RNA-binding protein 8A

Overview
NameRNA-binding protein 8A
Smed IDSMED30004754
Length (bp)622
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RNA-binding protein 8A (SMED30004754) t-SNE clustered cells

Violin plots show distribution of expression levels for RNA-binding protein 8A (SMED30004754) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RNA-binding protein 8A (SMED30004754) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RNA-binding protein 8A (SMED30004754) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004754

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30004754SMESG000051885.1 SmedASXL_003100SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30004754SMESG000051885.1 dd_Smed_v4_1169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004754SMESG000051885.1 dd_Smed_v4_1169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30004754SMESG000051885.1 dd_Smed_v4_1169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004754SMESG000051885.1 dd_Smed_v4_1169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004754SMESG000051885.1 dd_Smed_v4_1169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004754SMESG000051885.1 dd_Smed_v4_1169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004754SMESG000051885.1 dd_Smed_v4_1169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004754SMESG000051885.1 dd_Smed_v4_1169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004754SMESG000051885.1 dd_Smed_v4_1169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004754SMESG000051885.1 dd_Smed_v4_1169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004754SMESG000051885.1 dd_Smed_v6_1169_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RNA-binding protein 8A vs. Ensembl Human
Match: RBM8A (RNA binding motif protein 8A [Source:HGNC Symbol;Acc:HGNC:9905])

HSP 1 Score: 157.532 bits (397), Expect = 2.058e-48
Identity = 80/147 (54.42%), Postives = 106/147 (72.11%), Query Frame = 3
Query:   45 FQMADAEKEETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFV 485
              + +A  E+  MD DGDE I +LKE  K RKGRGF SE+      + +  S   D   PGPQRSVEGWI+F+  +HEEATEED+ DKF+E+GEIKN+H+N DRRTGY+KGY L+EYET+ EAQ A++ +NG ++ G+ ++VDW FV
Sbjct:    5 LDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFV 151          
BLAST of RNA-binding protein 8A vs. Ensembl Human
Match: RBM8A (RNA binding motif protein 8A [Source:HGNC Symbol;Acc:HGNC:9905])

HSP 1 Score: 157.532 bits (397), Expect = 2.058e-48
Identity = 80/147 (54.42%), Postives = 106/147 (72.11%), Query Frame = 3
Query:   45 FQMADAEKEETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFV 485
              + +A  E+  MD DGDE I +LKE  K RKGRGF SE+      + +  S   D   PGPQRSVEGWI+F+  +HEEATEED+ DKF+E+GEIKN+H+N DRRTGY+KGY L+EYET+ EAQ A++ +NG ++ G+ ++VDW FV
Sbjct:    5 LDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFV 151          
BLAST of RNA-binding protein 8A vs. Ensembl Human
Match: RBM8A (RNA binding motif protein 8A [Source:HGNC Symbol;Acc:HGNC:9905])

HSP 1 Score: 155.992 bits (393), Expect = 7.859e-48
Identity = 80/148 (54.05%), Postives = 109/148 (73.65%), Query Frame = 3
Query:   45 FQMADAEKEETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTK-FEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFV 485
              + +A  E+  MD DGDE I +LKE  K RKGRGF SE    R  + ++++  + D   PGPQRSVEGWI+F+  +HEEATEED+ DKF+E+GEIKN+H+N DRRTGY+KGY L+EYET+ EAQ A++ +NG ++ G+ ++VDW FV
Sbjct:    5 LDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEGSRARMREDYDSVEQDGDE--PGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFV 150          
BLAST of RNA-binding protein 8A vs. Ensembl Human
Match: RBM8A (RNA binding motif protein 8A [Source:HGNC Symbol;Acc:HGNC:9905])

HSP 1 Score: 125.946 bits (315), Expect = 6.387e-37
Identity = 51/82 (62.20%), Postives = 70/82 (85.37%), Query Frame = 3
Query:  240 VEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFV 485
            VEGWI+F+  +HEEATEED+ DKF+E+GEIKN+H+N DRRTGY+KGY L+EYET+ EAQ A++ +NG ++ G+ ++VDW FV
Sbjct:    2 VEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFV 83          
BLAST of RNA-binding protein 8A vs. Ensembl Human
Match: RBM8A (RNA binding motif protein 8A [Source:HGNC Symbol;Acc:HGNC:9905])

HSP 1 Score: 125.946 bits (315), Expect = 6.387e-37
Identity = 51/82 (62.20%), Postives = 70/82 (85.37%), Query Frame = 3
Query:  240 VEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFV 485
            VEGWI+F+  +HEEATEED+ DKF+E+GEIKN+H+N DRRTGY+KGY L+EYET+ EAQ A++ +NG ++ G+ ++VDW FV
Sbjct:    2 VEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFV 83          
BLAST of RNA-binding protein 8A vs. Ensembl Celegans
Match: rnp-4 (RNA-binding protein 8A [Source:UniProtKB/TrEMBL;Acc:Q21832])

HSP 1 Score: 143.28 bits (360), Expect = 1.220e-43
Identity = 64/123 (52.03%), Postives = 86/123 (69.92%), Query Frame = 3
Query:  123 NVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKG 491
            N +  +GRG    +  +R T ++ + +    T   PQRSVEGWI+F+ NIHEEATE+DV DKFSE+G+IKN+H+N DRRTG++KGY L+EYET  EA  A+   N  ++ G+ V VDW FVKG
Sbjct:   14 NAERSRGRGLAQSRNRERIT-YDVVDEESSATSGAPQRSVEGWIVFVTNIHEEATEDDVHDKFSEYGKIKNIHLNLDRRTGFLKGYALVEYETQKEANEAIDQSNDTDLLGQNVKVDWCFVKG 135          
BLAST of RNA-binding protein 8A vs. Ensembl Celegans
Match: rnp-4 (RNA-binding protein 8A [Source:UniProtKB/TrEMBL;Acc:Q21832])

HSP 1 Score: 143.28 bits (360), Expect = 1.220e-43
Identity = 64/123 (52.03%), Postives = 86/123 (69.92%), Query Frame = 3
Query:  123 NVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKG 491
            N +  +GRG    +  +R T ++ + +    T   PQRSVEGWI+F+ NIHEEATE+DV DKFSE+G+IKN+H+N DRRTG++KGY L+EYET  EA  A+   N  ++ G+ V VDW FVKG
Sbjct:   14 NAERSRGRGLAQSRNRERIT-YDVVDEESSATSGAPQRSVEGWIVFVTNIHEEATEDDVHDKFSEYGKIKNIHLNLDRRTGFLKGYALVEYETQKEANEAIDQSNDTDLLGQNVKVDWCFVKG 135          
BLAST of RNA-binding protein 8A vs. Ensembl Celegans
Match: R06C1.4 (pep chromosome:WBcel235:I:11930704:11931757:1 gene:WBGene00011059.1 transcript:R06C1.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R06C1.4)

HSP 1 Score: 56.6102 bits (135), Expect = 7.959e-11
Identity = 23/79 (29.11%), Postives = 48/79 (60.76%), Query Frame = 3
Query:  243 EGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            +G+ +++ N+  + TEE++ + F+  G + N+ + +DR TG  +G+  +E+   A AQ A++ +NG    G  + V++A
Sbjct:    4 QGFSVYVGNVPYQGTEEEIGNYFAAVGHVNNVRIVYDRETGRPRGFAFVEFSEEAGAQRAVEQLNGVAFNGRNLRVNYA 82          
BLAST of RNA-binding protein 8A vs. Ensembl Celegans
Match: rbm-3.1 (RNA Binding Motif protein homolog [Source:UniProtKB/TrEMBL;Acc:O45712])

