Cell cycle control protein 50A

Overview
NameCell cycle control protein 50A
Smed IDSMED30004751
Length (bp)1410
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cell cycle control protein 50A (SMED30004751) t-SNE clustered cells

Violin plots show distribution of expression levels for Cell cycle control protein 50A (SMED30004751) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cell cycle control protein 50A (SMED30004751) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cell cycle control protein 50A (SMED30004751) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004751

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30004751SMESG000035028.1 dd_Smed_v4_6430_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004751SMESG000035028.1 dd_Smed_v4_6430_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004751SMESG000035028.1 dd_Smed_v4_6430_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cell cycle control protein 50A vs. Ensembl Human
Match: TMEM30A (transmembrane protein 30A [Source:HGNC Symbol;Acc:HGNC:16667])

HSP 1 Score: 208.764 bits (530), Expect = 1.638e-62
Identity = 140/335 (41.79%), Postives = 185/335 (55.22%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTL-ITVPWTSTGIAWPSETNVRYGKPTSWAN-------TMKPPNW--PISALDRSPDAYSG-DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINE 1063
            ++RP+ +AF QQ+L  W+PI+    +   FF IG+IF+ +G  +   S  I E+ IDYT    S    C+  L  +        C C IN T+    +  VF YYGL+NF+QNHRRYVKSRDD QL G    LLN    C+PY+  N    I  APCG IANS+FNDT +L  + ND+  I +     GIAW ++ NV++  P    N       T KP NW  P+  LD  PD     +ED +VWMRTAALP F+K++R  I         +P G Y L++ Y+YPV  F G K   LST + +GGKN  LGI ++ VG   F L V  + IN 
Sbjct:   25 TRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPS--SPCNKCLSPD-----VTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYR-RNEDKPI--APCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYR-LIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINH 348          
BLAST of Cell cycle control protein 50A vs. Ensembl Human
Match: TMEM30B (transmembrane protein 30B [Source:HGNC Symbol;Acc:HGNC:27254])

HSP 1 Score: 199.519 bits (506), Expect = 3.633e-59
Identity = 124/346 (35.84%), Postives = 182/346 (52.60%), Query Frame = 2
Query:   71 MNLDENVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQ--NDTLITVPWTSTGIAWPSETNVRYGKPT--------SWANTMKPPNWPISALDRSPDAYSG---DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVG----LSYFALAVCFV 1051
            M        + +P+ +AF QQ+L  W+P+++       FF  G+ F+ +G  L Y S  I E+  DYT   +     CS              C C    ++P   + PV+ YY LTNF+QN+RRY  SRDD QL GL   L +  + C PYQ   S+  +  APCG IANSLFND+F L + +      + VP   +GIAW ++ +V++  P         ++  T  PPNW     + SPD  +    ++D +VWMRTAALP F+K++ +       +  G+PRG Y ++I Y+YPV  F G K    S+ + +GGKN  LGI +LVVG    L+ F + V ++
Sbjct:    1 MTWSATARGAHQPDNTAFTQQRLPAWQPLLSASIALPLFFCAGLAFIGLGLGLYYSSNGIKELEYDYTG--DPGTGNCSVCAAAGQGRALPPPCSCAWYFSLPELFQGPVYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPYQ--RSAAGLPIAPCGAIANSLFNDSFSLWHQRQPGGPYVEVPLDRSGIAWWTDYHVKFRNPPLVNGSLALAFQGTAPPPNWRRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGN--YSAGLPRGAYRVNITYNYPVRAFGGHKLLIFSSISWMGGKNPFLGIAYLVVGSLCILTGFVMLVVYI 340          
BLAST of Cell cycle control protein 50A vs. Ensembl Human
Match: TMEM30A (transmembrane protein 30A [Source:HGNC Symbol;Acc:HGNC:16667])

HSP 1 Score: 180.259 bits (456), Expect = 4.114e-52
Identity = 109/240 (45.42%), Postives = 139/240 (57.92%), Query Frame = 2
Query:  383 DIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTL-ITVPWTSTGIAWPSETNVRYGKPTSWAN-------TMKPPNW--PISALDRSPDAYSG-DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINE 1063
            +I+  VF YYGL+NF+QNHRRYVKSRDD QL G    LLN    C+PY+  N    I  APCG IANS+FNDT +L  + ND+  I +     GIAW ++ NV++  P    N       T KP NW  P+  LD  PD     +ED +VWMRTAALP F+K++R  I         +P G Y L++ Y+YPV  F G K   LST + +GGKN  LGI ++ VG   F L V  + IN 
Sbjct:   77 EIEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYR-RNEDKPI--APCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYR-LIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINH 312          
BLAST of Cell cycle control protein 50A vs. Ensembl Human
Match: TMEM30A (transmembrane protein 30A [Source:HGNC Symbol;Acc:HGNC:16667])

HSP 1 Score: 175.252 bits (443), Expect = 3.507e-51
Identity = 106/232 (45.69%), Postives = 134/232 (57.76%), Query Frame = 2
Query:  407 YYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTL-ITVPWTSTGIAWPSETNVRYGKPTSWAN-------TMKPPNW--PISALDRSPDAYSG-DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINE 1063
            YYGL+NF+QNHRRYVKSRDD QL G    LLN    C+PY+  N    I  APCG IANS+FNDT +L  + ND+  I +     GIAW ++ NV++  P    N       T KP NW  P+  LD  PD     +ED +VWMRTAALP F+K++R  I         +P G Y L++ Y+YPV  F G K   LST + +GGKN  LGI ++ VG   F L V  + IN 
Sbjct:    2 YYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYR-RNEDKPI--APCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYR-LIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINH 229          
BLAST of Cell cycle control protein 50A vs. Ensembl Human
Match: TMEM30A (transmembrane protein 30A [Source:HGNC Symbol;Acc:HGNC:16667])

HSP 1 Score: 175.252 bits (443), Expect = 3.507e-51
Identity = 106/232 (45.69%), Postives = 134/232 (57.76%), Query Frame = 2
Query:  407 YYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTL-ITVPWTSTGIAWPSETNVRYGKPTSWAN-------TMKPPNW--PISALDRSPDAYSG-DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINE 1063
            YYGL+NF+QNHRRYVKSRDD QL G    LLN    C+PY+  N    I  APCG IANS+FNDT +L  + ND+  I +     GIAW ++ NV++  P    N       T KP NW  P+  LD  PD     +ED +VWMRTAALP F+K++R  I         +P G Y L++ Y+YPV  F G K   LST + +GGKN  LGI ++ VG   F L V  + IN 
Sbjct:    2 YYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYR-RNEDKPI--APCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYR-LIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINH 229          
BLAST of Cell cycle control protein 50A vs. Ensembl Celegans
Match: chat-1 (CDC50 family protein chat-1 [Source:UniProtKB/Swiss-Prot;Acc:H2L0H3])

HSP 1 Score: 214.927 bits (546), Expect = 1.684e-65
Identity = 130/334 (38.92%), Postives = 181/334 (54.19%), Query Frame = 2
Query:   95 ISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLIT-VPWTSTGIAWPSETNVRYGKP--------TSWANTMKPPNWPISALDRSPDAYSGDE--DLLVWMRTAALPNFKKMHRKFIHNFDP-FLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFIN 1060
            +  RP ASA  QQKL  W+PI+    +    F IG IF+ +G  L   S  + E  ++YTNCL+                     CQ +IN+  P      VF YY L N++QNHRRYVKSR+D+Q  G    +   +C P+    ++     APCG IANS+FNDTF L +  +  ++T VP T+ G+ W  + + ++  P         ++ NT KPPNW      ++P    G E  D +VWMRTAALP FKK+ R      +P F NG+P+G Y+L++  +YPV  F G K F +STT+  GGKN+ LGI +LVVG     L V F+ I+
Sbjct:   27 LKNRPKASALRQQKLPAWQPILTATTVIPTVFVIGAIFLPIGVFLFIASDAVSEFTVEYTNCLSP--------------------CQLQINL--PNAFDGDVFLYYNLENYYQNHRRYVKSRNDQQYLGDLTNV--KDCAPFDIDPATKK-PIAPCGAIANSIFNDTFTLAHRADTGIVTMVPVTTQGVIWNVDKDRKFKNPPLNDGNLCDAFNNTTKPPNW-----SKNPCEVGGFENVDFIVWMRTAALPYFKKLWRIVDRTTNPLFSNGLPQGTYILTVENNYPVQSFGGKKEFVISTTSWAGGKNSFLGIAYLVVGSLAIVLGVVFIVIH 330          
BLAST of Cell cycle control protein 50A vs. Ensembl Celegans
Match: chat-1 (CDC50 family protein chat-1 [Source:UniProtKB/Swiss-Prot;Acc:H2L0H3])

HSP 1 Score: 214.927 bits (546), Expect = 1.684e-65
Identity = 130/334 (38.92%), Postives = 181/334 (54.19%), Query Frame = 2
Query:   95 ISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLIT-VPWTSTGIAWPSETNVRYGKP--------TSWANTMKPPNWPISALDRSPDAYSGDE--DLLVWMRTAALPNFKKMHRKFIHNFDP-FLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFIN 1060
            +  RP ASA  QQKL  W+PI+    +    F IG IF+ +G  L   S  + E  ++YTNCL+                     CQ +IN+  P      VF YY L N++QNHRRYVKSR+D+Q  G    +   +C P+    ++     APCG IANS+FNDTF L +  +  ++T VP T+ G+ W  + + ++  P         ++ NT KPPNW      ++P    G E  D +VWMRTAALP FKK+ R      +P F NG+P+G Y+L++  +YPV  F G K F +STT+  GGKN+ LGI +LVVG     L V F+ I+
Sbjct:   27 LKNRPKASALRQQKLPAWQPILTATTVIPTVFVIGAIFLPIGVFLFIASDAVSEFTVEYTNCLSP--------------------CQLQINL--PNAFDGDVFLYYNLENYYQNHRRYVKSRNDQQYLGDLTNV--KDCAPFDIDPATKK-PIAPCGAIANSIFNDTFTLAHRADTGIVTMVPVTTQGVIWNVDKDRKFKNPPLNDGNLCDAFNNTTKPPNW-----SKNPCEVGGFENVDFIVWMRTAALPYFKKLWRIVDRTTNPLFSNGLPQGTYILTVENNYPVQSFGGKKEFVISTTSWAGGKNSFLGIAYLVVGSLAIVLGVVFIVIH 330          
BLAST of Cell cycle control protein 50A vs. Ensembl Celegans
Match: F20C5.4 (pep chromosome:WBcel235:IV:8764867:8767450:1 gene:WBGene00008969.1 transcript:F20C5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F20C5.4)

HSP 1 Score: 184.111 bits (466), Expect = 1.343e-53
Identity = 112/338 (33.14%), Postives = 176/338 (52.07%), Query Frame = 2
Query:  104 RPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTN-SSNSIGYAPCGIIANSLFNDTFQLDYLQN---DTLITVPWTSTGIAWPSETNVRYGKPTS---------WANTMKPPNW--PISALDRS---PDAYSGDE--DLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFI 1057
            +P  + + QQKL   +P     +        G+  + +G  L +     +E  I YT+C  S+G Q S ++         Q+ +C   +T+  D    V  YYGL+ F+QN+R Y  SR+D+QL+G         C P +Y + +   +  APCG +A+S+FNDTF+L Y+ +   + +  VPWT+ G+   +E   ++  P           +A TM PP+W  PI  L  +   PD   G E  D +VWM+ AALP F+K++R      D F NG+P+G Y L+INY+YPV  + G K F ++  N +G +N  L +++LVVG     + + F+ I
Sbjct:   17 QPKDTPWKQQKLPALRPHYNITSAIPVTLITGVATLAMGIALYFGHNGSLEQEIVYTDCALSNGTQASRIMRTEMGN---QTFKCAYTITLNDDYTGEVKFYYGLSKFYQNNRLYFNSRNDQQLRGKVTE--TDGCDPLEYVDVNGTKVPIAPCGKVADSMFNDTFELFYINDKASNAVTRVPWTTRGVLGATEMKRKFRNPIRAENQTLCDVFAGTMPPPSWRYPICQLGLNSIDPDVGIGFENIDFMVWMKVAALPKFRKLYRILNRQVDMFSNGLPKGQYQLTINYNYPVDMYSGDKYFVIANENWVGPRNLFLPVIYLVVGTFLLLVTILFILI 349          
BLAST of Cell cycle control protein 50A vs. Ensembl Celegans
Match: chat-1 (CDC50 family protein chat-1 [Source:UniProtKB/Swiss-Prot;Acc:H2L0H3])

