Cytochrome P450

Overview
NameCytochrome P450
Smed IDSMED30004747
Length (bp)1738
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytochrome P450 (SMED30004747) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytochrome P450 (SMED30004747) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytochrome P450 (SMED30004747) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytochrome P450 (SMED30004747) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004747

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30004747SMESG000013786.1 SMESG000013783.1 SMESG000011362.1 dd_Smed_v4_2257_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30004747SMESG000013786.1 SMESG000013783.1 SMESG000011362.1 dd_Smed_v4_2257_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004747SMESG000044505.1 SMESG000039936.1 SMESG000026760.1 SMESG000017179.1 SMESG000013786.1 SMESG000013783.1 SMESG000013781.1 SMESG000013251.1 Contig44456uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004747SMESG000044505.1 SMESG000039936.1 SMESG000026760.1 SMESG000017179.1 SMESG000013786.1 SMESG000013783.1 SMESG000013781.1 SMESG000013251.1 Contig44456newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004747SMESG000013786.1 SMESG000013783.1 Contig31874uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004747SMESG000013786.1 SMESG000013783.1 Contig31874newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30004747SMESG000013786.1 SMESG000013783.1 SMED30004747smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30004747SMESG000013786.1 SMESG000013783.1 SMED30004747smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30004747SMESG000013786.1 SMESG000013783.1 Contig29675uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30004747SMESG000013786.1 SMESG000013783.1 Contig29675newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
copulatory apparatusSMED30004747SMESG000013786.1 SMESG000013783.1 PL04018A2G10ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytochrome P450 vs. Ensembl Human
Match: CYP3A4 (cytochrome P450 family 3 subfamily A member 4 [Source:HGNC Symbol;Acc:HGNC:2637])

HSP 1 Score: 316.235 bits (809), Expect = 6.984e-101
Identity = 176/458 (38.43%), Postives = 273/458 (59.61%), Query Frame = 2
Query:  239 GFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNP-PDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDS-KTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            GF  FD  C +KYGK++  Y G  P+  + D +++K +++KE +  FT+R             +++ + ++W+R+R+L++PTFTSGKL++M P+I+   ++L + +        P+ +K++FGA +MDVI  T FG+ IDS  NP + FV N K+L  F F + F +   +FP L I   ++L     F +E   F   +++   + R + T K+  DFL LM+         DS++SK  +S K LS+ E++AQS++F+ AGYETT++ L+F+ Y LA +PD QQ L  EI   L ++     DT++ M  LD +V E+LR+ P A+R++RVC +DV +       +   KG ++ IP YA+H DP  W +PEKF   RF   +K     Y + PFG GPRNC+GMRFAL+ +K A++ +LQNF   PC+ET   L   + GLL P  P++LK+  R
Sbjct:   56 GFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFG-PVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFL-IPILEVL-NICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMI---------DSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEI-----NGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESR 496          
BLAST of Cytochrome P450 vs. Ensembl Human
Match: CYP3A7 (cytochrome P450 family 3 subfamily A member 7 [Source:HGNC Symbol;Acc:HGNC:2640])