HSP 1 Score: 55.8398 bits (133), Expect = 1.292e-10
Identity = 27/77 (35.06%), Postives = 45/77 (58.44%), Query Frame = 3
Query:  249 WIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            + +++ N   + TEE++ + FS  G+I N+ +  DR TG  +G+  IE+     AQ A++ MNGAE  G  + V+ A
Sbjct:    5 FSVYVGNAPFQTTEEELGNFFSSIGQINNVRIVCDRETGRPRGFAFIEFAEEGSAQRAVEQMNGAEFNGRPLRVNLA 81          
BLAST of RNA-binding protein 8A vs. Ensembl Celegans
Match: cpf-2 (Cleavage and Polyadenylation Factor [Source:UniProtKB/TrEMBL;Acc:O45577])

HSP 1 Score: 56.6102 bits (135), Expect = 1.515e-9
Identity = 31/83 (37.35%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  231 QRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            QRSV     F+ NI  + +E+ +R  FS+ G + ++ M  DR TG  KGY  IE+     A+ A++ +NG E+ G  + VD A
Sbjct:   17 QRSV-----FVGNISYDVSEDTIRSIFSKAGNVLSIKMVHDRETGKPKGYGFIEFPDIQTAEVAIRNLNGYELSGRILRVDSA 94          
BLAST of RNA-binding protein 8A vs. Ensembl Fly
Match: tsu (gene:FBgn0033378 transcript:FBtr0088567)

HSP 1 Score: 162.155 bits (409), Expect = 1.027e-50
Identity = 80/149 (53.69%), Postives = 108/149 (72.48%), Query Frame = 3
Query:   69 EETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEAL-------SDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGP 494
            EE  +D DGD+ I+ LKE  K RKGRGF S    D NT+ EA+       +++DD   PGPQRSVEGWI+F+ +IHEEA E+++++KF ++GEIKN+H+N DRRTG+ KGY L+EYET  +A  A + +NGAE+ G+ + VDW FVKGP
Sbjct:   11 EEFEVDEDGDQGIVRLKEKAKHRKGRGFGS----DSNTR-EAIHSYERVRNEDDDELEPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKGP 154          
BLAST of RNA-binding protein 8A vs. Ensembl Fly
Match: CstF64 (gene:FBgn0027841 transcript:FBtr0083660)

HSP 1 Score: 61.6178 bits (148), Expect = 4.756e-11
Identity = 30/76 (39.47%), Postives = 47/76 (61.84%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAF 482
            +F+ NI  EATEE +++ FSE G + +L + FDR +G  KG+   EY+    A +A++ +NG E+ G  + VD A 
Sbjct:   18 VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEIGGRTLRVDNAC 93          
BLAST of RNA-binding protein 8A vs. Ensembl Fly
Match: CG4806 (gene:FBgn0260456 transcript:FBtr0072332)

HSP 1 Score: 60.8474 bits (146), Expect = 9.870e-11
Identity = 28/78 (35.90%), Postives = 48/78 (61.54%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVK 488
            + +RNI  ++TE+ +R+ F ++G ++++H+   R  G + G   ++YET  +A  A+   NG E+ G KV VDWA  K
Sbjct:   50 LIVRNISYKSTEDSLREHFGQWGTLEDVHI-LKRGDGKLVGCAFVQYETINQATKAILNSNGKELLGRKVFVDWALGK 126          
BLAST of RNA-binding protein 8A vs. Ensembl Fly
Match: hfp (gene:FBgn0028577 transcript:FBtr0300416)

HSP 1 Score: 55.8398 bits (133), Expect = 4.764e-9
Identity = 28/72 (38.89%), Postives = 44/72 (61.11%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNV 470
            +++ +I  E  E+ +R  F+ FG IK+++M++D  T   KG+  +EYE    AQ AL+ MNGA M G  + V
Sbjct:   40 VYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQMNGALMGGRNIKV 111          
BLAST of RNA-binding protein 8A vs. Ensembl Fly
Match: hfp (gene:FBgn0028577 transcript:FBtr0300418)

HSP 1 Score: 55.8398 bits (133), Expect = 4.764e-9
Identity = 28/72 (38.89%), Postives = 44/72 (61.11%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNV 470
            +++ +I  E  E+ +R  F+ FG IK+++M++D  T   KG+  +EYE    AQ AL+ MNGA M G  + V
Sbjct:   40 VYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQMNGALMGGRNIKV 111          
BLAST of RNA-binding protein 8A vs. Ensembl Zebrafish
Match: rbm8a (RNA binding motif protein 8A [Source:NCBI gene;Acc:503767])

HSP 1 Score: 166.007 bits (419), Expect = 5.965e-52
Identity = 85/150 (56.67%), Postives = 109/150 (72.67%), Query Frame = 3
Query:   45 FQMADAEKEETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGP 494
              + +A  E+  MD DGDE I +LKE  K RKGRGF SE+      + +  +   D   PGPQRSVEGWI+F+  +HEEATEEDV DKF+EFGEIKNLH+N DRRTGY+KGY L+EYET+ EAQ A++ +NG E+ G+ ++VDW FV+GP
Sbjct:    5 LDLHEAGGEDFPMDEDGDESIHKLKEKAKKRKGRGFGSEEGARSRVREDYDTVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDVHDKFAEFGEIKNLHLNLDRRTGYLKGYALVEYETYKEAQAAMEGLNGQELMGQPISVDWCFVRGP 154          
BLAST of RNA-binding protein 8A vs. Ensembl Zebrafish
Match: cstf2 (cleavage stimulation factor, 3' pre-RNA, subunit 2 [Source:ZFIN;Acc:ZDB-GENE-031118-2])

HSP 1 Score: 64.3142 bits (155), Expect = 7.504e-12
Identity = 31/75 (41.33%), Postives = 45/75 (60.00%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            +F+ NI  EATEE ++D FSE G + +  + +DR TG  KGY   EY+    A +A++ +NG E  G  + VD A
Sbjct:   26 VFVGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNA 100          
BLAST of RNA-binding protein 8A vs. Ensembl Zebrafish
Match: cstf2 (cleavage stimulation factor, 3' pre-RNA, subunit 2 [Source:ZFIN;Acc:ZDB-GENE-031118-2])

HSP 1 Score: 64.3142 bits (155), Expect = 8.293e-12
Identity = 31/75 (41.33%), Postives = 45/75 (60.00%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            +F+ NI  EATEE ++D FSE G + +  + +DR TG  KGY   EY+    A +A++ +NG E  G  + VD A
Sbjct:   26 VFVGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNA 100          
BLAST of RNA-binding protein 8A vs. Ensembl Zebrafish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 59.6918 bits (143), Expect = 7.831e-11
Identity = 34/121 (28.10%), Postives = 66/121 (54.55%), Query Frame = 3
Query:  135 RKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGPN 497
            RK  G  S   HD  +K ++ +  D    P P   +    +F  +++   TE D+R+ FS +G +  +++ +D+RTG  +G+  + +E   +A+ A++  NG E+ G ++ VD++  K P+
Sbjct:   75 RKHAGSRSSYSHD--SKKDSHNQGDARANPDPNTCLG---VFGLSLY--TTERDLREVFSRYGSLAGVNVVYDQRTGRSRGFAFVYFEHIDDAKEAMERANGMELDGRRIRVDYSITKRPH 188          
BLAST of RNA-binding protein 8A vs. Ensembl Zebrafish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 59.6918 bits (143), Expect = 7.831e-11
Identity = 34/121 (28.10%), Postives = 66/121 (54.55%), Query Frame = 3
Query:  135 RKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGPN 497
            RK  G  S   HD  +K ++ +  D    P P   +    +F  +++   TE D+R+ FS +G +  +++ +D+RTG  +G+  + +E   +A+ A++  NG E+ G ++ VD++  K P+
Sbjct:   75 RKHAGSRSSYSHD--SKKDSHNQGDARANPDPNTCLG---VFGLSLY--TTERDLREVFSRYGSLAGVNVVYDQRTGRSRGFAFVYFEHIDDAKEAMERANGMELDGRRIRVDYSITKRPH 188          
BLAST of RNA-binding protein 8A vs. Ensembl Xenopus
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:Xenbase;Acc:XB-GENE-981006])