HSP 1 Score: 105.916 bits (263), Expect = 1.004e-26
Identity = 63/153 (41.18%), Postives = 88/153 (57.52%), Query Frame = 2
Query:  635 VPWTSTGIAWPSETNVRYGKP--------TSWANTMKPPNWPISALDRSPDAYSGDE--DLLVWMRTAALPNFKKMHRKFIHNFDP-FLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFIN 1060
            VP T+ G+ W  + + ++  P         ++ NT KPPNW      ++P    G E  D +VWMRTAALP FKK+ R      +P F NG+P+G Y+L++  +YPV  F G K F +STT+  GGKN+ LGI +LVVG     L V F+ I+
Sbjct:    2 VPVTTQGVIWNVDKDRKFKNPPLNDGNLCDAFNNTTKPPNW-----SKNPCEVGGFENVDFIVWMRTAALPYFKKLWRIVDRTTNPLFSNGLPQGTYILTVENNYPVQSFGGKKEFVISTTSWAGGKNSFLGIAYLVVGSLAIVLGVVFIVIH 149          
BLAST of Cell cycle control protein 50A vs. Ensembl Celegans
Match: chat-1 (CDC50 family protein chat-1 [Source:UniProtKB/Swiss-Prot;Acc:H2L0H3])

HSP 1 Score: 105.916 bits (263), Expect = 1.004e-26
Identity = 63/153 (41.18%), Postives = 88/153 (57.52%), Query Frame = 2
Query:  635 VPWTSTGIAWPSETNVRYGKP--------TSWANTMKPPNWPISALDRSPDAYSGDE--DLLVWMRTAALPNFKKMHRKFIHNFDP-FLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFIN 1060
            VP T+ G+ W  + + ++  P         ++ NT KPPNW      ++P    G E  D +VWMRTAALP FKK+ R      +P F NG+P+G Y+L++  +YPV  F G K F +STT+  GGKN+ LGI +LVVG     L V F+ I+
Sbjct:    2 VPVTTQGVIWNVDKDRKFKNPPLNDGNLCDAFNNTTKPPNW-----SKNPCEVGGFENVDFIVWMRTAALPYFKKLWRIVDRTTNPLFSNGLPQGTYILTVENNYPVQSFGGKKEFVISTTSWAGGKNSFLGIAYLVVGSLAIVLGVVFIVIH 149          
BLAST of Cell cycle control protein 50A vs. Ensembl Fly
Match: CDC50 (gene:FBgn0030752 transcript:FBtr0074301)

HSP 1 Score: 253.062 bits (645), Expect = 5.887e-80
Identity = 143/340 (42.06%), Postives = 195/340 (57.35%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQ-CSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPTSWANTM-----KPPNWPISALDRSPDAYSGD----EDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINEFDSRQQSE 1087
            SKRP+ SAF QQ+L  W+P++  + +   FF IG++F+ +G VL + S    E+ IDYT C  S G   C++ L  N       +C C++   +P+D    V+ YYGLTN++QNHRRYVKSRDD+QL G      +++C P+ Y   S     APCG IANSLFNDT  L  LQ  + I +    TGIAWPS+  V++  P    N       KP  W     D  P+    +    EDL+VWMRTAALP+F+K++R+       + NG+  G Y L+I Y+YPV  F G K   LSTT++LGGKN  LGI ++VVG     L +  +FI+   SR   E
Sbjct:   16 SKRPSDSAFKQQRLPAWQPVLTARTVLPTFFVIGVLFIPIGVVLLHLSNTANELIIDYTKCRRSGGNTTCAEYLEANPGV----TCPCEVPFVLPSDFNGVVYMYYGLTNYYQNHRRYVKSRDDEQLLGHLSQTPSTDCAPFAYDPDSGK-PIAPCGAIANSLFNDTLTL--LQGGSEIKL--LKTGIAWPSDKRVKFRNPEGNLNVSLEGFSKPIFWQKGLADLDPENPDNNGFQNEDLIVWMRTAALPSFRKLYRRLNQTNTNYANGLKSGNYTLNIKYNYPVVSFDGTKRMILSTTSVLGGKNPFLGIAYIVVGAICITLGLALLFIHMRCSRSNME 346          
BLAST of Cell cycle control protein 50A vs. Ensembl Fly
Match: CDC50 (gene:FBgn0030752 transcript:FBtr0343350)

HSP 1 Score: 251.521 bits (641), Expect = 1.649e-79
Identity = 142/336 (42.26%), Postives = 194/336 (57.74%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQ-CSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPTSWANTM-----KPPNWPISALDRSPDAYSGD----EDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINEFDSR 1075
            SKRP+ SAF QQ+L  W+P++  + +   FF IG++F+ +G VL + S    E+ IDYT C  S G   C++ L  N       +C C++   +P+D    V+ YYGLTN++QNHRRYVKSRDD+QL G      +++C P+ Y   S     APCG IANSLFNDT  L  LQ  + I +    TGIAWPS+  V++  P    N       KP  W     D  P+    +    EDL+VWMRTAALP+F+K++R+       + NG+  G Y L+I Y+YPV  F G K   LSTT++LGGKN  LGI ++VVG     L +  +FI+   SR
Sbjct:   16 SKRPSDSAFKQQRLPAWQPVLTARTVLPTFFVIGVLFIPIGVVLLHLSNTANELIIDYTKCRRSGGNTTCAEYLEANPGV----TCPCEVPFVLPSDFNGVVYMYYGLTNYYQNHRRYVKSRDDEQLLGHLSQTPSTDCAPFAYDPDSGK-PIAPCGAIANSLFNDTLTL--LQGGSEIKL--LKTGIAWPSDKRVKFRNPEGNLNVSLEGFSKPIFWQKGLADLDPENPDNNGFQNEDLIVWMRTAALPSFRKLYRRLNQTNTNYANGLKSGNYTLNIKYNYPVVSFDGTKRMILSTTSVLGGKNPFLGIAYIVVGAICITLGLALLFIHMRCSR 342          
BLAST of Cell cycle control protein 50A vs. Ensembl Zebrafish
Match: tmem30aa (transmembrane protein 30Aa [Source:ZFIN;Acc:ZDB-GENE-040704-26])

HSP 1 Score: 228.409 bits (581), Expect = 3.459e-70
Identity = 140/339 (41.30%), Postives = 192/339 (56.64%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNC-LNSDGQQCSDVLLKNNYTYRYQS-CQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQ-NDTLITVPWTSTGIAWPSETNVRYGKPTS--------WANTMKPPNW--PISALDRSPDAYSG--DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINE 1063
            SK+P+ +AF QQ+L  W+PI+    +   FF IG+IF+ +G  L   S  I E  IDYT   ++S    C+      NY++   S C C +  T+    +S VF YYGL+NF+QNHRRYVKSRDD QL G    LLN    C+PY+   +S+    APCG IANSLFNDT +L Y+  N + I +    TGIAW ++ +V++  P          + +T KP NW   +  LD +    +G  +EDL+VWMRTAALP F+K++R      D     +P G Y L + Y+YPV  F G K   LST + +GGKN  LGI ++ VG   F L V  + I+ 
Sbjct:   29 SKKPDNTAFKQQRLPAWQPILTAGTVLPAFFMIGLIFIPIGIGLFVTSNNIKEFEIDYTGVDMSSPCYNCAQ-----NYSWNSTSVCTCTVPFTLDQPFESNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDKSSLLNPSKECEPYR---TSDRKPIAPCGAIANSLFNDTLELFYIHPNGSKIGIHLVKTGIAWWTDKHVKFRNPGGSNNNLSVVFQDTSKPVNWRKAVYELDPADPENNGFVNEDLIVWMRTAALPTFRKLYRIIQKKKDTMTPTLPPGNYSLEVAYNYPVRSFDGRKRVILSTISWMGGKNPFLGIAYITVGSVCFFLGVVLLIIHH 359          
BLAST of Cell cycle control protein 50A vs. Ensembl Zebrafish
Match: tmem30ab (transmembrane protein 30Ab [Source:ZFIN;Acc:ZDB-GENE-030131-5884])

HSP 1 Score: 227.254 bits (578), Expect = 9.734e-70
Identity = 137/347 (39.48%), Postives = 197/347 (56.77%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNC-LNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLL--NSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQ-NDTLITVPWTSTGIAWPSETNVRYGKPTS--------WANTMKPPNW--PISALDRSPDAYSG-DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFI-NEFDSRQQSEE 1090
            +++P+ +AF QQ+L  W+PI+    +   FF IG+IF+ +G  L   S  I E  IDYT   ++S    CS     N+ T     C+C ++ ++    +S VF YYGL+NF+QNHRRYVKSRDD QL G    L   +  C+PY+  ++      APCG IANS+FNDT  L Y+  N T   +P    GIAW ++ +V++  P          + +T KP NW  P+  LD  P+     +ED +VWMRTAALP F+K++R  I   +     +PRG Y L + Y+YPV  F+G K   LST + +GGKN  LGI ++ VG   F L V  +FI +++ +R  S +
Sbjct:   28 TRKPDNTAFKQQRLPAWQPILTAGTVLPAFFVIGLIFIPIGIGLYVTSNNIKEFEIDYTGTDMSSPCFNCSQSFSWNSTT----PCKCTLSFSLDQPFESNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDERSLKEPSKECEPYRINDNKR---IAPCGAIANSMFNDTLDLFYIDPNGTKTQIPMIKKGIAWWTDKHVKFRNPGGNNPNLTAVFIDTAKPINWRKPVYELDTDPENNGFINEDFIVWMRTAALPTFRKLYR-IIQKKNNMTPTLPRGNYSLEVTYNYPVRSFEGRKRMILSTISWMGGKNPFLGIAYITVGSICFFLGVVLLFIHHKYGNRNNSSD 366          
BLAST of Cell cycle control protein 50A vs. Ensembl Zebrafish
Match: tmem30b (transmembrane protein 30B [Source:ZFIN;Acc:ZDB-GENE-040704-17])

HSP 1 Score: 201.445 bits (511), Expect = 2.847e-60
Identity = 123/335 (36.72%), Postives = 183/335 (54.63%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTN-CLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKG--LYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPT--------SWANTMKPPNWPISA--LDRSPDAYSG--DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFI 1057
            ++RP+ +AF QQ+L  W+PI++   +   F  IG+ F+ +G  L   S  I  + +DYT    +S   +CS            Q+C C+I  ++      PVF YYGL+N++QN R+Y  S D  QL G   Y     S C PY Y N +  I   PCG IANS+FNDTF+L  + N T   VP    GIAW ++ N++Y  P+        ++A T+KP NWP  A  LD +    +G  ++D LVWMR AALP F+K++R+       +  G+P G Y ++++Y+YPV  F G K    S  + +GG+N  LGI +LVVG     +++  + +
Sbjct:    8 AQRPDNTAFTQQRLPAWQPILSAGIVIPGFLVIGLAFIGIGVGLFLTSQTIQVLEMDYTGVATDSSCFRCS--------MTSSQNCTCEITFSLDKLFTGPVFFYYGLSNYYQNFRKYGVSLDYYQLSGDTQYFTSPQSVCSPYSYDNQNRPI--VPCGAIANSMFNDTFELYQIINGTKNLVPLDGKGIAWWTDYNIKYRNPSFVNGSLANAFAGTVKPINWPKPAYDLDSTDPNNNGFLNQDFLVWMRRAALPQFRKLYRRITEG--NYAAGLPAGNYSMTVHYNYPVLTFDGRKKVVFSNVSWMGGRNDFLGIAYLVVGSLCVVMSIIMLIV 330          
BLAST of Cell cycle control protein 50A vs. Ensembl Zebrafish
Match: tmem30b (transmembrane protein 30B [Source:ZFIN;Acc:ZDB-GENE-040704-17])

HSP 1 Score: 201.445 bits (511), Expect = 2.847e-60
Identity = 123/335 (36.72%), Postives = 183/335 (54.63%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTN-CLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKG--LYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPT--------SWANTMKPPNWPISA--LDRSPDAYSG--DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFI 1057
            ++RP+ +AF QQ+L  W+PI++   +   F  IG+ F+ +G  L   S  I  + +DYT    +S   +CS            Q+C C+I  ++      PVF YYGL+N++QN R+Y  S D  QL G   Y     S C PY Y N +  I   PCG IANS+FNDTF+L  + N T   VP    GIAW ++ N++Y  P+        ++A T+KP NWP  A  LD +    +G  ++D LVWMR AALP F+K++R+       +  G+P G Y ++++Y+YPV  F G K    S  + +GG+N  LGI +LVVG     +++  + +
Sbjct:    8 AQRPDNTAFTQQRLPAWQPILSAGIVIPGFLVIGLAFIGIGVGLFLTSQTIQVLEMDYTGVATDSSCFRCS--------MTSSQNCTCEITFSLDKLFTGPVFFYYGLSNYYQNFRKYGVSLDYYQLSGDTQYFTSPQSVCSPYSYDNQNRPI--VPCGAIANSMFNDTFELYQIINGTKNLVPLDGKGIAWWTDYNIKYRNPSFVNGSLANAFAGTVKPINWPKPAYDLDSTDPNNNGFLNQDFLVWMRRAALPQFRKLYRRITEG--NYAAGLPAGNYSMTVHYNYPVLTFDGRKKVVFSNVSWMGGRNDFLGIAYLVVGSLCVVMSIIMLIV 330          
BLAST of Cell cycle control protein 50A vs. Ensembl Zebrafish
Match: tmem30c (transmembrane protein 30C [Source:ZFIN;Acc:ZDB-GENE-040426-1127])