HSP 1 Score: 313.153 bits (801), Expect = 1.024e-99
Identity = 171/459 (37.25%), Postives = 270/459 (58.82%), Query Frame = 2
Query:  233 KMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNP-PDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            + G+ TFD  C +KY K++ +Y    PM  + D +++K +++KE +  FT+R             +++ + ++W+R+R+L++PTFTSGKL++M P+I+   ++L + +        P+ +K +FGA +MDVI  T FG+ IDS  NP + FV N K+L  F+  + FV+   +FP L  +   +      F ++   F   +++   + R K T K+  DFL LM+ +   +   DSE+ K      LS+ E+MAQS++F+ AGYETT++ L+F+ Y LA +PD QQ +  EI   L ++     DT++ +  LD +V E+LR+ P A+R++RVC +DV +       +   KG ++ IP Y +H DP  W +PEKF   RF   +K     Y + PFG GPRNC+GMRFAL+ +K A+V +LQNF   PC+ET   L  ++ GLL P  PI+LK+  R
Sbjct:   54 RKGYWTFDMECYKKYRKVWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPFG-PVGFMKNAISIAEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKHVFGAYSMDVITSTSFGVSIDSLNNPQDPFVENTKKLLRFNPLDPFVLSIKVFPFLTPILEAL--NITVFPRKVISFLTKSVKQIKEGRLKETQKHRVDFLQLMIDS---QNSKDSETHK-----ALSDLELMAQSIIFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTVLQLEYLDMVVNETLRLFPVAMRLERVCKKDVEI-----NGMFIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRLGGLLQPEKPIVLKVESR 496          
BLAST of Cytochrome P450 vs. Ensembl Human
Match: CYP3A7 (cytochrome P450 family 3 subfamily A member 7 [Source:HGNC Symbol;Acc:HGNC:2640])

HSP 1 Score: 306.605 bits (784), Expect = 4.163e-97
Identity = 170/459 (37.04%), Postives = 267/459 (58.17%), Query Frame = 2
Query:  233 KMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNP-PDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            + G+ TFD  C +KY K++ +Y    PM  + D +++K +++KE +  FT+R             +++ + ++W+R+R+L++PTFTSGKL++M P+I+   ++L + +        P+ +K +FGA +MDVI  T FG+ IDS  NP + FV N K+L  F+  + FV+   +FP L  +   +      F ++   F   +++   + R K T K+  DFL LM+ +   +   DSE+ K      LS+ E+MAQS++F+ AGYETT++ L+F+ Y LA +PD QQ +  EI   L ++     DT++ +  LD +V E+LR+ P A+R++RVC +DV +       +   KG ++ IP Y +H DP  W +PEKF   RF   +K     Y + PFG GPRNC+GMRFAL+ +K A+V +LQNF   PC+ET   L  +  GLL    PI+LK   R
Sbjct:   54 RKGYWTFDMECYKKYRKVWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPFG-PVGFMKNAISIAEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKHVFGAYSMDVITSTSFGVSIDSLNNPQDPFVENTKKLLRFNPLDPFVLSIKVFPFLTPILEAL--NITVFPRKVISFLTKSVKQIKEGRLKETQKHRVDFLQLMIDS---QNSKDSETHK-----ALSDLELMAQSIIFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTVLQLEYLDMVVNETLRLFPVAMRLERVCKKDVEI-----NGMFIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESR 496          
BLAST of Cytochrome P450 vs. Ensembl Human
Match: CYP3A5 (cytochrome P450 family 3 subfamily A member 5 [Source:HGNC Symbol;Acc:HGNC:2638])

HSP 1 Score: 305.449 bits (781), Expect = 1.128e-96
Identity = 169/460 (36.74%), Postives = 264/460 (57.39%), Query Frame = 2
Query:  233 KMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPP-DTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDS-KTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            + G   FD  C +KYGK++  Y G  P+  + D ++++ +++KE +  FT+R  L          +++ + ++W+R+R+L++PTFTSGKL++M P+I+   ++L + +        P+ +K+IFGA +MDVI  T FG+ IDS  NP + FV + K+   F F +   +  ++FP L  +F  +      F K++  F   ++      R     K+  DFL LM+         DS++SK  +S K LS+ E+ AQS++F+ AGYETT++ L+F  Y LA +PD QQ L  EI   L ++     D ++ M  LD +V E+LR+ P A+R++R C +DV +       +   KG ++ IP YA+H DP  W +PE+F   RF    K +   Y + PFG GPRNC+GMRFAL+ +K A++ +LQNF   PC+ET   L     GLL P  PI+LK+  R
Sbjct:   54 RQGLWKFDTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSLG-PVGFMKSAISLAEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYSMDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEAL--NVSLFPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMI---------DSQNSKETESHKALSDLELAAQSIIFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVVNETLRLFPVAIRLERTCKKDVEI-----NGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFS-KKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQGLLQPEKPIVLKVDSR 495          
BLAST of Cytochrome P450 vs. Ensembl Human
Match: CYP3A7-CYP3A51P (CYP3A7-CYP3A51P readthrough [Source:HGNC Symbol;Acc:HGNC:51504])