HSP 1 Score: 65.4698 bits (158), Expect = 4.526e-12
Identity = 31/75 (41.33%), Postives = 45/75 (60.00%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            +F+ NI  EATEE ++D FSE G + +  + +DR TG  KGY   EY+    A +A++ +NG E  G  + VD A
Sbjct:   18 VFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNA 92          
BLAST of RNA-binding protein 8A vs. Ensembl Xenopus
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:Xenbase;Acc:XB-GENE-981006])

HSP 1 Score: 65.4698 bits (158), Expect = 4.562e-12
Identity = 31/75 (41.33%), Postives = 45/75 (60.00%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            +F+ NI  EATEE ++D FSE G + +  + +DR TG  KGY   EY+    A +A++ +NG E  G  + VD A
Sbjct:   18 VFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNA 92          
BLAST of RNA-binding protein 8A vs. Ensembl Xenopus
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:Xenbase;Acc:XB-GENE-981006])

HSP 1 Score: 65.4698 bits (158), Expect = 4.804e-12
Identity = 31/75 (41.33%), Postives = 45/75 (60.00%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            +F+ NI  EATEE ++D FSE G + +  + +DR TG  KGY   EY+    A +A++ +NG E  G  + VD A
Sbjct:   18 VFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNA 92          
BLAST of RNA-binding protein 8A vs. Ensembl Xenopus
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:Xenbase;Acc:XB-GENE-981006])

HSP 1 Score: 64.6994 bits (156), Expect = 9.231e-12
Identity = 33/84 (39.29%), Postives = 46/84 (54.76%), Query Frame = 3
Query:  228 PQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            P  S     I + NI  EATEE ++D FSE G + +  + +DR TG  KGY   EY+    A +A++ +NG E  G  + VD A
Sbjct:    8 PCSSCASCHIAVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNA 91          
BLAST of RNA-binding protein 8A vs. Ensembl Xenopus
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:Xenbase;Acc:XB-GENE-981006])

HSP 1 Score: 64.3142 bits (155), Expect = 1.077e-11
Identity = 33/84 (39.29%), Postives = 46/84 (54.76%), Query Frame = 3
Query:  228 PQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            P  S     I + NI  EATEE ++D FSE G + +  + +DR TG  KGY   EY+    A +A++ +NG E  G  + VD A
Sbjct:    8 PCSSCASCHIAVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNA 91          
BLAST of RNA-binding protein 8A vs. Ensembl Mouse
Match: Rbm8a (RNA binding motif protein 8a [Source:MGI Symbol;Acc:MGI:1913129])

HSP 1 Score: 157.532 bits (397), Expect = 1.413e-48
Identity = 80/147 (54.42%), Postives = 106/147 (72.11%), Query Frame = 3
Query:   45 FQMADAEKEETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFV 485
              + +A  E+  MD DGDE I +LKE  K RKGRGF SE+      + +  S   D   PGPQRSVEGWI+F+  +HEEATEED+ DKF+E+GEIKN+H+N DRRTGY+KGY L+EYET+ EAQ A++ +NG ++ G+ ++VDW FV
Sbjct:    5 LDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFV 151          
BLAST of RNA-binding protein 8A vs. Ensembl Mouse
Match: Rbm8a2 (RNA binding motif protein 8A2 [Source:MGI Symbol;Acc:MGI:3612447])

HSP 1 Score: 156.377 bits (394), Expect = 3.373e-48
Identity = 79/147 (53.74%), Postives = 106/147 (72.11%), Query Frame = 3
Query:   45 FQMADAEKEETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFV 485
              + +A  E+  MD DGDE I +LKE  K RKGRGF S++      + +  S   D   PGPQRSVEGWI+F+  +HEEATEED+ DKF+E+GEIKN+H+N DRRTGY+KGY L+EYET+ EAQ A++ +NG ++ G+ ++VDW FV
Sbjct:    5 LDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSKEGSRARMQEDYDSVKQDSDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFV 151          
BLAST of RNA-binding protein 8A vs. Ensembl Mouse
Match: Rbm8a (RNA binding motif protein 8a [Source:MGI Symbol;Acc:MGI:1913129])

HSP 1 Score: 155.992 bits (393), Expect = 5.395e-48
Identity = 80/148 (54.05%), Postives = 109/148 (73.65%), Query Frame = 3
Query:   45 FQMADAEKEETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTK-FEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFV 485
              + +A  E+  MD DGDE I +LKE  K RKGRGF SE    R  + ++++  + D   PGPQRSVEGWI+F+  +HEEATEED+ DKF+E+GEIKN+H+N DRRTGY+KGY L+EYET+ EAQ A++ +NG ++ G+ ++VDW FV
Sbjct:    5 LDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEGSRARMREDYDSVEQDGDE--PGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFV 150          
BLAST of RNA-binding protein 8A vs. Ensembl Mouse
Match: Rbm8a (RNA binding motif protein 8a [Source:MGI Symbol;Acc:MGI:1913129])

HSP 1 Score: 154.451 bits (389), Expect = 2.301e-47
Identity = 78/146 (53.42%), Postives = 104/146 (71.23%), Query Frame = 3
Query:   57 DAEKEETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGP 494
            D + EE+  D      I +LKE  K RKGRGF SE+      + +  S   D   PGPQRSVEGWI+F+  +HEEATEED+ DKF+E+GEIKN+H+N DRRTGY+KGY L+EYET+ EAQ A++ +NG ++ G+ ++VDW FV+GP
Sbjct:   20 DGDGEESGGDCGKRGSIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGP 165          
BLAST of RNA-binding protein 8A vs. Ensembl Mouse
Match: Rbm8a (RNA binding motif protein 8a [Source:MGI Symbol;Acc:MGI:1913129])