HSP 1 Score: 199.904 bits (507), Expect = 1.785e-59
Identity = 124/352 (35.23%), Postives = 184/352 (52.27%), Query Frame = 2
Query:   95 ISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKG----LYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQ-NDTLITVPWTSTGIAWPSETNVRYGKP---------TSWANTMKPPNWPISA--LDRSPDAYSG--DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCF--VFINEFDSRQQSEE 1090
            +S+RP+ SAF QQ+L  W P +  + +   F+ + ++ +++G  L        ++ +DYT+      ++C ++   N  T     C C +N  +P      VF YYGL NF QN RRY+ SRDD Q+ G    L  P  +S C P+ Y   +N +  APCG +ANS+FND+F L Y Q N   + VP    GIAW ++ NV++  P          ++  T +P  W  S   LD +    +G  ++DL+VWMR AA PNFKK++       +PF  G+P G Y +SINY++PV PF+G K   +S     GG+N  L I +LV        AV    VF+    + +  EE
Sbjct:   11 LSRRPDNSAFKQQRLPAWSPSLTAQTVLPIFYILAVVCLLLGIWLLITVQNTHQLKVDYTDA--GTCERCFELHANNTRTV----CTCSVNFYVPRPFPGDVFFYYGLRNFHQNLRRYMDSRDDAQMVGRKKNLKAP--SSYCAPFHY--DANGVPIAPCGAVANSMFNDSFTLVYHQANGAEVQVPLYRKGIAWYTDKNVKFRNPPTNNTFSLRQAFEGTTRPLYWQHSVYELDDTDSNNNGFINDDLIVWMREAAFPNFKKLYGVLNRAQEPFTEGLPAGNYNISINYNFPVEPFRGRKELVISMVTWFGGQNYFLPIAYLVTSGLILVTAVVLTTVFVKFGKNGKNMEE 352          
BLAST of Cell cycle control protein 50A vs. Ensembl Xenopus
Match: arhgap40 (Rho GTPase activating protein 40 [Source:Xenbase;Acc:XB-GENE-6050151])

HSP 1 Score: 233.032 bits (593), Expect = 7.679e-72
Identity = 147/350 (42.00%), Postives = 194/350 (55.43%), Query Frame = 2
Query:   86 NVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPTS--------WANTMKPPNW--PISALDRSPDAYSG--DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVG-LSYFALAVCFVFINEFDSRQQSEE 1090
            N+  SK+P+ +AF QQ+L  W+PI+    +   FF IGI+F+ +G  +   S  I E  IDYT    S    C   L   N T     C C IN T+    +S VF YYGL+NF+QNHRRYVKSRDD QL G    L N    C+PY+ TN S  I  APCG IANS+FNDT  L  + N     +P    GIAW ++ NV++  PT         +A T KP NW  P+  LD S    +G  +ED +VWMRTAALP F+K++R  I   D     +  G Y L + Y+YPV  F G K   LST + +GGKN  LGI ++ VG + +F   V FV  +++ +R  S +
Sbjct:   23 NLGKSKKPDNTAFKQQRLPAWQPILTAGTVLPAFFIIGIVFIPIGIGIFVTSNNIREFEIDYTGIDPS--SPCYKCL---NVTLNDPPCTCTINFTLDYAFESNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDKNSLTNPSKECEPYR-TNGSKPI--APCGAIANSMFNDTLVLYQIVNGAEKQIPLVKKGIAWWTDKNVKFKNPTGNASNLEAVFAGTTKPINWKKPVYELDPSEPDNNGFINEDFIVWMRTAALPTFRKLYR-LIEKTDATYPTLAPGNYSLVVEYNYPVRSFDGRKRMILSTISWMGGKNPFLGIAYITVGSICFFLGVVLFVIHHKYGNRNNSAD 363          
BLAST of Cell cycle control protein 50A vs. Ensembl Xenopus
Match: btf3l4 (basic transcription factor 3-like 4 [Source:Xenbase;Acc:XB-GENE-948236])

HSP 1 Score: 207.994 bits (528), Expect = 2.401e-62
Identity = 130/349 (37.25%), Postives = 187/349 (53.58%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQS--CQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSN--CQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPTSWANTM--------KPPNWPISALDRSPDAYSG---DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVG--LSYFALAVCFVFINEFDSRQQSEEA 1093
            S+RP+ +AF QQ+L  W+P+++   +   FF  G+ F+ +G  L Y S  I E   DYT  +   G  C        Y  R +S  C C +   I    + PV  YY L+N++QNH RY+ S D KQL GL   L   +  C PYQ+   S ++  APCG +ANS+FND   L Y  N T + VP T  GI+W S+ NV++  PT+   T+        KP NW   A + S D  +    +ED +VWMR AALP+F+K++R+       F  G+P G Y+L I Y+YPV  F G K    S+ + +GGKN  LGI +LV G   + FA+ +  +F+       + E++
Sbjct:   16 SQRPDNTAFTQQRLPAWQPLLSASIVIPFFFFAGLSFIAIGLGLYYSSNSIKESEFDYTGAV--LGDYC--------YNCRNESRGCTCNVPFNITEFFQGPVCMYYELSNYYQNHYRYMISVDPKQLGGLIDNLKAPSNYCSPYQW--DSKNLPIAPCGAVANSMFNDVISLHYKDNGTYVEVPLTRKGISWWSDYNVKFQNPTNGNETLAQVFNGTAKPSNWLTPAYNLSDDPSNTGFINEDFIVWMRRAALPSFRKLYRRIESG--NFTTGLPPGEYLLKIVYNYPVLSFDGRKKIVFSSLSWMGGKNPFLGIAYLVFGSLCTLFAIVILIIFLKTSQKDDEDEDS 350          
BLAST of Cell cycle control protein 50A vs. Ensembl Xenopus
Match: tmem30cp (transmembrane protein 30C, pseudogene [Source:NCBI gene;Acc:448286])

HSP 1 Score: 199.904 bits (507), Expect = 2.760e-59
Identity = 128/342 (37.43%), Postives = 187/342 (54.68%), Query Frame = 2
Query:   89 VNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTN-CLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVP-----LLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTL-ITVPWTSTGIAWPSETNVRYGKP-------TSWANTMKPPNW--PISALDRSP--DAYSGDEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFIN 1060
            V +SK P+ +AF QQ++  W+  ++ K +   FF IG   + VG      +  + E+ I+Y++ C+      CSD  L+ N +   + C C +N T+P +++  VF YYGL NFFQNHRRYV SR D QL G  V        ++NC P  ++   N    APCG IANSLFNDT  L Y    T  I VP   TG  W S+ N+++  P        ++A + +PP W  P   LD  P  + Y  D D ++WMR AA PNF+K++R+ +     F NG+P G Y  SI+Y++PV+ F+G K   L+T +  GG+N  LGI +   G     +AV  + ++
Sbjct:   14 VPVSKCPDNTAFKQQRVPAWRLTLSAKAVLSSFFLIGSFCLAVGISWIVATVNVKEIAINYSDYCVT-----CSD--LRQNSSNSEKPCNCVVNFTVPGELQGDVFMYYGLNNFFQNHRRYVISRYDTQLLGRNVTNSETITKSTNCAP--FSTYQNGTPMAPCGAIANSLFNDTITLYYYTTATTKIPVPLLRTGNTWWSDKNIKFKNPQPVNNLVQAFAGSARPPYWQKPPYLLDSDPYNNGYEND-DFIIWMRVAAFPNFRKLYRR-LSRVQQFANGLPAGNYSYSIDYNFPVSKFKGQKYIYLTTLSWCGGRNLFLGIAYTATGAVVILVAVAMLAVH 344          
BLAST of Cell cycle control protein 50A vs. Ensembl Mouse
Match: Tmem30a (transmembrane protein 30A [Source:MGI Symbol;Acc:MGI:106402])

HSP 1 Score: 214.927 bits (546), Expect = 5.440e-65
Identity = 139/338 (41.12%), Postives = 189/338 (55.92%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDT---LITVPWTSTGIAWPSETNVRYGKP-------TSWANTMKPPNWPISALDRSPDAYSG----DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINE 1063
            ++RP+ +AF QQ+L  W+PI+    +   FF IG+IF+ +G  +   S  I E+ IDYT    S    C+  L  N       SC C IN T+    +  VF YYGL+NF+QNHRRYVKSRDD QL G    LLN    C+PY+  N    I  APCG IANS+FNDT +L  + N++    I +P    GIAW ++ NV++  P         + +T+KP NW  +  +  P+  S     +ED +VWMRTAALP F+K++R  I   D     +P G Y L+I Y+YPV  F G K   LST + +GGKN  LGI ++ +G   F L V  + IN 
Sbjct:   25 TRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPS--SPCNKCLSPN-----VTSCACTINFTLKQSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKECEPYR-RNEDRPI--APCGAIANSMFNDTLELYLVANESDPKPIPIPLKKKGIAWWTDKNVKFRNPPGKESLEEKFKDTIKPVNWHKAVYELDPEDESNNGFINEDFIVWMRTAALPTFRKLYR-LIERRDDLHPTLPAGQYFLNITYNYPVHSFDGRKRMILSTISWMGGKNPFLGIAYITIGSISFLLGVVLLVINH 351          
BLAST of Cell cycle control protein 50A vs. Ensembl Mouse
Match: Tmem30b (transmembrane protein 30B [Source:MGI Symbol;Acc:MGI:2442082])

HSP 1 Score: 206.453 bits (524), Expect = 5.480e-62
Identity = 125/331 (37.76%), Postives = 178/331 (53.78%), Query Frame = 2
Query:   71 MNLDENVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQ--NDTLITVPWTSTGIAWPSETNVRYGKPT--------SWANTMKPPNWPISALDRSPDAYSG---DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVG 1018
            M        + +P+ +AF QQ+L  W+P+++       FF  G+ F+ +G  L Y S  I E+  DYT   N     CS    K         C C  + T+P     PV+ YY L+NF+QN+RRY  SRDD QL GL   L +  + C PYQ+   S+ +  APCG IANSLFND+F L + +  +D  + VP   T IAW ++ +V++  P         ++  T  PPNW     + SPD  +    ++D +VWMRTAALP F+K++ +       +  G+PRG Y ++I Y+YPV  F G K   LS  + +GGKN  LGI +LVVG
Sbjct:    1 MTWSATARGAHQPDNTAFTQQRLPAWQPLLSAGIALPLFFCAGLAFIGLGLGLFYSSNGIKELEYDYTG--NPGTGDCSVCAAKGQGRAPPPGCACSWSFTLPELFPGPVYLYYELSNFYQNNRRYGVSRDDAQLSGLASALRHPANECAPYQF--RSDGLPIAPCGAIANSLFNDSFSLWHQRQPSDPFVEVPLDRTAIAWWTDYHVKFRNPPLVNGSLALAFRGTAPPPNWHRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGN--YSAGLPRGTYRVNITYNYPVRAFGGHKLIILSNISWMGGKNPFLGIAYLVVG 325          
BLAST of Cell cycle control protein 50A vs. Ensembl Mouse
Match: Tmem30a (transmembrane protein 30A [Source:MGI Symbol;Acc:MGI:106402])

HSP 1 Score: 183.341 bits (464), Expect = 2.325e-53
Identity = 106/243 (43.62%), Postives = 142/243 (58.44%), Query Frame = 2
Query:  383 DIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDT---LITVPWTSTGIAWPSETNVRYGKP-------TSWANTMKPPNWPISALDRSPDAYSG----DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINE 1063
            +I+  VF YYGL+NF+QNHRRYVKSRDD QL G    LLN    C+PY+  N    I  APCG IANS+FNDT +L  + N++    I +P    GIAW ++ NV++  P         + +T+KP NW  +  +  P+  S     +ED +VWMRTAALP F+K++R  I   D     +P G Y L+I Y+YPV  F G K   LST + +GGKN  LGI ++ +G   F L V  + IN 
Sbjct:   77 EIEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKECEPYR-RNEDRPI--APCGAIANSMFNDTLELYLVANESDPKPIPIPLKKKGIAWWTDKNVKFRNPPGKESLEEKFKDTIKPVNWHKAVYELDPEDESNNGFINEDFIVWMRTAALPTFRKLYR-LIERRDDLHPTLPAGQYFLNITYNYPVHSFDGRKRMILSTISWMGGKNPFLGIAYITIGSISFLLGVVLLVINH 315          
BLAST of Cell cycle control protein 50A vs. Ensembl Mouse
Match: Tmem30c (transmembrane protein 30C [Source:MGI Symbol;Acc:MGI:1918277])