HSP 1 Score: 306.22 bits (783), Expect = 1.553e-96
Identity = 170/459 (37.04%), Postives = 267/459 (58.17%), Query Frame = 2
Query:  233 KMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNP-PDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            + G+ TFD  C +KY K++ +Y    PM  + D +++K +++KE +  FT+R             +++ + ++W+R+R+L++PTFTSGKL++M P+I+   ++L + +        P+ +K +FGA +MDVI  T FG+ IDS  NP + FV N K+L  F+  + FV+   +FP L  +   +      F ++   F   +++   + R K T K+  DFL LM+ +   +   DSE+ K      LS+ E+MAQS++F+ AGYETT++ L+F+ Y LA +PD QQ +  EI   L ++     DT++ +  LD +V E+LR+ P A+R++RVC +DV +       +   KG ++ IP Y +H DP  W +PEKF   RF   +K     Y + PFG GPRNC+GMRFAL+ +K A+V +LQNF   PC+ET   L  +  GLL    PI+LK   R
Sbjct:   54 RKGYWTFDMECYKKYRKVWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPFG-PVGFMKNAISIAEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKHVFGAYSMDVITSTSFGVSIDSLNNPQDPFVENTKKLLRFNPLDPFVLSIKVFPFLTPILEAL--NITVFPRKVISFLTKSVKQIKEGRLKETQKHRVDFLQLMIDS---QNSKDSETHK-----ALSDLELMAQSIIFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTVLQLEYLDMVVNETLRLFPVAMRLERVCKKDVEI-----NGMFIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESR 496          
BLAST of Cytochrome P450 vs. Ensembl Celegans
Match: cyp-25A2 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27476])

HSP 1 Score: 197.208 bits (500), Expect = 4.456e-56
Identity = 134/438 (30.59%), Postives = 219/438 (50.00%), Query Frame = 2
Query:  230 QKMGFHTFDKM---CRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRM-ELAFRSKRAHK-MLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIEL----LKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFT-FSFFNSFVIIF-LMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVR-VDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEI 1507
            +K+G+   +K      ++YG+ + +YFG     V+ +EE +K++ IK F  F+DR+    F S + ++ +L       W+  R+ I P F++GK++ M   I   ++L    L+++ S+       DI E F  LT+DVI +  F +  + Q + N+ F +NA++        +S VI    + P+L  L+R  L K+                +    R        D L L++       E+D        SK ++  E++     FLLAGYETT+T + + SY L+K P+ QQ LY EIME       +  D++  M  LD +  E+LR  PP +  ++R C  D+T+         + KG ++    + VH +P  W  PE+F   RF+   +K++    ++PFG+GPR CVGMRFA +E K  IV +L  FE+
Sbjct:   56 EKLGYDDSNKWFNELHKQYGETFGIYFGAQMNIVLSNEEDIKEVFIKNFSNFSDRIVPPIFDSNQLNQSLLQNTYATGWKHTRSAIAPIFSTGKMKAMQETIHSKVDLFLDILREKASSG---QKWDIYEDFQGLTLDVIGKCAFAIDSNCQRDRNDVFYVNARKFIANIDIRHSKVIAASFILPELAPLWRA-LYKYTPLADAEIPLVEGLSNVYERRRGGEGSDSVDLLKLLLN-----REDDK-------SKPMTKQEVIENCFAFLLAGYETTSTAMTYCSYLLSKYPNVQQKLYEEIMEA-KENGGLTYDSIHNMKYLDYVYKETLRCYPPVIHFINRRCLADITIRGQ-----FYPKGSVVTCLPHTVHLNPENWDSPEEFHPERFENWEEKSSS-LKWIPFGVGPRYCVGMRFAEMEFKTTIVKLLDTFEL 470          
BLAST of Cytochrome P450 vs. Ensembl Celegans
Match: cyp-25A1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27477])