HSP 1 Score: 141.739 bits (356), Expect = 5.083e-43
Identity = 57/88 (64.77%), Postives = 76/88 (86.36%), Query Frame = 3
Query:  222 PGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFV 485
            PGPQRSVEGWI+F+  +HEEATEED+ DKF+E+GEIKN+H+N DRRTGY+KGY L+EYET+ EAQ A++ +NG ++ G+ ++VDW FV
Sbjct:   15 PGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFV 102          
BLAST of RNA-binding protein 8A vs. UniProt/SwissProt
Match: sp|B5DGI7|RBM8A_SALSA (RNA-binding protein 8A OS=Salmo salar OX=8030 GN=rbm8a PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 6.633e-56
Identity = 83/150 (55.33%), Postives = 109/150 (72.67%), Query Frame = 3
Query:   45 FQMADAEKEETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGP 494
              + +A  E+  MD DGD+ I +LKE  K RKGRGF SE+      + +  +   D   PGPQRSVEGWI+F+  +HEEATEED+ DKF+EFGEIKNLH+N DRRTGY+KGY L+EYET+ EAQ A++ +NG +M G+ ++VDW FV+GP
Sbjct:    5 LDLHEAGGEDFAMDEDGDDSIHKLKEKAKRRKGRGFGSEEGARSRVREDYDTVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEFGEIKNLHLNLDRRTGYLKGYALVEYETYKEAQAAMEGLNGQDMMGQPISVDWGFVRGP 154          
BLAST of RNA-binding protein 8A vs. UniProt/SwissProt
Match: sp|Q5D018|RBM8A_DANRE (RNA-binding protein 8A OS=Danio rerio OX=7955 GN=rbm8a PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 4.503e-51
Identity = 85/150 (56.67%), Postives = 109/150 (72.67%), Query Frame = 3
Query:   45 FQMADAEKEETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGP 494
              + +A  E+  MD DGDE I +LKE  K RKGRGF SE+      + +  +   D   PGPQRSVEGWI+F+  +HEEATEEDV DKF+EFGEIKNLH+N DRRTGY+KGY L+EYET+ EAQ A++ +NG E+ G+ ++VDW FV+GP
Sbjct:    5 LDLHEAGGEDFPMDEDGDESIHKLKEKAKKRKGRGFGSEEGARSRVREDYDTVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDVHDKFAEFGEIKNLHLNLDRRTGYLKGYALVEYETYKEAQAAMEGLNGQELMGQPISVDWCFVRGP 154          
BLAST of RNA-binding protein 8A vs. UniProt/SwissProt
Match: sp|Q9V535|RBM8A_DROME (RNA-binding protein 8A OS=Drosophila melanogaster OX=7227 GN=tsu PE=1 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.029e-49
Identity = 80/149 (53.69%), Postives = 108/149 (72.48%), Query Frame = 3
Query:   69 EETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEAL-------SDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGP 494
            EE  +D DGD+ I+ LKE  K RKGRGF S    D NT+ EA+       +++DD   PGPQRSVEGWI+F+ +IHEEA E+++++KF ++GEIKN+H+N DRRTG+ KGY L+EYET  +A  A + +NGAE+ G+ + VDW FVKGP
Sbjct:   11 EEFEVDEDGDQGIVRLKEKAKHRKGRGFGS----DSNTR-EAIHSYERVRNEDDDELEPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKGP 154          
BLAST of RNA-binding protein 8A vs. UniProt/SwissProt
Match: sp|Q27W01|RBM8A_RAT (RNA-binding protein 8A OS=Rattus norvegicus OX=10116 GN=Rbm8a PE=1 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 9.884e-48
Identity = 80/147 (54.42%), Postives = 106/147 (72.11%), Query Frame = 3
Query:   45 FQMADAEKEETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFV 485
              + +A  E+  MD DGDE I +LKE  K RKGRGF SE+      + +  S   D   PGPQRSVEGWI+F+  +HEEATEED+ DKF+E+GEIKN+H+N DRRTGY+KGY L+EYET+ EAQ A++ +NG ++ G+ ++VDW FV
Sbjct:    5 LDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFV 151          
BLAST of RNA-binding protein 8A vs. UniProt/SwissProt
Match: sp|Q9CWZ3|RBM8A_MOUSE (RNA-binding protein 8A OS=Mus musculus OX=10090 GN=Rbm8a PE=1 SV=4)

HSP 1 Score: 157.532 bits (397), Expect = 9.884e-48
Identity = 80/147 (54.42%), Postives = 106/147 (72.11%), Query Frame = 3
Query:   45 FQMADAEKEETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFV 485
              + +A  E+  MD DGDE I +LKE  K RKGRGF SE+      + +  S   D   PGPQRSVEGWI+F+  +HEEATEED+ DKF+E+GEIKN+H+N DRRTGY+KGY L+EYET+ EAQ A++ +NG ++ G+ ++VDW FV
Sbjct:    5 LDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFV 151          
BLAST of RNA-binding protein 8A vs. TrEMBL
Match: A0A075AAL2 (RNA-binding protein 8A OS=Opisthorchis viverrini OX=6198 GN=T265_01122 PE=3 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 4.233e-57
Identity = 81/138 (58.70%), Postives = 107/138 (77.54%), Query Frame = 3
Query:   84 DIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGPN 497
            D+DGD  +++LKE+ K RKGRGF  E        FE+L   +D  GPGPQRS+EGWI+F+RN+HEEATEED+RDKF E+G+IKNLH+N DRRTGY+KGY L+EYE F EAQ AL+ +NG+ ++G+ + VDWAF +G +
Sbjct:   16 DVDGDHGLLKLKESAKKRKGRGFIGEITDTSKEGFESLRTAEDSGGPGPQRSIEGWIVFVRNVHEEATEEDIRDKFCEYGDIKNLHLNLDRRTGYLKGYALVEYELFKEAQTALEQLNGSLLHGQTIRVDWAFTRGAS 153          
BLAST of RNA-binding protein 8A vs. TrEMBL
Match: A0A504YL45 (RNA-binding protein 8A OS=Fasciola gigantica OX=46835 GN=FGIG_09902 PE=3 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 5.256e-57
Identity = 81/138 (58.70%), Postives = 109/138 (78.99%), Query Frame = 3
Query:   84 DIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGPN 497
            D+ GD  +++LKE+ K RKGRGF ++        FE++  + D  GPGPQRS+EGWI+FIRN+HEEATEED+RDKF E+G+IKNLH+N DRRTGY+KGY L+EYE F EAQ A++ +NG+E++G+K+ VDWAF KG +
Sbjct:   16 DVYGDHGLMKLKESAKKRKGRGFIADSVSTGKEGFESIPSDGDTGGPGPQRSIEGWILFIRNVHEEATEEDIRDKFCEYGDIKNLHLNLDRRTGYLKGYALVEYELFKEAQTAMEQLNGSELHGQKIRVDWAFTKGSS 153          
BLAST of RNA-binding protein 8A vs. TrEMBL
Match: A0A183BCN3 (RNA-binding protein 8A OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS16968 PE=3 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.665e-55
Identity = 79/130 (60.77%), Postives = 108/130 (83.08%), Query Frame = 3
Query:  108 IELKENVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGPN 497
            ++LKE+ K RKGRGF ++  +     FE++  ++D TGPGPQRS+EGWI+FIRN+HEEATEED+RDKF E+G+IKN+H+N DRRTGY+KGY L+EYE F EAQ A++ +NG+E++G+K+ VDWAF KGP+
Sbjct:    1 MKLKESAKKRKGRGFIADSVNTGKEGFESIPTDND-TGPGPQRSIEGWILFIRNVHEEATEEDIRDKFCEYGDIKNIHLNLDRRTGYLKGYALVEYEMFKEAQTAMEQLNGSELHGQKIRVDWAFTKGPS 129          
BLAST of RNA-binding protein 8A vs. TrEMBL
Match: A0A2H1C095 (RNA-binding protein 8A OS=Fasciola hepatica OX=6192 GN=D915_008184 PE=3 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 3.498e-55
Identity = 78/130 (60.00%), Postives = 104/130 (80.00%), Query Frame = 3
Query:  108 IELKENVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGPN 497
            ++LKE+ K RKGRGF ++        FE++  + D  GPGPQRS+EGWI+FIRN+HEEATEED+RDKF E+G+IKNLH+N DRRTGY+KGY L+EYE F EAQ A++ +NG+E++G+K+ VDWAF KG +
Sbjct:    1 MKLKESAKKRKGRGFIADSVSTGKEGFESIPSDGDTGGPGPQRSIEGWILFIRNVHEEATEEDIRDKFCEYGDIKNLHLNLDRRTGYLKGYALVEYELFKEAQTAMEQLNGSELHGQKIRVDWAFTKGSS 130          
BLAST of RNA-binding protein 8A vs. TrEMBL
Match: A0A0R3WQ11 (RNA-binding protein 8A OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS2836 PE=3 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 7.884e-55
Identity = 80/137 (58.39%), Postives = 108/137 (78.83%), Query Frame = 3
Query:   84 DIDGDEKIIELKENVKSRKGRGFESEQ-RHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKG 491
            D +GD  I+ LKE    RKGRGF  E   H +  +FE+L  +D+ +  GPQRS+EGWI+F+RN+HEEAT+ED+RDKF E+GEIKN+H+N DRRTG++KGY L+EYETF +A  AL+ +NG+E++G+K+ VDWAFVKG
Sbjct:   16 DTEGDHGIMRLKEQATKRKGRGFRGELVAHAQEEEFESLKTDDNASATGPQRSIEGWIVFVRNVHEEATDEDIRDKFCEYGEIKNIHLNLDRRTGFLKGYALVEYETFKDANAALQALNGSELHGQKILVDWAFVKG 152          
BLAST of RNA-binding protein 8A vs. Ensembl Cavefish
Match: rbm8a (RNA binding motif protein 8A [Source:NCBI gene;Acc:103036849])