HSP 1 Score: 161.77 bits (408), Expect = 3.736e-45
Identity = 113/346 (32.66%), Postives = 179/346 (51.73%), Query Frame = 2
Query:   71 MNLDENVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDY-LQNDTLITVPWTSTGIAWPSETNVRYGKPTS------WANTMKPPNW--PISALDRSPDAYSG--DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVG----LSYFALAVCFVFINE 1063
            M +    ++S+ P  +A  QQ L   +  ++   +   FF  G   + +G +L   +    ++ I+YT    +  Q      L+ N +   ++C C +   +P  ++  V+ YY L  F+QN  +Y+ SR + QL G  +    +NC P+Q +++   I   PCG IANS+FNDT  L Y L + T I VP   +G+ W ++  V++  P S      +A + KP +W  PI  LD      +G  +ED +VWMRTAA P FKK++R+ +     F  G+P G Y LSI+Y++PVT FQG K+  LST   +GG    LG+ + V G    L+ FA+    + +  
Sbjct:    1 MEMMPQYDLSRLPENTALKQQTLPTQQLNLSASVVLSIFFITGGFCLSIGIILLLSAKSTKKIEINYTKTCANCAQ------LRENSSNFDKACNCSLPFYLPEKMEGDVYMYYKLYGFYQNLYQYILSRSNSQLVGKDI-WDTTNCDPFQVSHNDTPI--IPCGAIANSIFNDTITLSYNLNSSTQIEVPMLKSGLTWWTDKYVKFRNPRSSNFTSTFAGSSKPLHWAKPIYELDLDDPGNNGFLNEDFIVWMRTAAFPTFKKLYRR-LKRVHAFAEGLPAGNYSLSISYNFPVTMFQGEKSIVLSTLTWIGGGGLFLGLTYTVTGALTLLASFAILTIHLMLKR 336          
BLAST of Cell cycle control protein 50A vs. Ensembl Mouse
Match: Tmem30c (transmembrane protein 30C [Source:MGI Symbol;Acc:MGI:1918277])

HSP 1 Score: 161.77 bits (408), Expect = 3.736e-45
Identity = 113/346 (32.66%), Postives = 179/346 (51.73%), Query Frame = 2
Query:   71 MNLDENVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDY-LQNDTLITVPWTSTGIAWPSETNVRYGKPTS------WANTMKPPNW--PISALDRSPDAYSG--DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVG----LSYFALAVCFVFINE 1063
            M +    ++S+ P  +A  QQ L   +  ++   +   FF  G   + +G +L   +    ++ I+YT    +  Q      L+ N +   ++C C +   +P  ++  V+ YY L  F+QN  +Y+ SR + QL G  +    +NC P+Q +++   I   PCG IANS+FNDT  L Y L + T I VP   +G+ W ++  V++  P S      +A + KP +W  PI  LD      +G  +ED +VWMRTAA P FKK++R+ +     F  G+P G Y LSI+Y++PVT FQG K+  LST   +GG    LG+ + V G    L+ FA+    + +  
Sbjct:    1 MEMMPQYDLSRLPENTALKQQTLPTQQLNLSASVVLSIFFITGGFCLSIGIILLLSAKSTKKIEINYTKTCANCAQ------LRENSSNFDKACNCSLPFYLPEKMEGDVYMYYKLYGFYQNLYQYILSRSNSQLVGKDI-WDTTNCDPFQVSHNDTPI--IPCGAIANSIFNDTITLSYNLNSSTQIEVPMLKSGLTWWTDKYVKFRNPRSSNFTSTFAGSSKPLHWAKPIYELDLDDPGNNGFLNEDFIVWMRTAAFPTFKKLYRR-LKRVHAFAEGLPAGNYSLSISYNFPVTMFQGEKSIVLSTLTWIGGGGLFLGLTYTVTGALTLLASFAILTIHLMLKR 336          
BLAST of Cell cycle control protein 50A vs. UniProt/SwissProt
Match: sp|H2L0H3|CHAT1_CAEEL (CDC50 family protein chat-1 OS=Caenorhabditis elegans OX=6239 GN=chat-1 PE=2 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 2.142e-64
Identity = 130/334 (38.92%), Postives = 181/334 (54.19%), Query Frame = 2
Query:   95 ISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLIT-VPWTSTGIAWPSETNVRYGKP--------TSWANTMKPPNWPISALDRSPDAYSGDE--DLLVWMRTAALPNFKKMHRKFIHNFDP-FLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFIN 1060
            +  RP ASA  QQKL  W+PI+    +    F IG IF+ +G  L   S  + E  ++YTNCL+                     CQ +IN+  P      VF YY L N++QNHRRYVKSR+D+Q  G    +   +C P+    ++     APCG IANS+FNDTF L +  +  ++T VP T+ G+ W  + + ++  P         ++ NT KPPNW      ++P    G E  D +VWMRTAALP FKK+ R      +P F NG+P+G Y+L++  +YPV  F G K F +STT+  GGKN+ LGI +LVVG     L V F+ I+
Sbjct:   27 LKNRPKASALRQQKLPAWQPILTATTVIPTVFVIGAIFLPIGVFLFIASDAVSEFTVEYTNCLSP--------------------CQLQINL--PNAFDGDVFLYYNLENYYQNHRRYVKSRNDQQYLGDLTNV--KDCAPFDIDPATKK-PIAPCGAIANSIFNDTFTLAHRADTGIVTMVPVTTQGVIWNVDKDRKFKNPPLNDGNLCDAFNNTTKPPNW-----SKNPCEVGGFENVDFIVWMRTAALPYFKKLWRIVDRTTNPLFSNGLPQGTYILTVENNYPVQSFGGKKEFVISTTSWAGGKNSFLGIAYLVVGSLAIVLGVVFIVIH 330          
BLAST of Cell cycle control protein 50A vs. UniProt/SwissProt
Match: sp|Q8VEK0|CC50A_MOUSE (Cell cycle control protein 50A OS=Mus musculus OX=10090 GN=Tmem30a PE=1 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 3.805e-64
Identity = 139/338 (41.12%), Postives = 189/338 (55.92%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDT---LITVPWTSTGIAWPSETNVRYGKP-------TSWANTMKPPNWPISALDRSPDAYSG----DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINE 1063
            ++RP+ +AF QQ+L  W+PI+    +   FF IG+IF+ +G  +   S  I E+ IDYT    S    C+  L  N       SC C IN T+    +  VF YYGL+NF+QNHRRYVKSRDD QL G    LLN    C+PY+  N    I  APCG IANS+FNDT +L  + N++    I +P    GIAW ++ NV++  P         + +T+KP NW  +  +  P+  S     +ED +VWMRTAALP F+K++R  I   D     +P G Y L+I Y+YPV  F G K   LST + +GGKN  LGI ++ +G   F L V  + IN 
Sbjct:   25 TRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPS--SPCNKCLSPN-----VTSCACTINFTLKQSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKECEPYR-RNEDRPI--APCGAIANSMFNDTLELYLVANESDPKPIPIPLKKKGIAWWTDKNVKFRNPPGKESLEEKFKDTIKPVNWHKAVYELDPEDESNNGFINEDFIVWMRTAALPTFRKLYR-LIERRDDLHPTLPAGQYFLNITYNYPVHSFDGRKRMILSTISWMGGKNPFLGIAYITIGSISFLLGVVLLVINH 351          
BLAST of Cell cycle control protein 50A vs. UniProt/SwissProt
Match: sp|Q5F362|CC50A_CHICK (Cell cycle control protein 50A OS=Gallus gallus OX=9031 GN=TMEM30A PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.541e-63
Identity = 144/347 (41.50%), Postives = 196/347 (56.48%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCL-NSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPTSWAN-------TMKPPNW--PISALDRSPDAYSG-DEDLLVWMRTAALPNFKKMHR--KFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFI-NEFDSRQQSEE 1090
            +++P+ +AF QQ+L  W+PI+    +   FF IG+IF+ +G  +   S  I E  IDYT    +S   +C +V   +        C C IN T+    +S VF YYGL+NF+QNHRRYVKSRDD QL G    LLN    C+PY+ TN    I  APCG IANS+FNDT +L +++NDT   +     GIAW ++ NV++  P    N       T KP NW  P+  LD  PD     +ED +VWMRTAALP F+K++R  +   N  P L     G Y L+I Y+YPV  F G K   LST + +GGKN  LGI ++ VG   F L V  + I +++ +R  S +
Sbjct:   34 TRKPDNTAFKQQRLPAWQPILTAGTVLPAFFIIGLIFIPIGIGIFVTSNNIREYEIDYTGVEPSSPCNKCLNVSWDST-----PPCTCTINFTLEHSFESNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDNSSLLNPSKECEPYR-TNEDKPI--APCGAIANSMFNDTLELYHIENDTRTAITLIKKGIAWWTDKNVKFRNPKGDGNLTALFQGTTKPVNWPKPVYMLDSEPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSNLQPTLQA---GKYSLNITYNYPVHSFDGRKRMILSTISWMGGKNPFLGIAYITVGSICFFLGVVLLIIHHKYGNRNTSAD 369          
BLAST of Cell cycle control protein 50A vs. UniProt/SwissProt
Match: sp|Q5R6C0|CC50A_PONAB (Cell cycle control protein 50A OS=Pongo abelii OX=9601 GN=TMEM30A PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 5.485e-62
Identity = 140/335 (41.79%), Postives = 185/335 (55.22%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTL-ITVPWTSTGIAWPSETNVRYGKPTSWAN-------TMKPPNW--PISALDRSPDAYSG-DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINE 1063
            ++RP+ +AF QQ+L  W+PI+    +   FF IG+IF+ +G  +   S  I E+ IDYT    S    C+  L  +        C C IN T+    +  VF YYGL+NF+QNHRRYVKSRDD QL G    LLN    C+PY+  N    I  APCG IANS+FNDT +L  + ND+  I +     GIAW ++ NV++  P    N       T KP NW  P+  LD  PD     +ED +VWMRTAALP F+K++R  I         +P G Y L++ Y+YPV  F G K   LST + +GGKN  LGI ++ VG   F L V  + IN 
Sbjct:   25 TRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPS--SPCNKCLSPD-----VTPCICTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYR-RNEDKPI--APCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLKERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYR-LIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINH 348          
BLAST of Cell cycle control protein 50A vs. UniProt/SwissProt
Match: sp|Q9NV96|CC50A_HUMAN (Cell cycle control protein 50A OS=Homo sapiens OX=9606 GN=TMEM30A PE=1 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 7.867e-62
Identity = 140/335 (41.79%), Postives = 185/335 (55.22%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTL-ITVPWTSTGIAWPSETNVRYGKPTSWAN-------TMKPPNW--PISALDRSPDAYSG-DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINE 1063
            ++RP+ +AF QQ+L  W+PI+    +   FF IG+IF+ +G  +   S  I E+ IDYT    S    C+  L  +        C C IN T+    +  VF YYGL+NF+QNHRRYVKSRDD QL G    LLN    C+PY+  N    I  APCG IANS+FNDT +L  + ND+  I +     GIAW ++ NV++  P    N       T KP NW  P+  LD  PD     +ED +VWMRTAALP F+K++R  I         +P G Y L++ Y+YPV  F G K   LST + +GGKN  LGI ++ VG   F L V  + IN 
Sbjct:   25 TRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPS--SPCNKCLSPD-----VTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYR-RNEDKPI--APCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYR-LIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINH 348          
BLAST of Cell cycle control protein 50A vs. TrEMBL
Match: A0A1I8J5W3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007709g1 PE=3 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 2.083e-101
Identity = 156/324 (48.15%), Postives = 218/324 (67.28%), Query Frame = 2
Query:  101 KRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDT--LITVPWTSTGIAWPSETNVRYGKPTSWANTMKPPNWPISALDRSPDAYSGDEDLLVWMRTAALPNFKKMHRKFIHN---FDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFI 1057
            ++PN S FHQQ+L  W+P++  K  +  FF IGI+F+ +G+ L   S  + E+  DYTNC N     C  ++    Y   +QSCQC +++ +P ++   V++YY LTNF+QNHRRYVKSRDD QL+G  +  L  +C PY+ + S     YAPCG IANSLFNDTFQL Y + D    + VPWTSTGIAW S+   ++ + +SW NT+KP NWP SA +R+ DAY GDE+L+VWMRTAALP+F+K+HR   H+    + F +G+P G Y L +NY+YPV+ F G K+F L+T+  LGG+N +LGI++LVVG  +  L + FV +
Sbjct:   30 RKPNDSRFHQQRLPAWQPLLTAKPAFCLFFIIGIVFVPLGAFLLTTSQSVEEIKTDYTNCKNGS-SFCLALVSTPEYYANFQSCQCMVDIKLPNNLTGQVYAYYALTNFYQNHRRYVKSRDDGQLQGTKMDNLLDDCNPYRQSPSGQ--WYAPCGAIANSLFNDTFQLFYNRPDGSGRVAVPWTSTGIAWDSDRARKFARISSWNNTVKPVNWPKSAKERNADAYQGDEELIVWMRTAALPSFRKLHRIIQHDSAATNLFKDGLPAGNYSLVVNYAYPVSSFAGTKSFILTTSTWLGGRNPALGIIYLVVGSLHVILGIIFVGV 350          
BLAST of Cell cycle control protein 50A vs. TrEMBL
Match: A0A504YJI3 (Cell cycle control protein 50A OS=Fasciola gigantica OX=46835 GN=FGIG_00294 PE=3 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 9.338e-92
Identity = 148/331 (44.71%), Postives = 214/331 (64.65%), Query Frame = 2
Query:   68 QMNLDENVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQ-------CSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTL-----ITVPWTSTGIAWPSETNVRYGKPTS--WANTMKPPNWPISALDRSPDAYSGDEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVG 1018
            +  ++    +  +P  S+FHQQ+L  W+PI+  + +   F  IGI+F+ +G VL   S ++ E  I+YT+C  SD          CS+ + K ++  +Y  C C+ + T+ +D+K  V+ YYGL+NF+QNHRRYV S+DD QL G   PL ++ C P++      S  YAPCG IA SLFNDTFQL Y    +      + VP TS+GIAW ++   ++G+P +  WANT+KP +WP +AL+RSP+AYSGDE+L+VWMR AALP F+K+HR  + + D F  G+P G Y L+I Y+YPVT F G K F +ST++ LGG+N +LGI +LV+G
Sbjct:    3 EGTIESQQELVNKPKDSSFHQQRLPAWRPILTARFVSPIFLVIGILFIPIGIVLLVTSSRVFERVIEYTHCERSDANNTSSFRVLCSEEVRKPSFFSQYSFCPCQQSFTLDSDLKGDVYFYYGLSNFYQNHRRYVMSKDDMQLHGDSNPL-SAACDPFRTNPEGKS--YAPCGAIAMSLFNDTFQLMYNGQSSAPLSPPVNVPLTSSGIAWRTDVEQKFGRPPASIWANTVKPDSWPRTALERSPNAYSGDEELIVWMRVAALPTFRKLHRILVAH-DRFSEGLPAGDYTLNIGYAYPVTQFGGTKRFIISTSSWLGGRNPTLGIAYLVMG 329          
BLAST of Cell cycle control protein 50A vs. TrEMBL
Match: A0A267G2J1 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015712g2 PE=4 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 3.892e-91
Identity = 149/334 (44.61%), Postives = 212/334 (63.47%), Query Frame = 2
Query:  101 KRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRY--QSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQL----KGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDY----LQNDTLITVPWTSTGIAWPSETNVRYGKPTSWANTMKPPNWPISALDRSPDAYSGDEDLLVWMRTAALPNFKKMHRKFIHN----FDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFIN 1060
            ++P+ S FHQQKL  W+P++  ++++  FF +G  F+ +G+VL   S  + E   +YTNC ++ G  C +   K +Y YR+    C C +++ +P ++   VF+YY LTNF+QNHRRYVKSRDD QL     G   PL   +C PY+    S S    PCG IANSLFNDTFQL Y       D  + VPWTS GI+W S+   ++G+  ++  T KPPNW +S   RS D++ GDE+L+VWMRTAALP+F+K+HR  +HN     D F +G+P G Y L +NY+YPV  F G K+F L+T++  GG+N +LGI+++VVG  +  L   FV I+
Sbjct:   39 RKPSDSKFHQQKLPAWQPLLTARSVFPLFFLVGAAFVPIGAVLFTASQSVKEAEFNYTNCRDASGISCLEQANKPDY-YRWLRPPCVCNMSIHLPDNLTGQVFAYYALTNFYQNHRRYVKSRDDSQLLGWKPGSEEPL--QDCSPYRQDPGSGSW-ILPCGAIANSLFNDTFQLFYHSPTAGADLAVEVPWTSRGISWASDRERKFGRVKNFTGTSKPPNWRLSPEQRSADSFQGDEELIVWMRTAALPSFRKLHRIVLHNASSAADWFKDGLPSGNYTLLVNYAYPVNAFSGTKSFVLTTSSWSGGRNPALGIIYMVVGCLHIVLGALFVVIH 368          
BLAST of Cell cycle control protein 50A vs. TrEMBL
Match: A0A267DEB6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015712g1 PE=4 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 4.507e-91
Identity = 149/334 (44.61%), Postives = 212/334 (63.47%), Query Frame = 2
Query:  101 KRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRY--QSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQL----KGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDY----LQNDTLITVPWTSTGIAWPSETNVRYGKPTSWANTMKPPNWPISALDRSPDAYSGDEDLLVWMRTAALPNFKKMHRKFIHN----FDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFIN 1060
            ++P+ S FHQQKL  W+P++  ++++  FF +G  F+ +G+VL   S  + E   +YTNC ++ G  C +   K +Y YR+    C C +++ +P ++   VF+YY LTNF+QNHRRYVKSRDD QL     G   PL   +C PY+    S S    PCG IANSLFNDTFQL Y       D  + VPWTS GI+W S+   ++G+  ++  T KPPNW +S   RS D++ GDE+L+VWMRTAALP+F+K+HR  +HN     D F +G+P G Y L +NY+YPV  F G K+F L+T++  GG+N +LGI+++VVG  +  L   FV I+
Sbjct:   48 RKPSDSKFHQQKLPAWQPLLTARSVFPLFFLVGAAFVPIGAVLFTASQSVKEAEFNYTNCRDASGISCLEQANKPDY-YRWLRPPCVCNMSIHLPDNLTGQVFAYYALTNFYQNHRRYVKSRDDSQLLGWKPGSEEPL--QDCSPYRQDPGSGSW-ILPCGAIANSLFNDTFQLFYHSPTAGADLAVEVPWTSRGISWASDRERKFGRVNNFTGTSKPPNWRLSPEQRSADSFQGDEELIVWMRTAALPSFRKLHRIVLHNASSAADWFKDGLPSGNYTLLVNYAYPVNAFSGTKSFVLTTSSWSGGRNPALGIIYMVVGCLHIVLGALFVVIH 377          
BLAST of Cell cycle control protein 50A vs. TrEMBL
Match: A0A267EYS7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012769g1 PE=3 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 3.142e-90
Identity = 139/336 (41.37%), Postives = 202/336 (60.12%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLN-SDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPTSWANTMKPPNWPISALDRSPDAYSGDEDLLVWMRTAALPNFKKMHRKFIH-NFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINEFDSRQQSEEAWY 1099
            S RP +SAFHQQKL  W+P++    ++  F  + I F+ +G  L   +  I E++IDYT+C    D   C++++ K  + Y Y  CQC++   +   +   V++YY LTNF QNHR+YVKS D  QL G     L++ C+PY+   S++    APCG +ANSLFNDTF+L   +  +L TVPWT  GI+W ++   +YG+  +W  T KPPNW +    RSP  Y+GDE+L VWM  AALP F+K+HR+ IH +   +  G+P G Y L +NYSYPV  F G K+F L+T  +LGG+N  LG + + VG  + AL      ++    R +  + +Y
Sbjct:   44 SNRPPSSAFHQQKLPAWQPLLTAGTVFPVFLIMSIAFICLGVALLLANSNISELSIDYTDCKRIGDRTPCANLVKKPEFYYNYSVCQCRLEFKLDKPMTGQVYAYYALTNFHQNHRKYVKSHDRMQLSGRRYSDLDAECEPYR--TSADGKWIAPCGAVANSLFNDTFKL-MRRVGSLETVPWTVKGISWSADVARKYGRVDTWNGTAKPPNWAVPESARSPIGYTGDEELQVWMTVAALPTFRKLHRRLIHSDISAYAEGLPAGNYSLLVNYSYPVAGFGGTKSFVLATAGLLGGRNAGLGGLAIAVGCLHLALCCALAVLHTHAKRNRETDPYY 376          
BLAST of Cell cycle control protein 50A vs. Ensembl Cavefish
Match: tmem30aa (cell cycle control protein 50A-like [Source:NCBI gene;Acc:103045771])

