATTTACAATTTATCCAA
GATTAAACGACCCAAATGCTCCAGGAGAAGGAGGACGACCATTTAGAATC
AATAAAGATGAACTAACAGAATCAGAAAAAGCTGAATATAAAAGTGGATG
GGAAAAACACCAATTTAATTTATACGCTAGTGATAGAATAAGCGTTCGAA
GATCCATTCCTGATCAAAGATCAAAAGAATGTAAAGAGATGAAATTCCTT
GAAAACCTACCCACAACAAGTATTGTAATCGTCTTTCATAATGAAGCTTG
GTCAACGCTTCTTAGAACGATCCATTCGATAATTGATAGGTCACCAGGTC
ATTTACTTAAAGAGATTGTACTTGTTGACGATGCATCCACATTCGAACAC
CTAAAGTCCAGATTAAATGATTATGTGAAACCATTGAAAATCGTAAAGAT
TGTCAGATCAGAGACCCGAGTTGGATTAATGAAAGCACGAATAATTGGAG
CTGAAGAAACCTCAGGCGAAGTGTTGACATTTTTAGATGCACATATAGAA
TGCTACCCAGGTTGGTTGGAACCAATGTTAGAAAGAATTGCAGAAAACAA
TAGAACAGTCGTTTGTCCGATTATTGAAAGTATTAACGACAATACATTTG
AAGCTTCAAATTTAGGACAGAACACGATATCAGTTGGAGTATTTGATTGG
AAGATGCAATTTAATTGGCAGTTTGCAGACACAATTAATATACAGCGTTT
GACTCGAGAAAGTCCTGTCAAATCCCCAGCAATGGCTGGAGGTTTATTCA
GTATAATGAGAACATACTTTTACGAACTTGGTACCTATGATCCAGGAATG
AAGATTTGGGGATCAGAAAATGTTGAAATGTCACTAAGAATATGGATGTG
CGGAGGCATTCTAGAAATTATACCTTGCTCACATGTTGGACATGTTTTCC
GAAGTCGTTCTCCATACAGTTGGGGAGAAAGCATTGATAAAATATTAACA
ATAAATCAAAGGCGTTTAGTTGAAGTATGGCTTGATGAGTATAAGGAAGT
TTATTACTCATTGACAGGAAATAGAGATCGATATGATATCGGAAACATTC
AAGGTCGAATGAAGCTGAGAAGGAAGTTAAAATGCCACTCTTTTCAGTGG
TATTTGAAAAATGTTTTCCCAAGTTTATACGATCCACTCAGCAGTAAATT
CATGGGCAGCATTGAAAGTTTTGCTAGTAAAGGCAATTGTTTAGATAGTG
GAAATGAAAATTCAAGAACGGTAAAGCTGTTTCCGTGTCACAATCTCGGA
GGAAATCAGTTATTCCTGATATCTCAAACCGGTTTCCTTCGAACTATTAA
TAAATGCTTTTCACAAAATAAACTGCTATTGAATACCTGTGACAAGGATC
CAGTTGAATCTAGGTGGAAATATGATGACGAGACTAATTTGATATACGAT
AAACAGAACAACTGCGTCGCTATTAACACCAACGAGAACGTTGAAGTCCA
AACCTGCTCATTTGAGGTGCCAAGCATTGAACAAAAATGGCATTTAAAAT
CATTTGTCACATTCAAATTACCTTATGACGGTAGCCAGGATGACCAATAA
AGCAGTTACTTG
back to top

protein sequence of SMED30004761-orf-1

>SMED30004761-orf-1 ID=SMED30004761-orf-1|Name=SMED30004761-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=713bp
MKSLKKFFKLLNSTTGVLFLVVCWMVTFIIFIGFSELENTESRFKDLFIP
ETFQNSIKNFDSPANKNRVEPTKLLNLLRKHFEKFNSEDFNKIKEIVPDN
KQIESSLQNDFQKIYPKPPEVLDLPEQKNDSNGLTTKETSKTIFKNKLAD
QENVTLSRNSLQQTVENATERTISEEEVKIKNSSFKIEENEFTIYPRLND
PNAPGEGGRPFRINKDELTESEKAEYKSGWEKHQFNLYASDRISVRRSIP
DQRSKECKEMKFLENLPTTSIVIVFHNEAWSTLLRTIHSIIDRSPGHLLK
EIVLVDDASTFEHLKSRLNDYVKPLKIVKIVRSETRVGLMKARIIGAEET
SGEVLTFLDAHIECYPGWLEPMLERIAENNRTVVCPIIESINDNTFEASN
LGQNTISVGVFDWKMQFNWQFADTINIQRLTRESPVKSPAMAGGLFSIMR
TYFYELGTYDPGMKIWGSENVEMSLRIWMCGGILEIIPCSHVGHVFRSRS
PYSWGESIDKILTINQRRLVEVWLDEYKEVYYSLTGNRDRYDIGNIQGRM
KLRRKLKCHSFQWYLKNVFPSLYDPLSSKFMGSIESFASKGNCLDSGNEN
SRTVKLFPCHNLGGNQLFLISQTGFLRTINKCFSQNKLLLNTCDKDPVES
RWKYDDETNLIYDKQNNCVAINTNENVEVQTCSFEVPSIEQKWHLKSFVT
FKLPYDGSQDDQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR035992Ricin_B-like_lectins
IPR000772Ricin_B_lectin
IPR029044Nucleotide-diphossugar_trans
IPR001173Glyco_trans_2-like
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006486protein glycosylation
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
GO:0030246carbohydrate binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 158..178
NoneNo IPR availableGENE3DG3DSA:2.80.10.50coord: 578..701
e-value: 8.2E-19
score: 69.9
NoneNo IPR availablePANTHERPTHR11675N-ACETYLGALACTOSAMINYLTRANSFERASEcoord: 122..698
NoneNo IPR availablePANTHERPTHR11675:SF43POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 1coord: 122..698
NoneNo IPR availableCDDcd02510pp-GalNAc-Tcoord: 270..569
e-value: 1.56441E-155
score: 450.118
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
IPR000772Ricin B, lectin domainSMARTSM00458ricin_3coord: 582..696
e-value: 1.8E-8
score: 44.1
IPR000772Ricin B, lectin domainPFAMPF00652Ricin_B_lectincoord: 582..685
e-value: 3.1E-12
score: 46.8
IPR000772Ricin B, lectin domainPROSITEPS50231RICIN_B_LECTINcoord: 580..696
score: 15.517
IPR000772Ricin B, lectin domainCDDcd00161RICINcoord: 582..695
e-value: 3.16668E-12
score: 62.1378
IPR029044Nucleotide-diphospho-sugar transferasesGENE3DG3DSA:3.90.550.10coord: 186..577
e-value: 6.5E-158
score: 527.5
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILYSSF53448Nucleotide-diphospho-sugar transferasescoord: 247..570
IPR001173Glycosyltransferase 2-likePFAMPF00535Glycos_transf_2coord: 270..452
e-value: 5.4E-33
score: 114.2
IPR035992Ricin B-like lectinsSUPERFAMILYSSF50370Ricin B-like lectinscoord: 581..696