HSP 1 Score: 155.992 bits (393), Expect = 4.870e-48
Identity = 81/147 (55.10%), Postives = 104/147 (70.75%), Query Frame = 3
Query:   45 FQMADAEKEETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFV 485
              + +A  E+  MD DGDE I +LKE  K RKGRGF SE+      + +  +   D   PGPQRSVEGWI+F+  + EEATEED+ DKFSEFGEIKNLH+N DRRTGY+KGY L+EYET+ EAQ A++ +NG ++ G+ + VDW FV
Sbjct:    5 LDLHEAGGEDFPMDEDGDESIHKLKEKAKKRKGRGFGSEEGARSRVREDYDTVEQDGDEPGPQRSVEGWILFVTGVQEEATEEDIHDKFSEFGEIKNLHLNLDRRTGYLKGYALVEYETYKEAQAAMEGLNGQDLMGQPIGVDWCFV 151          
BLAST of RNA-binding protein 8A vs. Ensembl Cavefish
Match: cstf2 (cleavage stimulation factor subunit 2 [Source:NCBI gene;Acc:103042269])

HSP 1 Score: 64.3142 bits (155), Expect = 6.859e-12
Identity = 31/75 (41.33%), Postives = 45/75 (60.00%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            +F+ NI  EATEE ++D FSE G + +  + +DR TG  KGY   EY+    A +A++ +NG E  G  + VD A
Sbjct:   25 VFVGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNA 99          
BLAST of RNA-binding protein 8A vs. Ensembl Cavefish
Match: cstf2 (cleavage stimulation factor subunit 2 [Source:NCBI gene;Acc:103042269])

HSP 1 Score: 64.3142 bits (155), Expect = 7.013e-12
Identity = 31/75 (41.33%), Postives = 45/75 (60.00%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            +F+ NI  EATEE ++D FSE G + +  + +DR TG  KGY   EY+    A +A++ +NG E  G  + VD A
Sbjct:   25 VFVGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNA 99          
BLAST of RNA-binding protein 8A vs. Ensembl Cavefish
Match: cstf2 (cleavage stimulation factor subunit 2 [Source:NCBI gene;Acc:103042269])

HSP 1 Score: 63.929 bits (154), Expect = 8.501e-12
Identity = 31/75 (41.33%), Postives = 45/75 (60.00%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            +F+ NI  EATEE ++D FSE G + +  + +DR TG  KGY   EY+    A +A++ +NG E  G  + VD A
Sbjct:   25 VFVGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNA 99          
BLAST of RNA-binding protein 8A vs. Ensembl Cavefish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 59.3066 bits (142), Expect = 1.352e-10
Identity = 32/121 (26.45%), Postives = 63/121 (52.07%), Query Frame = 3
Query:  135 RKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGPN 497
            R+  G  S   HD   K +++S  D    P P        + +  +    TE D+R+ FS +G +  +++ +D+RTG  +G+  + +E   +++ A++  NG E+ G ++ VD++  K P+
Sbjct:  105 RRHAGSRSTYSHD---KKDSVSHGDARANPDPN-----TCLGVFGLSLYTTERDLREVFSRYGPLAGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRPH 217          
BLAST of RNA-binding protein 8A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002832.1 (pep scaffold:Pmarinus_7.0:GL476732:699988:701739:-1 gene:ENSPMAG00000002585.1 transcript:ENSPMAT00000002832.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.265 bits (334), Expect = 1.323e-40
Identity = 55/86 (63.95%), Postives = 74/86 (86.05%), Query Frame = 3
Query:  237 SVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGP 494
            +VEGWI+F+  +HEEA E+D+ DKF EFGEIKN+H+N DRRTG++KGY L+EYETF EAQ A++ +NGA++ G+K+ VDWAFV+GP
Sbjct:    6 AVEGWILFVTGVHEEAQEDDMHDKFGEFGEIKNVHLNLDRRTGFLKGYALVEYETFKEAQAAMEGLNGADILGQKIAVDWAFVRGP 91          
BLAST of RNA-binding protein 8A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010908.1 (pep scaffold:Pmarinus_7.0:GL483688:3845:10066:1 gene:ENSPMAG00000009884.1 transcript:ENSPMAT00000010908.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 3.109e-10
Identity = 25/72 (34.72%), Postives = 43/72 (59.72%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNV 470
            +++ +I+ E  E+ +R  F+ FG IK++ M+FD  T   KG+  +EY+    AQ A++ MNG  + G  + V
Sbjct:   21 VYVGSIYYELGEDTIRQAFAPFGPIKSIDMSFDPVTMKHKGFAFVEYDLPEAAQLAMEQMNGITLGGRSIKV 92          
BLAST of RNA-binding protein 8A vs. Ensembl Sea Lamprey
Match: tia1l (cytotoxic granule-associated RNA binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2167])

HSP 1 Score: 52.373 bits (124), Expect = 1.014e-8
Identity = 24/80 (30.00%), Postives = 45/80 (56.25%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGP 494
            +F+ ++  E + +D+R  F+ FG+I +  +  D  TG  KGY  + +    +A+NA++ M G  + G ++  +WA  K P
Sbjct:    5 VFVGDLSPEISTDDLRAAFAPFGKISDARVVKDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNWATRKPP 84          
BLAST of RNA-binding protein 8A vs. Ensembl Sea Lamprey
Match: sf3b4 (splicing factor 3b, subunit 4 [Source:ZFIN;Acc:ZDB-GENE-020419-22])

HSP 1 Score: 50.8322 bits (120), Expect = 4.877e-8
Identity = 29/82 (35.37%), Postives = 41/82 (50.00%), Query Frame = 3
Query:  246 GWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNF-DRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVK 488
            G  IFI N+  E  E+ + D FS FG I        D  TG  KGY  I + +F  +  A++ MNG  +    ++V +AF K
Sbjct:   99 GANIFIGNLDTEIDEKLLYDTFSAFGVILQTPKTMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRPISVSYAFKK 180          
BLAST of RNA-binding protein 8A vs. Ensembl Sea Lamprey
Match: ncl (nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986])

HSP 1 Score: 49.2914 bits (116), Expect = 2.122e-7
Identity = 28/90 (31.11%), Postives = 49/90 (54.44%), Query Frame = 3
Query:  222 PGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKG 491
            PGP  +     +F+R + E+ +E+ + D F      +   +  DR +G  KGY  +++ +  EA++AL  M G E+ G ++ VD+A  KG
Sbjct:  538 PGPSEASS--TLFVRGLGEDTSEDTLMDSFEGATAAR---IVTDRDSGQSKGYAYVDFSSADEAKSALNAMKGVEIDGSQIYVDFARPKG 622          
BLAST of RNA-binding protein 8A vs. Ensembl Yeast
Match: SGN1 (Cytoplasmic RNA-binding protein; contains an RNA recognition motif (RRM); may have a role in mRNA translation, as suggested by genetic interactions with genes encoding proteins involved in translational initiation [Source:SGD;Acc:S000001440])

HSP 1 Score: 59.3066 bits (142), Expect = 2.359e-11
Identity = 30/72 (41.67%), Postives = 46/72 (63.89%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNV 470
            IF+ NI  + T E + D F + G+IK + + +DR TG  KGY  IE+E+ A  + AL+ +NG E+ G+K+ V
Sbjct:   66 IFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAYREKALQ-LNGGELKGKKIAV 136          
BLAST of RNA-binding protein 8A vs. Ensembl Yeast
Match: RNA15 (Component of the cleavage and polyadenylation factor I (CF I); CF 1, composed of the CF 1A complex (Rna14p, Rna15p, Clp1p, Pcf11p) and Hrp1, is involved in cleavage and polyadenylation of mRNA 3' ends; interacts with the A-rich polyadenylation signal in complex with Rna14p and Hrp1p; mutant displays reduced transcription elongation in the G-less-based run-on (GLRO) assay; required for gene looping and maintenance of genome stability [Source:SGD;Acc:S000003012])