HSP 1 Score: 232.646 bits (592), Expect = 6.340e-72
Identity = 142/339 (41.89%), Postives = 190/339 (56.05%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNC-LNSDGQQCSDVLLKNNYTYRYQ-SCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYL-QNDTLITVPWTSTGIAWPSETNVRYGKP--------TSWANTMKPPNW--PISALDRSPDAYSG--DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINE 1063
            SK+P+ +AF QQ+L  W+PI+    +   FF IG+IF+ +G  L   S  I E  IDYT    NS   +CS        TY +  SC C +  ++    +S VF YYGL+NF+QNHRRYVKSRDD QL G    L N    C+PY+    S     APCG IANSLFNDT +L Y+  N +   +P    GIAW ++ +V++  P         ++ +T KP NW  P+  LD +    +G  +ED +VWMRTAALP F+K++R    N D     +PRG Y L I Y+YPV  F G K   LST + +GGKN  LGI ++ VG   F L V  + I+ 
Sbjct:   29 SKKPDNTAFKQQRLPAWQPILTAGTVLPAFFVIGLIFIPIGIGLFVTSNNIREFEIDYTGVDTNSPCNRCSQ-------TYSWNISCTCSVPFSLEQPFESNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDKSSLTNPSKECEPYRI---SEKKPIAPCGAIANSLFNDTLELYYIYPNGSRTLIPLVKKGIAWWTDKHVKFRNPPGNNDNLTITFQDTTKPVNWHKPVYELDPNDPDNNGFINEDFIVWMRTAALPTFRKLYRIIQKNKDNMTPTLPRGNYSLEIAYNYPVRSFDGRKRMILSTISWMGGKNPFLGIAYITVGSVCFFLGVVLLIIHH 357          
BLAST of Cell cycle control protein 50A vs. Ensembl Cavefish
Match: tmem30ab (cell cycle control protein 50A [Source:NCBI gene;Acc:103037759])

HSP 1 Score: 226.483 bits (576), Expect = 1.746e-69
Identity = 144/352 (40.91%), Postives = 201/352 (57.10%), Query Frame = 2
Query:   86 NVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLN-SDGQQCSDVLLKNNYTYRYQS-CQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLL--NSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQ-NDTLITVPWTSTGIAWPSETNVRYGKP-TSWAN-------TMKPPNW--PISALDRSPDAYSG-DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFI-NEFDSRQQSEE 1090
            N N  K+P+ +AF QQ+L  W+PI+    +   FF IG+IF+ +G  L   S  I E  IDYT   + S    C+      NY++   + C+C +  T+    +S VF YYGL+NF+QNHRRYVKSRDD QL G    L   +  C+PY+  N +  I  APCG IANS+FNDT +L Y+  N T   +P    GIAW ++ +V++  P  S AN       + KP NW  P+  LD  P+     +ED +VWMRTAALP F+K++R  I   +     +PRG Y L + Y+YPV  F+G K   LST + +GGKN  LGI ++ VG   F L V  +FI +++ +R  S +
Sbjct:   23 NANSGKKPDNTAFKQQRLPAWQPILTAGTVLPAFFIIGLIFIPIGIGLFVTSNNIKEFEIDYTGTDSWSPCYNCAQ-----NYSWNSSTPCRCTLPFTLEQPFESNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDLSSLKYPSKECEPYRL-NENKPI--APCGAIANSMFNDTLELYYIDPNGTQTLIPLMKKGIAWWTDKHVKFRNPGGSNANLTAVFQVSTKPVNWRNPVYELDSDPENNGFINEDFIVWMRTAALPTFRKLYR-IIQKKNNMTPTLPRGNYTLEVVYNYPVNSFEGRKRMILSTISWMGGKNPFLGIAYITVGSVCFFLGVVLLFIHHKYGNRNNSSD 365          
BLAST of Cell cycle control protein 50A vs. Ensembl Cavefish
Match: tmem30c (cell cycle control protein 50A-like [Source:NCBI gene;Acc:111191273])