HSP 1 Score: 195.282 bits (495), Expect = 2.367e-55
Identity = 129/438 (29.45%), Postives = 217/438 (49.54%), Query Frame = 2
Query:  230 QKMGFHTFDKM---CRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRM--ELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIEL----LKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIF--LMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVR-VDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEI 1507
            +K+G+   ++      ++YG+ + +Y+G     V+ +E+ +K++ IK F  F+DR    +   ++    +L       W+  R+ I P F++GK++ M   I+  ++L    L+++ S+       DI + F  LT+DVI +  F +  + Q + N+ F +NAK+  +        II   ++ P+L   F K L K+                +    R        D L L++       E+D        SK ++  E++     FLLAGYETT+T + + SY L+K P+ QQ LY EIME       +  D++  M  LD +  E+LR  PP +  + R+C +D+T+         + KG I+    + VH +P  W  PE+F   RF+   +K++    ++PFG+GPR CVGMRFA +E K  IV +L  FE+
Sbjct:   56 EKLGYDDANRWFNELHEQYGETFGIYYGSQMNIVISNEKDIKEVFIKNFSNFSDRSVPSIYEANQLTASLLMNSYSSGWKHTRSAIAPIFSTGKMKAMQETINSKVDLFLDILREKASSG---QKWDIYDDFQGLTLDVIGKCAFAIDSNCQRDRNDVFYVNAKKYISNIDIRHSKIIAASVLLPELST-FWKALYKYTPLADAEIPLVEGLSNVYERRRGGEGSDSVDLLKLLLN-----REDDK-------SKPMTKQEVIENCFAFLLAGYETTSTAMTYCSYLLSKYPNVQQKLYEEIMEA-KENGGLTYDSIHNMKYLDCVYKETLRFYPPVIHFIRRLCREDITIRGQ-----FYPKGAIVVCLPHTVHRNPENWDSPEEFHPERFENWEEKSSS-LKWIPFGVGPRYCVGMRFAEMEFKTTIVKLLDTFEL 470          
BLAST of Cytochrome P450 vs. Ensembl Celegans
Match: cyp-25A3 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q1HB05])

HSP 1 Score: 194.512 bits (493), Expect = 3.829e-55
Identity = 131/431 (30.39%), Postives = 216/431 (50.12%), Query Frame = 2
Query:  242 FHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRME--LAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGI----ELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFT-FSFFNSFVI-IFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRV-DRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEI 1507
            +  ++K+ +Q +G+ + +YFG      + +EE +K++ IK F  F+DR    +   +K    +L       W+  R+ I P F++GK++ M   I   +    E+LK++ S+       DI + F  LT+DVI +  F +  + Q + N+ F +NA++  T     +S +I    +FP+L  L+ K+L ++    K           +    R        D L L++       E+D        SK ++  E++     FLLAGYETT+T + + SY L+K P+ QQ LY EIME       +  D++  M  LD +  E+LR  PP +   +R C +D+T+         + KG I+    + VH +P  W  PE+F   RF+   +K++    ++PFG+GPR CVGMRFA +E K  I  +L  FE+
Sbjct:   64 YDWYNKLHKQ-FGETFGIYFGTQLNINITNEEDIKEVFIKNFSNFSDRTPPPIIEDNKLKESLLQNTYESGWKHTRSAIAPIFSTGKMKAMHETIHSKVDLFLEILKEKASSG---QKWDIYDDFQGLTLDVIGKCAFAIDSNCQRDRNDVFYVNARKFITNIDIRHSKIISTSFLFPELSKLW-KVLYRFTDLAKAEIPLVEGLADVYERRRGGEGSDSVDLLKLLLN-----REDDK-------SKPMTKQEVIENCFAFLLAGYETTSTAMTYCSYLLSKYPNVQQKLYEEIMEA-KENGGLTYDSIHNMKYLDYVYKETLRCYPPVIHFSNRRCLKDITIRGQ-----FYPKGAIVVCLPHTVHRNPENWDSPEEFHPERFENWEEKSS-SLKWIPFGVGPRYCVGMRFAEMEFKTTIAKLLDTFEL 470          
BLAST of Cytochrome P450 vs. Ensembl Celegans
Match: cyp-25A4 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27479])