HSP 1 Score: 53.5286 bits (127), Expect = 3.583e-9
Identity = 24/75 (32.00%), Postives = 42/75 (56.00%), Query Frame = 3
Query:  225 GPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEM 449
            G Q +    ++++ +I  + TEE + D  S  G + NL M FD +TG  KGY  IE+     + +A++ +NG ++
Sbjct:   10 GVQNNPPSRVVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNLNGYQL 84          
BLAST of RNA-binding protein 8A vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 51.2174 bits (121), Expect = 2.504e-8
Identity = 20/75 (26.67%), Postives = 45/75 (60.00%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            +F+ +++    +E +R+ F +F    + H+ +D +TG  +GY  + + +  +AQNA+ +M G ++ G  + ++WA
Sbjct:  164 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWA 238          
BLAST of RNA-binding protein 8A vs. Ensembl Yeast
Match: MRD1 (Essential conserved small ribosomal subunit (40s) synthesis factor; component of the 90S preribosome; required for production of 18S rRNA and small ribosomal subunit; contains five consensus RNA-binding domains and binds to the pre-rRNA at two sites within the 18S region [Source:SGD;Acc:S000006316])

HSP 1 Score: 49.2914 bits (116), Expect = 1.151e-7
Identity = 24/57 (42.11%), Postives = 36/57 (63.16%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNAL 425
            +F+RNI   + EED R  FS FGE++ +H+  D RTG  KG+    Y  F +++NA+
Sbjct:  347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFA---YVLFKDSKNAV 400          

HSP 2 Score: 43.8986 bits (102), Expect = 7.305e-6
Identity = 21/76 (27.63%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHM--NFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDW 476
            I ++N+  EAT +DV + F+ FG++K++ +   FD+     +G+  +E+    EA+NA+  ++G  + G ++ + +
Sbjct:  765 IIVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSA---RGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQY 837          
BLAST of RNA-binding protein 8A vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 46.9802 bits (110), Expect = 7.097e-7
Identity = 24/75 (32.00%), Postives = 46/75 (61.33%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            ++++NI+ E T+E  ++ F++FG I +  +  D   G +KG+  + YE   +A  A++ +N +E+ GEK+ V  A
Sbjct:  221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDA-DGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRA 294          
BLAST of RNA-binding protein 8A vs. Ensembl Nematostella
Match: EDO45702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS89])

HSP 1 Score: 144.436 bits (363), Expect = 1.026e-44
Identity = 60/90 (66.67%), Postives = 79/90 (87.78%), Query Frame = 3
Query:  228 PQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGPN 497
            P RSVEGWI+F+ NIHEEA E+D+ + FS++GEIKNLH+N DRRTG+IKGY L+EYETF EAQ+AL+ +NGAEM G+ ++VDWAF++GP+
Sbjct:   31 PARSVEGWILFVTNIHEEAQEDDIHELFSDYGEIKNLHVNLDRRTGFIKGYALVEYETFKEAQSALEALNGAEMLGQNISVDWAFIRGPS 120          
BLAST of RNA-binding protein 8A vs. Ensembl Nematostella
Match: EDO47928 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKL6])

HSP 1 Score: 137.887 bits (346), Expect = 1.806e-42
Identity = 57/87 (65.52%), Postives = 77/87 (88.51%), Query Frame = 3
Query:  237 SVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGPN 497
            +VEGWI+F+ NIHEEA E+D+ + FS++GEIKNLH+N DRRTG+IKGY L+EYETF EAQ+AL+ +NGAEM G+ ++VDWAF++GP+
Sbjct:    1 AVEGWILFVTNIHEEAQEDDIHELFSDYGEIKNLHVNLDRRTGFIKGYALVEYETFKEAQSALEALNGAEMLGQNISVDWAFIRGPS 87          
BLAST of RNA-binding protein 8A vs. Ensembl Nematostella
Match: EDO30149 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1M0])

HSP 1 Score: 137.502 bits (345), Expect = 2.315e-42
Identity = 57/87 (65.52%), Postives = 77/87 (88.51%), Query Frame = 3
Query:  237 SVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGPN 497
            +VEGWI+F+ NIHEEA E+D+ + FS++GEIKNLH+N DRRTG+IKGY L+EYETF EAQ+AL+ +NGAEM G+ ++VDWAF++GP+
Sbjct:    1 AVEGWILFVTNIHEEAQEDDIHELFSDYGEIKNLHVNLDRRTGFIKGYALVEYETFKEAQSALEALNGAEMLGQNISVDWAFIRGPS 87          
BLAST of RNA-binding protein 8A vs. Ensembl Nematostella
Match: EDO49282 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH27])

HSP 1 Score: 48.9062 bits (115), Expect = 3.930e-8
Identity = 22/77 (28.57%), Postives = 46/77 (59.74%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKG--YVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            I++RN+H +   +D+R  F ++G I ++++  D  T   +G  Y+ I +E   +A++AL  ++ A + G ++ V +A
Sbjct:   12 IYVRNLHPDTRPDDLRRMFGKYGRITDVYIPLDYYTREPRGFCYIYITFEDIRDAEDALYYLDRAMLLGRELEVQFA 88          
BLAST of RNA-binding protein 8A vs. Ensembl Nematostella
Match: EDO34879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN30])

HSP 1 Score: 51.6026 bits (122), Expect = 4.045e-8
Identity = 23/78 (29.49%), Postives = 40/78 (51.28%), Query Frame = 3
Query:  243 EGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDW 476
            +GW IF+  + +EAT   +   FS +G I N+ +  D      KGY  +    + EA +A+  +NG   +G+ + V +
Sbjct:  253 QGWCIFVYGLPQEATPLFLYKLFSPYGAITNIELKLD------KGYGFVNMSNYEEACHAICCLNGTPQHGKILQVSF 324          

HSP 2 Score: 45.4394 bits (106), Expect = 5.483e-6
Identity = 20/75 (26.67%), Postives = 38/75 (50.67%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            + I  +    ++ED++  F   G + +  +  DR TG   GY  + Y+   +A  A++ MNGA +  + + V +A
Sbjct:   12 LIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFA 86          
BLAST of RNA-binding protein 8A vs. Ensembl Medaka
Match: rbm8a (RNA binding motif protein 8A [Source:NCBI gene;Acc:100049229])

HSP 1 Score: 162.925 bits (411), Expect = 7.709e-51
Identity = 84/150 (56.00%), Postives = 108/150 (72.00%), Query Frame = 3
Query:   45 FQMADAEKEETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGP 494
              + +A  E+  MD DGDE I +LKE  K RKGRGF ++       K +  +   D   PGPQRSVEGWI+F+  +HEEATEED+ DKFSEFGEIKNLH+N DRRTGY+KGY L+EYET+ EAQ A++ +N  ++ G+ V+VDWAFV+GP
Sbjct:    5 LDLHEAGGEDFPMDEDGDESIHKLKEKAKKRKGRGFGADDGARSRAKEDYDTVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFSEFGEIKNLHLNLDRRTGYLKGYALVEYETYKEAQAAMEGLNAQDLMGQPVSVDWAFVRGP 154          
BLAST of RNA-binding protein 8A vs. Ensembl Medaka
Match: cstf2 (cleavage stimulation factor subunit 2 [Source:NCBI gene;Acc:101163985])

HSP 1 Score: 63.929 bits (154), Expect = 8.971e-12
Identity = 31/75 (41.33%), Postives = 45/75 (60.00%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            +F+ NI  EATEE ++D FSE G + +  + +DR TG  KGY   EY+    A +A++ +NG E  G  + VD A
Sbjct:   31 VFVGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNA 105          
BLAST of RNA-binding protein 8A vs. Ensembl Medaka
Match: cstf2 (cleavage stimulation factor subunit 2 [Source:NCBI gene;Acc:101163985])