HSP 1 Score: 194.897 bits (494), Expect = 1.140e-57
Identity = 120/334 (35.93%), Postives = 174/334 (52.10%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQND-TLITVPWTSTGIAWPSETNVRYGKP-------TSWANTMKPPNW--PISALDRSPDAYSG--DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFI 1057
            ++RP+ SAF QQ+L  W P +    +   F+ + ++ +++G  L        E+ +DYT     +G       L+ +      SC C +N  IP      VF YYGL NF QN RRY+ SRD+ QL G    L +  S C+P+ +      I  APCG IANS+FND+F L Y   D   + VP    GI W ++ NV++  P        ++  T +P  W  P+  LD +  + +G  ++DL+VWMR AA PNFKK++   I    PF  G+P G Y ++I Y++PV  FQG K   LST +  GG+N  L I +LV G   F  A+    +
Sbjct:   12 ARRPDNSAFKQQRLPAWSPSLTPYTVLPVFYLLAVVCVLLGVWLFITVENTHELKVDYT----EEGTCIRCFELRKDPIQARNSCDCVVNFNIPKTFPGDVFFYYGLVNFHQNLRRYMDSRDEDQLVGRKKSLKSPSSYCEPFAHDEHGEPI--APCGAIANSMFNDSFTLTYHPPDGAEVPVPLYRRGITWYTDKNVKFRNPPTNTTLQLAFQGTAQPLFWQQPVYELDPADPSNNGFINDDLIVWMREAAFPNFKKLYGILIRAETPFSEGLPAGNYSVNIIYNFPVQYFQGRKEVVLSTVSWFGGQNHFLPIAYLVTGGLIFIAAIVLTVV 339          
BLAST of Cell cycle control protein 50A vs. Ensembl Cavefish
Match: tmem30b (transmembrane protein 30B [Source:ZFIN;Acc:ZDB-GENE-040704-17])

HSP 1 Score: 181.03 bits (458), Expect = 1.207e-52
Identity = 110/280 (39.29%), Postives = 153/280 (54.64%), Query Frame = 2
Query:  263 IDYTNC-LNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPT--------SWANTMKPPNWPISA--LDRSPDAYSG--DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFI 1057
            +DYT   +NS    CS V            C C++  +     + PVF YYGL+N++QN+R+Y  S+D  QL G     L+    C PYQY +S   I   PCG IANS FNDTF+L  + N     VP+   GIAW ++ NV+Y  P         ++  T+KPPNWP  A  LD S  A +G  ++D LVWMR AALPNF+K++ +       +  G+P G Y L INY+YPV  F+G K    S  + +GGKN  LG+ +LV+G     +A+  + +
Sbjct:   54 LDYTGTEMNSSCFSCSSVK---------PDCVCELTFSFSQLFEGPVFFYYGLSNYYQNYRQYGVSKDANQLSGDTTYFLSPQDTCSPYQYDSSGKPI--VPCGSIANSKFNDTFKLYLMVNGVKTLVPFDGKGIAWWTDYNVKYRNPATVNGSLAKAFDGTVKPPNWPKPAYELDPSDAANNGFVNQDFLVWMRRAALPNFRKLYGRITGG--DYSQGLPAGNYTLQINYNYPVVNFKGTKKVIFSNVSWMGGKNEFLGLAYLVIGCLCVVMAIVMLIV 320          
BLAST of Cell cycle control protein 50A vs. Ensembl Cavefish
Match: tmem30c (cell cycle control protein 50A-like [Source:NCBI gene;Acc:111191273])

HSP 1 Score: 180.259 bits (456), Expect = 9.217e-52
Identity = 120/361 (33.24%), Postives = 174/361 (48.20%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFN---------------------------DTFQLDYLQND-TLITVPWTSTGIAWPSETNVRYGKP-------TSWANTMKPPNW--PISALDRSPDAYSG--DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFI 1057
            ++RP+ SAF QQ+L  W P +    +   F+ + ++ +++G  L        E+ +DYT     +G       L+ +      SC C +N  IP      VF YYGL NF QN RRY+ SRD+ QL G    L +  S C+P+ +      I  APCG IANS+FN                           D+F L Y   D   + VP    GI W ++ NV++  P        ++  T +P  W  P+  LD +  + +G  ++DL+VWMR AA PNFKK++   I    PF  G+P G Y ++I Y++PV  FQG K   LST +  GG+N  L I +LV G   F  A+    +
Sbjct:   12 ARRPDNSAFKQQRLPAWSPSLTPYTVLPVFYLLAVVCVLLGVWLFITVENTHELKVDYT----EEGTCIRCFELRKDPIQARNSCDCVVNFNIPKTFPGDVFFYYGLVNFHQNLRRYMDSRDEDQLVGRKKSLKSPSSYCEPFAHDEHGEPI--APCGAIANSMFNGETHLLVTYKENTLNIDLFKTLFNLCSDSFTLTYHPPDGAEVPVPLYRRGITWYTDKNVKFRNPPTNTTLQLAFQGTAQPLFWQQPVYELDPADPSNNGFINDDLIVWMREAAFPNFKKLYGILIRAETPFSEGLPAGNYSVNIIYNFPVQYFQGRKEVVLSTVSWFGGQNHFLPIAYLVTGGLIFIAAIVLTVV 366          
BLAST of Cell cycle control protein 50A vs. Ensembl Sea Lamprey
Match: tmem30b (transmembrane protein 30B [Source:ZFIN;Acc:ZDB-GENE-040704-17])

HSP 1 Score: 242.276 bits (617), Expect = 2.531e-76
Identity = 141/345 (40.87%), Postives = 206/345 (59.71%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTL-ITVPWTSTGIAWPSETNVRYGKP-------TSWANTMKPPNW-----PISALDRSPDAYSGDEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINEFDSRQQSE 1087
            S+RP+ +AF QQ+L  W+PI+    +   FF I +IF+ +G  L   S  I+E  +DYT+  ++D   C++V  +  +   +QSC C I   +    K PV+ YYGL+NF+QNHRRYVKSRDD QL G+   LLN  S C PY+    + +I  APCG IANS+FNDT  L Y+ N T  + VP   TGIAW ++ NV    P       +++A T KP  W      +  LD + + +  +ED +VWMRTAALP F+K++R+ ++  D   NG+P G Y+L ++Y++PV  F G K   LSTT+ +GGKN  LGI ++ VG   F L +    I++  S++ ++
Sbjct:   28 SRRPDNTAFKQQRLPAWQPILTAGTVLPAFFIIAVIFIPLGIGLLITSNNILEHEVDYTD--SNDCAHCAEV--RTYWNNSFQSCSCSIAFNLTEHFKGPVYMYYGLSNFYQNHRRYVKSRDDNQLYGVKASLLNPSSECAPYE---KNGTIPIAPCGAIANSMFNDTLTL-YMANATDNVPVPMIKTGIAWWTDKNVDGQNPEPKNNLTSAFAGTTKPLYWNKSVYELDELDSNNNGFM-NEDFIVWMRTAALPTFRKLYRR-VNMTD---NGLPAGSYLLKVDYNFPVKSFGGRKRMILSTTSWMGGKNPFLGIAYITVGTICFVLGIVLFIIHQKYSKRPND 359          
BLAST of Cell cycle control protein 50A vs. Ensembl Yeast
Match: CDC50 (Endosomal protein that interacts with phospholipid flippase Drs2p; interaction with Cdc50p is essential for Drs2p catalytic activity; mutations affect cell polarity and polarized growth; similar to Lem3p; CDC50 has a paralog, YNR048W, that arose from the whole genome duplication [Source:SGD;Acc:S000000690])

HSP 1 Score: 177.178 bits (448), Expect = 2.399e-51
Identity = 110/360 (30.56%), Postives = 181/360 (50.28%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSC-----------------QCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPL--LNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPTSWANTMKPPNWPISALDRSPDAYSGD--------EDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINEFDSRQQSEEAW 1096
            SK+P  +AF QQ+LK W+PI++ +++      +  IF  +G  L   + ++ ++ IDY++C         + + K    Y ++S                   C++   IP DIK  +F YY +TNF+QNHRRYV+S D KQ+ G  +    L+++C P +  +  + I Y PCG+IANS+FNDTF       D       T+  I+W  + +       + ++ + PPNW    + + PD Y+ +        E+  VWMRTAA P F K+  K           +P+G Y ++I  +YP++ F G K+F L+T   +GG+N SLG+++L+V        + F+    F  R   +  +
Sbjct:   20 SKKPPNTAFRQQRLKAWQPILSPQSVLPLLIFVACIFTPIGIGLIVSATKVQDLTIDYSHCDTKASTTAFEDIPKKYIKYHFKSKVENKPQWRLTENENGEQSCELQFEIPNDIKKSIFIYYKITNFYQNHRRYVQSFDTKQILGEPIKKDDLDTSCSPIR--SREDKIIY-PCGLIANSMFNDTFSQVLSGIDDTEDYNLTNKHISWSIDRHRFKTTKYNASDIVPPPNW----MKKYPDGYTDENLPDIHTWEEFQVWMRTAAFPKFYKLTLKNES------ASLPKGKYQMNIELNYPISLFGGTKSFVLTTNGAIGGRNMSLGVLYLIVAGLCALFGIIFLVKLIFQPRAMGDHTY 366          
BLAST of Cell cycle control protein 50A vs. Ensembl Yeast
Match: YNR048W (Potential noncatalytic subunit for phospholipid translocase Dnf3p; YNR048W has a paralog, CDC50, that arose from the whole genome duplication [Source:SGD;Acc:S000005331])

HSP 1 Score: 174.096 bits (440), Expect = 3.461e-50
Identity = 114/372 (30.65%), Postives = 180/372 (48.39%), Query Frame = 2
Query:   68 QMNLDENVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSC------------------QCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKG--LYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPT-SWANTMKPPNWPISALDRSPDAYSGD--------EDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINEFDSRQQSEEAW 1096
            Q++  +N   S++P  ++F QQ+LK W+PI++ +++      +  +F  +G  L   +  +  + ++YT C      +  + +      Y +                      C+I   +P  IK   + YY LTNF QN+R YV+S D  QLKG  L    L+ NC P +   +       PCG+IANS+FNDTF       +       T+ GIAW ++++ RYGK   + ++ + PPNW        P+ Y+ D        E   +WMRTAALPNF K+  K         NG+ +G Y+  I  +YPV  F G K+F L+T +I+G  N +LGIV+L+V       A+ F+    F  R   + ++
Sbjct:   12 QLSSKQNAQKSRKPANTSFRQQRLKAWQPILSPQSVLPLLILMACVFAPIGIGLVVSTISVQRLVVNYTECDALAPAKHFETIPSEYVDYHFSKKVAVQPQWMVLTDPELGNQTCRIQFEVPNHIKKSTYVYYRLTNFNQNYREYVQSLDLDQLKGKALIGNDLDPNCDPLRTVENKTIF---PCGLIANSMFNDTFGTTLTGVNDTADYLLTTKGIAWDTDSH-RYGKTEYNASDIVPPPNWA----KLFPNGYTDDNIPDLQNWEQFKIWMRTAALPNFYKLAMK------NETNGLGKGIYIADIELNYPVRSFYGTKSFVLTTNSIIGAGNEALGIVYLIVAGIATLFAILFLIKVIFKPRPMHDHSY 369          
BLAST of Cell cycle control protein 50A vs. Ensembl Yeast
Match: LEM3 (Membrane protein of the plasma membrane and ER; interacts specifically in vivo with the phospholipid translocase (flippase) Dnf1p; involved in translocation of phospholipids and alkylphosphocholine drugs across the plasma membrane; null mutant requires tryptophan due to mislocalization of tryptophan permease Tat2p [Source:SGD;Acc:S000005267])

HSP 1 Score: 138.658 bits (348), Expect = 5.754e-37
Identity = 110/373 (29.49%), Postives = 170/373 (45.58%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDV-----------------------LLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGL---YVPLLNS---NCQPYQYTNSSNSIG--YAPCGIIANSLFNDTFQLDYLQ-NDTLITVPWTSTGIAWPSETNVRYGKPT-SWANTMKPPNWPISALDRSPDAYSGD--------EDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINEFDSRQQSEEA 1093
            ++RP   AF QQ+L    P++  + +   +  I ++F++VG  +   + ++ EV I Y +C+ +     SD+                       +   +  +  Q   C+I  T P+D+K+ V+  Y L  F  NHRRYV S  + Q++G    Y  + ++   NC+P     S N+ G  Y PCG+IANS+FNDTF L      DT      T+ GI W S+   RY K   ++     PP W        PD Y+          E+   WMR  A     K+ R  I+  D     +P G Y L I   +PV  F G K   L+  + LGG+N  LGIV+L+ G    A+A+  +    F  R+ ++ +
Sbjct:   50 NRRPKEDAFTQQRLAAINPVLTPRTVLPLYLLIAVVFVIVGGCILAQNSKVDEVTIYYQDCMTNATSSWSDIPSEHWQFVFHKYKTYNTAPQWRFVDDESDDFTKQRGTCQIRFTTPSDMKNNVYLNYVLEKFAANHRRYVLSFSEDQIRGEDASYETVHDATGINCKPL----SKNADGKIYYPCGLIANSMFNDTFPLQLTNVGDTSNNYSLTNKGINWESDKK-RYKKTKYNYTQIAPPPYWE----KMYPDGYNETNIPDIQDWEEFQNWMRPGAFDKITKLIR--INKNDT----LPAGEYQLDIGLHWPVLEFNGKKGIYLTHGSHLGGRNPFLGIVYLIGGCICAAMALILLTFWLFGGRKIADAS 407          
BLAST of Cell cycle control protein 50A vs. Ensembl Nematostella
Match: EDO47858 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL17])