HSP 1 Score: 178.333 bits (451), Expect = 3.916e-49
Identity = 120/439 (27.33%), Postives = 219/439 (49.89%), Query Frame = 2
Query:  227 VQKMGFH---TFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRM--ELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGI----ELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLF-TFSFFNSFVI-IFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVR-VDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEI 1507
            V ++G++    +      KYG ++ +Y G      V +EE +K+I I+ F  F+DRM  ++   ++    +L       W+  R+ I P F++GK++ M   +   I    E+LK++ S+       DI E F +L++D+I +  F +  + Q +  + F + A++         S+++ + L+ P+L  L+R +   ++F    + +  +    + + +R ++ +  ND   L+    ++ET              ++  E++     FL+AGYETT+T + F +Y LA+ P  QQ LY EI +       +  D++  M  LD +  ESLR  PP     +RVC  D+T+         + +   + +  Y +H +P+ W  P++F   RF+   +K++    ++PFG+GPR CVGMRFA +E K  I  +L  FE+
Sbjct:   55 VSRLGYNDTTQWHPTLHTKYGPIFGLYCGTQLHITVSEEEDIKEIFIQNFSNFSDRMTPDIFGMNQLNQSLLQNTYATGWKHTRSAIAPIFSTGKMKAMHETLVSKIDIFLEVLKEKSSSG---QKWDIFENFQSLSLDIIGKCAFAIDSNCQRDRTDLFYVQARKFVGAVDLKKSWILPVSLILPELSWLWRFL---YKFSDLSAAELPLVKGLVDLYDRRRAGEGGNDSTDLLNLLIRRETIGK-----------MTQREVIENCFAFLIAGYETTSTAMMFSAYLLAEYPIVQQKLYEEIKKT-KENAGLNYDSIHNMKYLDCVYKESLRFYPPTTHFTNRVCLNDMTIRGQ-----IYPEDSTLKVQPYTIHRNPANWESPDEFQPERFENWEEKSSS-LKWIPFGVGPRYCVGMRFAEMEFKTTIAKLLDTFEL 469          
BLAST of Cytochrome P450 vs. Ensembl Celegans
Match: cyp-13A7 (Putative cytochrome P450 CYP13A7 [Source:UniProtKB/Swiss-Prot;Acc:Q27519])