HSP 1 Score: 63.929 bits (154), Expect = 9.187e-12
Identity = 31/75 (41.33%), Postives = 45/75 (60.00%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            +F+ NI  EATEE ++D FSE G + +  + +DR TG  KGY   EY+    A +A++ +NG E  G  + VD A
Sbjct:   31 VFVGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNA 105          
BLAST of RNA-binding protein 8A vs. Ensembl Medaka
Match: tra2a (transformer-2 protein homolog alpha [Source:NCBI gene;Acc:101157868])

HSP 1 Score: 60.4622 bits (145), Expect = 8.387e-11
Identity = 25/73 (34.25%), Postives = 44/73 (60.27%), Query Frame = 3
Query:  279 EATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGPN 497
              TE D+R+ FS +G +  ++M  D+RTG  +G+  I +E   +A+ A++  NG  M G ++ VD++  K P+
Sbjct:  119 STTERDLREVFSRYGRLTGINMVHDQRTGRSRGFAFIYFERLCDAREAIEHTNGMNMDGRQIRVDYSITKRPH 191          
BLAST of RNA-binding protein 8A vs. Ensembl Medaka
Match: ENSORLT00000019586.2 (nucleolysin TIA-1 [Source:NCBI gene;Acc:101158614])

HSP 1 Score: 53.9138 bits (128), Expect = 1.450e-8
Identity = 26/80 (32.50%), Postives = 44/80 (55.00%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGP 494
            +F+ ++  E T EDV+  F+ FG I +  +  D  TG  KGY  + +    +A+NA++ M G  + G ++  +WA  K P
Sbjct:   97 VFVGDLSPEITTEDVKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQHMGGQWLGGRQIRTNWATRKPP 176          
BLAST of RNA-binding protein 8A vs. Planmine SMEST
Match: SMESG000051885.1 (SMESG000051885.1)

HSP 1 Score: 316.62 bits (810), Expect = 1.240e-111
Identity = 175/175 (100.00%), Postives = 175/175 (100.00%), Query Frame = 3
Query:   51 MADAEKEETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGPNMXXXXXXXXXXXXXXXXXXXAEHKRH 575
            MADAEKEETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGPNMKSISKKKKSTNKTRSRSRSAEHKRH
Sbjct:    1 MADAEKEETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEALSDNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGPNMKSISKKKKSTNKTRSRSRSAEHKRH 175          
BLAST of RNA-binding protein 8A vs. Planmine SMEST
Match: SMESG000052090.1 (SMESG000052090.1)

HSP 1 Score: 56.225 bits (134), Expect = 2.158e-9
Identity = 28/86 (32.56%), Postives = 48/86 (55.81%), Query Frame = 3
Query:  222 PGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            PG    +   I++I  + +E TEE +++ F +FG+I N+ +  D  T   +G+  IEYE   +A  A+  MN  E+ G+ + V+ A
Sbjct:    9 PGSYNPINKRILYIGGLADEVTEEILQNNFIKFGDITNISIPIDYSTQKHRGFGFIEYELVEDAAAAIDNMNDGELCGKTIRVNIA 94          
BLAST of RNA-binding protein 8A vs. Planmine SMEST
Match: SMESG000016033.1 (SMESG000016033.1)

HSP 1 Score: 53.1434 bits (126), Expect = 8.369e-9
Identity = 21/76 (27.63%), Postives = 45/76 (59.21%), Query Frame = 3
Query:  252 IIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
             +F+RN+ +    ED+   F ++G I N+ +  D  +G +KG+    +E F +A++A   ++GA++ G ++ V++ 
Sbjct:    8 CLFVRNLSDRVRYEDLEKLFGKYGRIYNIKIPLDYYSGRMKGFGFCTFEDFRDAEDAKTRLDGAQLLGREIGVEFT 83          
BLAST of RNA-binding protein 8A vs. Planmine SMEST
Match: SMESG000009931.1 (SMESG000009931.1)

HSP 1 Score: 51.6026 bits (122), Expect = 7.892e-8
Identity = 26/75 (34.67%), Postives = 41/75 (54.67%), Query Frame = 3
Query:  255 IFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWA 479
            IF+ NI  EATEE +   FS+ G +    + +DR +G  KGY   EY + A A +AL+ ++  +  G  + +  A
Sbjct:   12 IFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPA 86          
BLAST of RNA-binding protein 8A vs. Planmine SMEST
Match: SMESG000073310.1 (SMESG000073310.1)