HSP 1 Score: 229.565 bits (584), Expect = 1.957e-71
Identity = 130/339 (38.35%), Postives = 201/339 (59.29%), Query Frame = 2
Query:   80 DENVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLK--NNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDT-LITVPWTSTGIAWPSETNVRYGKPT-----SWANTMKPPNW--PISALDRSPDAYSG--DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFIN 1060
            D     S++P+ +AF QQ+LK W+PI+        FF +G++F+ +G++L   S  + E  I+YT C ++   +  D   K  NN     + C CKI+ ++ +     V+ YYG++NF+QNHRRYV+SRDD QL G     +N +C P+    S      APCG IANSLFND+F+  Y ++ + +I +  T   IAW S+  V++  P+     +++   KP +W  P+  LD++  + +G  ++D +VWMRTAA   F+K++RK +   DPF  G+P+G Y + INY+YPV  F G K   +STT+ +GGKN  LGI ++ VG+    L VCF+ I+
Sbjct:    3 DSAEKTSRKPSNTAFKQQRLKAWQPILTASTALPVFFIVGVVFVPIGAILLVASDGVQEKVIEYTKCNSTTTNEGCDAFFKKVNNSG---KVCHCKIDFSLASKFSGDVYIYYGMSNFYQNHRRYVRSRDDLQLNGQLQTPVNKDCAPFNKNASGTPT--APCGAIANSLFNDSFKFFYKKSSSDIIPLDLTYKDIAWESDREVKFKNPSGNLESAFSKYSKPRDWQKPVYELDKNDSSNNGFLNQDFIVWMRTAAFSTFRKLYRKVVAT-DPFKEGLPKGDYTVEINYAYPVGRFDGEKRIIISTTSWIGGKNPFLGIAYITVGILCIVLGVCFLVIH 335          
BLAST of Cell cycle control protein 50A vs. Ensembl Medaka
Match: tmem30aa (transmembrane protein 30A [Source:NCBI gene;Acc:101158900])

HSP 1 Score: 229.565 bits (584), Expect = 9.375e-71
Identity = 143/349 (40.97%), Postives = 199/349 (57.02%), Query Frame = 2
Query:   98 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNC-LNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLL--NSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYL-QNDTLITVPWTSTGIAWPSETNVRYGKPTSWAN-------TMKPPNWPISALDRSPDAYSG----DEDLLVWMRTAALPNFKKMHRKFIH--NFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVG-LSYFALAVCFVFINEFDSRQQSEE 1090
            SK+P+ +AF QQ+L  W+PI+    +   FF IG+IF+ +G  L   S  I E  IDYT   ++S    C+     N+ T    SC C +N T+    +S V+ YYGL+NF+QNHRRYVKSRDD QL G+   L   +  C+PY+   +S+ +  APCG IANSLFNDT +L ++ QN T   V  T  GIAW ++ +V++  P   +N       T KP NW  +  D  P+        +ED +VWMRTAALP F+K++R      N  P L+    G YV+ I Y+YPV  F G K   LST + +GGKN  LGI ++ VG + +F   V  V  +++D+R  S E
Sbjct:   29 SKKPDNTAFKQQRLPAWQPILTAGTVLPAFFVIGLIFIPIGIGLFVTSNNIKEFEIDYTGVEIDSPCYICAKNFSWNSTT----SCVCSVNFTLDQPFESNVYMYYGLSNFYQNHRRYVKSRDDSQLNGVESNLKQPSKECEPYR---TSDGLPIAPCGAIANSLFNDTLELFHINQNGTKQRVNVTKKGIAWWTDKHVKFRNPGGSSNLSVAFQGTAKPVNWRKAVYDLDPEDPENNGFINEDFIVWMRTAALPTFRKLYRIIQKKPNSTPTLSS---GRYVMEITYNYPVLSFDGRKRMILSTISWMGGKNPFLGIAYITVGSICFFLGVVLLVIHHKYDTRTNSAE 367          
BLAST of Cell cycle control protein 50A vs. Ensembl Medaka
Match: tmem30b (cell cycle control protein 50A [Source:NCBI gene;Acc:101172542])

HSP 1 Score: 215.312 bits (547), Expect = 1.142e-65
Identity = 128/339 (37.76%), Postives = 189/339 (55.75%), Query Frame = 2
Query:   77 LDENVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKG--LYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKP------TSWANTMKPPNW--PISALDRSPDAYSG--DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFI 1057
            + E  N + RP+ +AF QQ+L  W+P+++   +   F  IG+ F+ +G  L   S  I  + +DYT    S    C    + N       +C CK++ +I T  K PVF YYGLTN+FQN R+Y  S+D  QL G   Y    +S+CQPYQ  N    +   PCG IANS+FNDTF+L  + N     VP+   GIAW ++ N++Y  P       ++ +T KP  W  P   LD S  + +G  ++D LVWMR AALPNF+K++R+       + +G+P G Y L I+Y+YPV  F+G K  + S  + +GG+N  LGI +LV+G     ++V  + +
Sbjct:    1 MKEEGNYANRPSNTAFTQQRLPAWQPMLSAGVVIPGFLLIGLAFIGIGVGLLITSRSIQVLELDYTGTETSS--PCYQCTMSNQ-----SNCVCKLSFSIGTLFKGPVFFYYGLTNYFQNQRKYGVSKDFNQLIGDVSYFKSPSSDCQPYQRVNGKPIV---PCGAIANSMFNDTFKLYQIINGKEELVPFDGKGIAWWTDYNIKYRNPDYTPLKNAFNDTEKPVFWTKPAYELDTSDASNNGFINQDFLVWMRRAALPNFRKLYRRITEG--NYKDGLPAGNYSLEISYNYPVISFEGTKKVTFSNVSWMGGQNEFLGIAYLVIGSMCVVMSVVMLIV 327          
BLAST of Cell cycle control protein 50A vs. Ensembl Medaka
Match: tmem30c (cell cycle control protein 50A-like [Source:NCBI gene;Acc:101166445])

HSP 1 Score: 191.43 bits (485), Expect = 2.340e-56
Identity = 122/337 (36.20%), Postives = 175/337 (51.93%), Query Frame = 2
Query:   95 ISKRPNASAFHQQKLKGWKPIIATKNMYLPFF-AIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVL-LKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLN--SNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPTS--------WANTMKPPNW--PISALDRSPDAYSG--DEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFI 1057
            +++RP+ SAF QQ+L  W P++ T +  LPFF  + +I M++G  L        E+ +DYT     +   C+    ++ N +   Q C C I  +I    K  VF YYGL NF QN RRY+ SRDD Q+ G    L +  S C+P+        I  APCG +ANS+FND+F L Y   +    VP    G+ W ++ NV+Y  P          +  T +PP W  P+  LD      +G  ++DLLVWMR AA PNFKK++        PF  G+P G Y ++I+Y++PV  F+G K   L+T +  GG+N  L I +LV        AV    +
Sbjct:   11 LARRPDNSAFKQQRLPAWSPML-TASAVLPFFYLLALICMLLGVWLLLTVQNTQEMKVDYT-----EAGSCNLCFEMRKNVSNAGQRCTCMIMFSIEKAFKGDVFIYYGLRNFHQNLRRYMDSRDDGQMLGRKSNLKSPSSYCKPFDVDEKGVPI--APCGAVANSMFNDSFILTYYTINGPTVVPLLRKGLTWYTDKNVKYRNPKMDNLTLPEVFEGTTRPPYWQKPVYQLDPFDPNNNGFINDDLLVWMREAAFPNFKKLYGFLYRANKPFTKGLPAGNYSVTISYNFPVQYFKGRKEVVLTTVSWFGGQNHFLPIAYLVTSGLILLTAVVLTVV 339          
BLAST of Cell cycle control protein 50A vs. Planmine SMEST
Match: SMESG000035028.1 (SMESG000035028.1)

HSP 1 Score: 790.03 bits (2039), Expect = 0.000e+0
Identity = 381/382 (99.74%), Postives = 382/382 (100.00%), Query Frame = 2
Query:   71 MNLDENVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPTSWANTMKPPNWPISALDRSPDAYSGDEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINEFDSRQQSEEAWYIANQNRISGCPNETFCNVDNNEEIIGFSDEYYGSVNRTV 1216
            MNLDENVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPTSWANTMKPPNWPISALDRSPDAYSGDEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINEFDSRQQSEEAWYIANQNRISGCPNETFCNVDNNEEIIGFSDE+YGSVNRTV
Sbjct:    1 MNLDENVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPTSWANTMKPPNWPISALDRSPDAYSGDEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINEFDSRQQSEEAWYIANQNRISGCPNETFCNVDNNEEIIGFSDEFYGSVNRTV 382          
BLAST of Cell cycle control protein 50A vs. Planmine SMEST
Match: SMESG000035028.1 (SMESG000035028.1)

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 336/336 (100.00%), Postives = 336/336 (100.00%), Query Frame = 2
Query:   71 MNLDENVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPTSWANTMKPPNWPISALDRSPDAYSGDEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINEFDSRQ 1078
            MNLDENVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPTSWANTMKPPNWPISALDRSPDAYSGDEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINEFDSRQ
Sbjct:    1 MNLDENVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPTSWANTMKPPNWPISALDRSPDAYSGDEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINEFDSRQ 336          
BLAST of Cell cycle control protein 50A vs. Planmine SMEST
Match: SMESG000061468.1 (SMESG000061468.1)

HSP 1 Score: 281.567 bits (719), Expect = 4.675e-91
Identity = 154/354 (43.50%), Postives = 205/354 (57.91%), Query Frame = 2
Query:   80 DENVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSD-------GQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPY-QYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPTSWANTMKPPNWPISALDRSPDAYSGDEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINEFDSRQQSEEAWYIANQNR 1117
            D   N  K    S FHQQ L  W P+I    +Y  F + GI+F+++G  L   S  + E   DYT+C   D        + CS +L  +NYT  YQSC C I   +       V+ YY L NFFQNHRRY  S+DDKQL G  +   +  C+P+ + +N S    YAPCG+IANSLFNDTFQL ++ +   I V     GIAW  + ++ YG PT WANT+KP NW  SA +RS  +Y GDEDLLVWMRTA L  FKK+     H   PF NG+P G Y L INY+YPV+ F G K   L+TT+ +GGKN +LGI+++ +G  +  +A+ F+    F  RQ+ + ++ I    R
Sbjct:    3 DTEENQVKLLKDSNFHQQNLPSWNPVILISTIYPLFGSFGIVFILIGIGLLLSSISVNEFQYDYTHCKEYDKLNNNYSNRICSGIL-NSNYTNNYQSCLCNIKFRLDKQFSGQVYFYYSLQNFFQNHRRYFSSKDDKQLMGKSIQSASDYCKPFDKLSNGSFLQNYAPCGLIANSLFNDTFQLSFINSTNSIPVSMKKKGIAWKVDVDLLYGTPTDWANTLKPTNWKYSAEERSNSSYKGDEDLLVWMRTAPLSTFKKLSGIIKHE-SPFQNGLPAGNYELLINYAYPVSIFGGTKMVFLTTTSAMGGKNNNLGIMYITLGTIHELIALVFLVFTLF--RQKKKGSYSIEMIKR 352          
BLAST of Cell cycle control protein 50A vs. Planmine SMEST
Match: SMESG000061468.1 (SMESG000061468.1)

HSP 1 Score: 280.796 bits (717), Expect = 6.281e-91
Identity = 150/342 (43.86%), Postives = 200/342 (58.48%), Query Frame = 2
Query:   80 DENVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSD-------GQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPY-QYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPTSWANTMKPPNWPISALDRSPDAYSGDEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINEFDSRQQ 1081
            D   N  K    S FHQQ L  W P+I    +Y  F + GI+F+++G  L   S  + E   DYT+C   D        + CS +L  +NYT  YQSC C I   +       V+ YY L NFFQNHRRY  S+DDKQL G  +   +  C+P+ + +N S    YAPCG+IANSLFNDTFQL ++ +   I V     GIAW  + ++ YG PT WANT+KP NW  SA +RS  +Y GDEDLLVWMRTA L  FKK+     H   PF NG+P G Y L INY+YPV+ F G K   L+TT+ +GGKN +LGI+++ +G  +  +A+ F+    F  +++
Sbjct:    3 DTEENQVKLLKDSNFHQQNLPSWNPVILISTIYPLFGSFGIVFILIGIGLLLSSISVNEFQYDYTHCKEYDKLNNNYSNRICSGIL-NSNYTNNYQSCLCNIKFRLDKQFSGQVYFYYSLQNFFQNHRRYFSSKDDKQLMGKSIQSASDYCKPFDKLSNGSFLQNYAPCGLIANSLFNDTFQLSFINSTNSIPVSMKKKGIAWKVDVDLLYGTPTDWANTLKPTNWKYSAEERSNSSYKGDEDLLVWMRTAPLSTFKKLSGIIKHE-SPFQNGLPAGNYELLINYAYPVSIFGGTKMVFLTTTSAMGGKNNNLGIMYITLGTIHELIALVFLVFTLFRQKKK 342          
BLAST of Cell cycle control protein 50A vs. Planmine SMEST
Match: SMESG000061468.1 (SMESG000061468.1)

HSP 1 Score: 280.796 bits (717), Expect = 1.623e-90
Identity = 150/343 (43.73%), Postives = 201/343 (58.60%), Query Frame = 2
Query:   80 DENVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNCLNSD-------GQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPY-QYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPTSWANTMKPPNWPISALDRSPDAYSGDEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKNTSLGIVFLVVGLSYFALAVCFVFINEFDSRQQS 1084
            D   N  K    S FHQQ L  W P+I    +Y  F + GI+F+++G  L   S  + E   DYT+C   D        + CS +L  +NYT  YQSC C I   +       V+ YY L NFFQNHRRY  S+DDKQL G  +   +  C+P+ + +N S    YAPCG+IANSLFNDTFQL ++ +   I V     GIAW  + ++ YG PT WANT+KP NW  SA +RS  +Y GDEDLLVWMRTA L  FKK+     H   PF NG+P G Y L INY+YPV+ F G K   L+TT+ +GGKN +LGI+++ +G  +  +A+ F+    F  ++++
Sbjct:    3 DTEENQVKLLKDSNFHQQNLPSWNPVILISTIYPLFGSFGIVFILIGIGLLLSSISVNEFQYDYTHCKEYDKLNNNYSNRICSGIL-NSNYTNNYQSCLCNIKFRLDKQFSGQVYFYYSLQNFFQNHRRYFSSKDDKQLMGKSIQSASDYCKPFDKLSNGSFLQNYAPCGLIANSLFNDTFQLSFINSTNSIPVSMKKKGIAWKVDVDLLYGTPTDWANTLKPTNWKYSAEERSNSSYKGDEDLLVWMRTAPLSTFKKLSGIIKHE-SPFQNGLPAGNYELLINYAYPVSIFGGTKMVFLTTTSAMGGKNNNLGIMYITLGTIHELIALVFLVFTLFRQKKKT 343          
The following BLAST results are available for this feature:
BLAST of Cell cycle control protein 50A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMEM30A1.638e-6241.79transmembrane protein 30A [Source:HGNC Symbol;Acc:... [more]
TMEM30B3.633e-5935.84transmembrane protein 30B [Source:HGNC Symbol;Acc:... [more]
TMEM30A4.114e-5245.42transmembrane protein 30A [Source:HGNC Symbol;Acc:... [more]
TMEM30A3.507e-5145.69transmembrane protein 30A [Source:HGNC Symbol;Acc:... [more]
TMEM30A3.507e-5145.69transmembrane protein 30A [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chat-11.684e-6538.92CDC50 family protein chat-1 [Source:UniProtKB/Swi... [more]
chat-11.684e-6538.92CDC50 family protein chat-1 [Source:UniProtKB/Swi... [more]
F20C5.41.343e-5333.14pep chromosome:WBcel235:IV:8764867:8767450:1 gene:... [more]
chat-11.004e-2641.18CDC50 family protein chat-1 [Source:UniProtKB/Swi... [more]
chat-11.004e-2641.18CDC50 family protein chat-1 [Source:UniProtKB/Swi... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CDC505.887e-8042.06gene:FBgn0030752 transcript:FBtr0074301[more]
CDC501.649e-7942.26gene:FBgn0030752 transcript:FBtr0343350[more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem30aa3.459e-7041.30transmembrane protein 30Aa [Source:ZFIN;Acc:ZDB-GE... [more]
tmem30ab9.734e-7039.48transmembrane protein 30Ab [Source:ZFIN;Acc:ZDB-GE... [more]
tmem30b2.847e-6036.72transmembrane protein 30B [Source:ZFIN;Acc:ZDB-GEN... [more]
tmem30b2.847e-6036.72transmembrane protein 30B [Source:ZFIN;Acc:ZDB-GEN... [more]
tmem30c1.785e-5935.23transmembrane protein 30C [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
arhgap407.679e-7242.00Rho GTPase activating protein 40 [Source:Xenbase;A... [more]
btf3l42.401e-6237.25basic transcription factor 3-like 4 [Source:Xenbas... [more]
tmem30cp2.760e-5937.43transmembrane protein 30C, pseudogene [Source:NCBI... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tmem30a5.440e-6541.12transmembrane protein 30A [Source:MGI Symbol;Acc:M... [more]
Tmem30b5.480e-6237.76transmembrane protein 30B [Source:MGI Symbol;Acc:M... [more]
Tmem30a2.325e-5343.62transmembrane protein 30A [Source:MGI Symbol;Acc:M... [more]
Tmem30c3.736e-4532.66transmembrane protein 30C [Source:MGI Symbol;Acc:M... [more]
Tmem30c3.736e-4532.66transmembrane protein 30C [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Cell cycle control protein 50A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|H2L0H3|CHAT1_CAEEL2.142e-6438.92CDC50 family protein chat-1 OS=Caenorhabditis eleg... [more]
sp|Q8VEK0|CC50A_MOUSE3.805e-6441.12Cell cycle control protein 50A OS=Mus musculus OX=... [more]
sp|Q5F362|CC50A_CHICK1.541e-6341.50Cell cycle control protein 50A OS=Gallus gallus OX... [more]
sp|Q5R6C0|CC50A_PONAB5.485e-6241.79Cell cycle control protein 50A OS=Pongo abelii OX=... [more]
sp|Q9NV96|CC50A_HUMAN7.867e-6241.79Cell cycle control protein 50A OS=Homo sapiens OX=... [more]
back to top
BLAST of Cell cycle control protein 50A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8J5W32.083e-10148.15Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A504YJI39.338e-9244.71Cell cycle control protein 50A OS=Fasciola giganti... [more]
A0A267G2J13.892e-9144.61Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DEB64.507e-9144.61Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267EYS73.142e-9041.37Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem30aa6.340e-7241.89cell cycle control protein 50A-like [Source:NCBI g... [more]
tmem30ab1.746e-6940.91cell cycle control protein 50A [Source:NCBI gene;A... [more]
tmem30c1.140e-5735.93cell cycle control protein 50A-like [Source:NCBI g... [more]
tmem30b1.207e-5239.29transmembrane protein 30B [Source:ZFIN;Acc:ZDB-GEN... [more]
tmem30c9.217e-5233.24cell cycle control protein 50A-like [Source:NCBI g... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem30b2.531e-7640.87transmembrane protein 30B [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
CDC502.399e-5130.56Endosomal protein that interacts with phospholipid... [more]
YNR048W3.461e-5030.65Potential noncatalytic subunit for phospholipid tr... [more]
LEM35.754e-3729.49Membrane protein of the plasma membrane and ER; in... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO478581.957e-7138.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tmem30aa9.375e-7140.97transmembrane protein 30A [Source:NCBI gene;Acc:10... [more]
tmem30b1.142e-6537.76cell cycle control protein 50A [Source:NCBI gene;A... [more]
tmem30c2.340e-5636.20cell cycle control protein 50A-like [Source:NCBI g... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035028.10.000e+099.74SMESG000035028.1[more]
SMESG000035028.10.000e+0100.00SMESG000035028.1[more]
SMESG000061468.14.675e-9143.50SMESG000061468.1[more]
SMESG000061468.16.281e-9143.86SMESG000061468.1[more]
SMESG000061468.11.623e-9043.73SMESG000061468.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004751 ID=SMED30004751|Name=Cell cycle control protein 50A|organism=Schmidtea mediterranea sexual|type=transcript|length=1410bp
TAACTAACAATTTCATCTGAAATTACATTTTGTTTATATATACATGTAAA
AAATAAATAATTCTATTCAAATGAATTTAGACGAAAACGTCAATATATCG
AAAAGACCGAATGCTTCAGCTTTTCACCAACAAAAATTAAAAGGCTGGAA
ACCGATAATAGCTACCAAAAACATGTATTTACCATTTTTTGCCATCGGTA
TAATTTTCATGGTTGTTGGCTCAGTCTTAACTTATTATTCATATCAGATA
ATAGAAGTGAATATAGATTACACTAATTGTTTAAACAGTGATGGGCAACA
GTGTTCAGATGTACTTTTGAAAAATAACTATACATATCGTTATCAAAGTT
GTCAGTGTAAAATTAACATGACTATTCCTACCGATATTAAAAGTCCTGTA
TTTTCATATTATGGATTAACCAATTTTTTTCAAAACCACCGTCGTTATGT
AAAATCCCGAGACGATAAACAATTAAAAGGATTATATGTGCCATTATTAA
ATAGTAATTGCCAGCCATATCAATACACAAATTCATCTAATTCTATTGGA
TATGCTCCATGTGGAATTATAGCAAACAGCTTATTTAATGATACCTTCCA
ACTGGATTATCTACAAAACGACACACTTATTACCGTTCCTTGGACCAGTA
CTGGAATTGCTTGGCCTTCAGAAACTAATGTGAGATATGGGAAACCTACA
AGCTGGGCCAACACAATGAAACCACCGAATTGGCCTATTTCAGCTCTCGA
TAGAAGTCCCGATGCTTATTCCGGTGATGAGGATTTACTCGTCTGGATGA
GAACTGCTGCTTTGCCTAATTTTAAAAAGATGCATAGAAAGTTTATTCAT
AATTTTGATCCGTTTCTGAATGGAATTCCACGAGGGTTCTATGTGCTCTC
CATTAACTATTCCTATCCAGTTACTCCCTTCCAAGGAGTTAAAACCTTCA
GTTTATCCACGACTAACATCCTGGGAGGCAAAAATACATCCCTAGGAATA
GTGTTCCTGGTTGTTGGTTTATCCTATTTCGCCTTAGCTGTTTGCTTCGT
GTTTATCAACGAATTTGATTCTCGGCAGCAATCAGAGGAGGCTTGGTATA
TTGCCAATCAGAATCGAATTAGTGGCTGCCCGAATGAAACGTTTTGCAAT
GTAGATAATAACGAAGAGATAATAGGGTTTAGTGATGAGTACTATGGATC
TGTAAATCGAACCGTCTGATGCTATTTTTTCGAGAGGCTTTTTTGCAATA
TCATGAAATATTTTCAATATATTTTACACATCTCATTTGCCATAATATAA
TATTAATAAAGTGTAAATTATTTACAAATCAAATCCTATGCTGTTTATTT
TACTGATATTTTGAATGTTTATGTTTTTCTTTTATAAAATGAAGGTCTGT
TTTATTTCAA
back to top

protein sequence of SMED30004751-orf-1

>SMED30004751-orf-1 ID=SMED30004751-orf-1|Name=SMED30004751-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=383bp
MNLDENVNISKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVG
SVLTYYSYQIIEVNIDYTNCLNSDGQQCSDVLLKNNYTYRYQSCQCKINM
TIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPY
QYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPS
ETNVRYGKPTSWANTMKPPNWPISALDRSPDAYSGDEDLLVWMRTAALPN
FKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNI
LGGKNTSLGIVFLVVGLSYFALAVCFVFINEFDSRQQSEEAWYIANQNRI
SGCPNETFCNVDNNEEIIGFSDEYYGSVNRTV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005045CDC50/LEM3_fam
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005045CDC50/LEM3 familyPIRSFPIRSF015840Lem3/Cdc50coord: 2..348
e-value: 5.8E-95
score: 315.6
IPR005045CDC50/LEM3 familyPFAMPF03381CDC50coord: 54..333
e-value: 2.1E-80
score: 270.2
IPR005045CDC50/LEM3 familyPANTHERPTHR10926CELL CYCLE CONTROL PROTEIN 50coord: 7..333
NoneNo IPR availablePANTHERPTHR10926:SF0CDC50 FAMILY PROTEIN CHAT-1coord: 7..333
NoneNo IPR availableTMHMMTMhelixcoord: 36..58
NoneNo IPR availableTMHMMTMhelixcoord: 307..329