HSP 1 Score: 50.447 bits (119), Expect = 2.947e-7
Identity = 20/72 (27.78%), Postives = 44/72 (61.11%), Query Frame = 3
Query:  249 WIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNFDRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKV 464
            WIIF+ N+  + T++++   F+ FG ++++ ++ D  T    GY  ++   + EA  A++ +NG  ++G++V
Sbjct:  446 WIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGT-LFGDRV 516          
The following BLAST results are available for this feature:
BLAST of RNA-binding protein 8A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBM8A2.058e-4854.42RNA binding motif protein 8A [Source:HGNC Symbol;A... [more]
RBM8A2.058e-4854.42RNA binding motif protein 8A [Source:HGNC Symbol;A... [more]
RBM8A7.859e-4854.05RNA binding motif protein 8A [Source:HGNC Symbol;A... [more]
RBM8A6.387e-3762.20RNA binding motif protein 8A [Source:HGNC Symbol;A... [more]
RBM8A6.387e-3762.20RNA binding motif protein 8A [Source:HGNC Symbol;A... [more]
back to top
BLAST of RNA-binding protein 8A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnp-41.220e-4352.03RNA-binding protein 8A [Source:UniProtKB/TrEMBL;A... [more]
rnp-41.220e-4352.03RNA-binding protein 8A [Source:UniProtKB/TrEMBL;A... [more]
R06C1.47.959e-1129.11pep chromosome:WBcel235:I:11930704:11931757:1 gene... [more]
rbm-3.11.292e-1035.06RNA Binding Motif protein homolog [Source:UniProt... [more]
cpf-21.515e-937.35Cleavage and Polyadenylation Factor [Source:UniPr... [more]
back to top
BLAST of RNA-binding protein 8A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tsu1.027e-5053.69gene:FBgn0033378 transcript:FBtr0088567[more]
CstF644.756e-1139.47gene:FBgn0027841 transcript:FBtr0083660[more]
CG48069.870e-1135.90gene:FBgn0260456 transcript:FBtr0072332[more]
hfp4.764e-938.89gene:FBgn0028577 transcript:FBtr0300416[more]
hfp4.764e-938.89gene:FBgn0028577 transcript:FBtr0300418[more]
back to top
BLAST of RNA-binding protein 8A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm8a5.965e-5256.67RNA binding motif protein 8A [Source:NCBI gene;Acc... [more]
cstf27.504e-1241.33cleavage stimulation factor, 3' pre-RNA, subunit 2... [more]
cstf28.293e-1241.33cleavage stimulation factor, 3' pre-RNA, subunit 2... [more]
tra2a7.831e-1128.10transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
tra2a7.831e-1128.10transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of RNA-binding protein 8A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm3ap4.526e-1241.33minichromosome maintenance complex component 3 ass... [more]
mcm3ap4.562e-1241.33minichromosome maintenance complex component 3 ass... [more]
mcm3ap4.804e-1241.33minichromosome maintenance complex component 3 ass... [more]
mcm3ap9.231e-1239.29minichromosome maintenance complex component 3 ass... [more]
mcm3ap1.077e-1139.29minichromosome maintenance complex component 3 ass... [more]
back to top
BLAST of RNA-binding protein 8A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbm8a1.413e-4854.42RNA binding motif protein 8a [Source:MGI Symbol;Ac... [more]
Rbm8a23.373e-4853.74RNA binding motif protein 8A2 [Source:MGI Symbol;A... [more]
Rbm8a5.395e-4854.05RNA binding motif protein 8a [Source:MGI Symbol;Ac... [more]
Rbm8a2.301e-4753.42RNA binding motif protein 8a [Source:MGI Symbol;Ac... [more]
Rbm8a5.083e-4364.77RNA binding motif protein 8a [Source:MGI Symbol;Ac... [more]
back to top
BLAST of RNA-binding protein 8A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B5DGI7|RBM8A_SALSA6.633e-5655.33RNA-binding protein 8A OS=Salmo salar OX=8030 GN=r... [more]
sp|Q5D018|RBM8A_DANRE4.503e-5156.67RNA-binding protein 8A OS=Danio rerio OX=7955 GN=r... [more]
sp|Q9V535|RBM8A_DROME1.029e-4953.69RNA-binding protein 8A OS=Drosophila melanogaster ... [more]
sp|Q27W01|RBM8A_RAT9.884e-4854.42RNA-binding protein 8A OS=Rattus norvegicus OX=101... [more]
sp|Q9CWZ3|RBM8A_MOUSE9.884e-4854.42RNA-binding protein 8A OS=Mus musculus OX=10090 GN... [more]
back to top
BLAST of RNA-binding protein 8A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A075AAL24.233e-5758.70RNA-binding protein 8A OS=Opisthorchis viverrini O... [more]
A0A504YL455.256e-5758.70RNA-binding protein 8A OS=Fasciola gigantica OX=46... [more]
A0A183BCN32.665e-5560.77RNA-binding protein 8A OS=Echinostoma caproni OX=2... [more]
A0A2H1C0953.498e-5560.00RNA-binding protein 8A OS=Fasciola hepatica OX=619... [more]
A0A0R3WQ117.884e-5558.39RNA-binding protein 8A OS=Hydatigena taeniaeformis... [more]
back to top
BLAST of RNA-binding protein 8A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm8a4.870e-4855.10RNA binding motif protein 8A [Source:NCBI gene;Acc... [more]
cstf26.859e-1241.33cleavage stimulation factor subunit 2 [Source:NCBI... [more]
cstf27.013e-1241.33cleavage stimulation factor subunit 2 [Source:NCBI... [more]
cstf28.501e-1241.33cleavage stimulation factor subunit 2 [Source:NCBI... [more]
tra2a1.352e-1026.45transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of RNA-binding protein 8A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002832.11.323e-4063.95pep scaffold:Pmarinus_7.0:GL476732:699988:701739:-... [more]
ENSPMAT00000010908.13.109e-1034.72pep scaffold:Pmarinus_7.0:GL483688:3845:10066:1 ge... [more]
tia1l1.014e-830.00cytotoxic granule-associated RNA binding protein 1... [more]
sf3b44.877e-835.37splicing factor 3b, subunit 4 [Source:ZFIN;Acc:ZDB... [more]
ncl2.122e-731.11nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986][more]
back to top
BLAST of RNA-binding protein 8A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SGN12.359e-1141.67Cytoplasmic RNA-binding protein; contains an RNA r... [more]
RNA153.583e-932.00Component of the cleavage and polyadenylation fact... [more]
PUB12.504e-826.67Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
MRD11.151e-742.11Essential conserved small ribosomal subunit (40s) ... [more]
PAB17.097e-732.00Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
back to top
BLAST of RNA-binding protein 8A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO457021.026e-4466.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479281.806e-4265.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301492.315e-4265.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492823.930e-828.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348794.045e-829.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RNA-binding protein 8A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm8a7.709e-5156.00RNA binding motif protein 8A [Source:NCBI gene;Acc... [more]
cstf28.971e-1241.33cleavage stimulation factor subunit 2 [Source:NCBI... [more]
cstf29.187e-1241.33cleavage stimulation factor subunit 2 [Source:NCBI... [more]
tra2a8.387e-1134.25transformer-2 protein homolog alpha [Source:NCBI g... [more]
ENSORLT00000019586.21.450e-832.50nucleolysin TIA-1 [Source:NCBI gene;Acc:101158614][more]
back to top
BLAST of RNA-binding protein 8A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051885.11.240e-111100.00SMESG000051885.1[more]
SMESG000052090.12.158e-932.56SMESG000052090.1[more]
SMESG000016033.18.369e-927.63SMESG000016033.1[more]
SMESG000009931.17.892e-834.67SMESG000009931.1[more]
SMESG000073310.12.947e-727.78SMESG000073310.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004754 ID=SMED30004754|Name=RNA-binding protein 8A|organism=Schmidtea mediterranea sexual|type=transcript|length=622bp
TATAATAAGTTTGTTTAATTATTTTAACTTACAATAAATTTAAATTCCAA
ATGGCTGATGCTGAAAAAGAAGAAACTGTTATGGACATTGATGGGGACGA
AAAAATAATTGAATTAAAGGAAAATGTTAAAAGTAGAAAAGGAAGAGGAT
TTGAAAGCGAACAGCGACATGATCGCAATACTAAATTTGAGGCGCTAAGT
GATAATGATGATGTTACAGGACCTGGTCCCCAAAGATCTGTTGAAGGATG
GATTATTTTTATTCGTAATATTCATGAAGAAGCAACTGAAGAAGATGTTA
GAGATAAATTTTCAGAGTTCGGGGAAATCAAAAATTTACATATGAATTTT
GATAGACGCACTGGTTACATTAAAGGATATGTTTTAATTGAATATGAAAC
ATTTGCTGAAGCTCAGAATGCTTTAAAAACAATGAATGGAGCTGAAATGT
ATGGCGAAAAAGTCAATGTTGATTGGGCATTTGTTAAAGGACCTAATATG
AAATCTATTTCTAAGAAAAAGAAAAGTACCAATAAAACCCGCAGTAGAAG
TCGATCTGCTGAACATAAAAGACATTAATTTTAATATAATATTATTGTTT
ACAGTTCTAAAAAGATCGGAAG
back to top

protein sequence of SMED30004754-orf-1

>SMED30004754-orf-1 ID=SMED30004754-orf-1|Name=SMED30004754-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=176bp
MADAEKEETVMDIDGDEKIIELKENVKSRKGRGFESEQRHDRNTKFEALS
DNDDVTGPGPQRSVEGWIIFIRNIHEEATEEDVRDKFSEFGEIKNLHMNF
DRRTGYIKGYVLIEYETFAEAQNALKTMNGAEMYGEKVNVDWAFVKGPNM
KSISKKKKSTNKTRSRSRSAEHKRH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000398mRNA splicing, via spliceosome
GO:0006396RNA processing
GO:0000184nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000381regulation of alternative mRNA splicing, via spliceosome
GO:0006397mRNA processing
GO:0006417regulation of translation
GO:0006810transport
GO:0008380RNA splicing
GO:0051028mRNA transport
Vocabulary: cellular component
TermDefinition
GO:0005681spliceosomal complex
GO:0071006U2-type catalytic step 1 spliceosome
GO:0005737cytoplasm
GO:0005634nucleus
GO:0016607nuclear speck
GO:0035145exon-exon junction complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR033744RRM_RBM8
IPR035979RBD_domain_sf
IPR008111RNA-bd_8
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003729mRNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008111RNA-binding motif protein 8PRINTSPR01738RNABINDINGM8coord: 23..35
score: 63.85
coord: 132..144
score: 43.08
coord: 58..72
score: 78.67
coord: 114..130
score: 54.12
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 68..141
e-value: 6.1E-21
score: 85.6
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 69..138
e-value: 2.8E-17
score: 62.3
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 67..145
score: 16.534
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 1..158
e-value: 4.6E-36
score: 126.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 149..175
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 27..49
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 27..58
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 151..175
NoneNo IPR availablePANTHERPTHR45894:SF1RNA-BINDING PROTEIN 8Acoord: 7..171
NoneNo IPR availablePANTHERPTHR45894FAMILY NOT NAMEDcoord: 7..171
IPR033744RBM8, RNA recognition motifCDDcd12324RRM_RBM8coord: 61..148
e-value: 9.23523E-55
score: 166.239
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 60..164