HSP 1 Score: 172.555 bits (436), Expect = 5.811e-47
Identity = 141/476 (29.62%), Postives = 235/476 (49.37%), Query Frame = 2
Query:  269 QKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFR---SKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGI-ELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNM------------QMAIDERA--KSTDKYNDFLALMMKAH------KKETENDSESSKLMD-SKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEI-MECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRV-DRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQY-----SFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            +KYG +Y +  G     V+ D E + ++ +K+F  F  R   A +   +K     L   +G  W+R+R L +PTF++  LRK+   + + + EL++     +     +D+ E +   TMD+I +   G +        N  +   K +F     N F+I  + FP +GI  R I  K+      S Q   D              Q   DE+A  + + +  DF+ L + A       + E E D   S+++   K L+ DEI+ Q  VFLLAGY+TTA +L++ SY LA +P+ Q+ L  E+  EC   + E+  D L  +  L+ +V E+LR+ P A  V +R C     L+T++   +  + G  I +  +++H DP +W D    D + F P+  ++  +       ++PFGMGPR C+GMR A++E+K  + +IL+N+      ET+  L    +  + P S +LLK+  R
Sbjct:   62 KKYGPVYGITEGVEKTLVISDPEFVHEVFVKQFDNFYGRKLTAIQGDPNKNKRVPLVAAQGHRWKRLRTLASPTFSNKSLRKIMGTVEESVTELVRSLEKASAEGKTLDMLEYYQEFTMDIIGKMAMGQE--KSLMFRNPMLDKVKTIFKEGRNNVFMISGI-FPFVGIALRNIFAKFP-----SLQMATDIQSILEKALNKRLEQREADEKAGIEPSGEPQDFIDLFLDARSTVDFFEGEAEQDFAKSEVLKVDKHLTFDEIIGQLFVFLLAGYDTTALSLSYSSYLLATHPEIQKKLQEEVDREC--PDPEVTFDQLSKLKYLECVVKEALRLYPLASLVHNRKC-----LKTTNVLGMEIEAGTNINVDTWSLHHDPKVWGD----DVNEFKPERWESGDELFFAKGGYLPFGMGPRICIGMRLAMMEMKMLLTNILKNYTFETTPETVIPLKLVGTATIAP-SSVLLKLKSR 517          
BLAST of Cytochrome P450 vs. Ensembl Fly
Match: Cyp9c1 (gene:FBgn0015040 transcript:FBtr0072321)

HSP 1 Score: 248.054 bits (632), Expect = 7.598e-75
Identity = 151/454 (33.26%), Postives = 256/454 (56.39%), Query Frame = 2
Query:  245 HTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDR----MELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLIS----DGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSF-VIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAH---KKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIM---ECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSD-KTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGL 1558
            H+ D   R K  K+Y ++    P+  + D EL++Q+ IK F  FT+      E    +    K L  L+ + W+++R+ +TPTFTS K+R+M  LI     + ++ +++++  +   + +++K+ F   T DVIA   FG+Q++S  +PNN+F    +R+  F+F+    V+++++ PKL    R  +P  +    + F+  +     A+  R + +    D + L+M+A    K E E  +ES+   D    ++D+++AQ L+F  AG+ET AT L+F SY L  NP+ Q+ L  EI+   E LG E+ +  DTLM M  L+ +V ESLR  PPA  VDR+C  D  L+  + +  +  ++ D++ I + A+H DP  +P+PE+F   RFD +HK    Q++++PFG+G R+C+G R AL+EVK  I  ++  + + P   T  ++   ISG 
Sbjct:   59 HSIDLHLRLKQHKVYGVFNLRDPLYYLSDPELIRQVGIKNFDTFTNHRKGITEGFNDTSVISKSLLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNVEAVDFVQRQL--DAGTSELELKDFFTRYTNDVIATAAFGIQVNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILMPKLMKALR--VPVMDMNNVDYFKKLVFG---AMKYRKEQSIVRPDMIHLLMEAQRQFKAEQEGSAESAAQQDKAEFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQLG-EKPLDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLREDDLVHINVGALHHDPDNFPEPEQFRPERFDEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLRYHLKPTDRTPADMMSSISGF 504          
BLAST of Cytochrome P450 vs. Ensembl Fly
Match: Cyp6a14 (gene:FBgn0033302 transcript:FBtr0345575)

HSP 1 Score: 229.95 bits (585), Expect = 3.351e-68
Identity = 152/471 (32.27%), Postives = 248/471 (52.65%), Query Frame = 2
Query:  227 VQKMGFHTFDKMCRQKY---GKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRAHKM---LTVLKGKDWERVRNLITPTFTSGKLRKMSPLISD-----GIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMF-PKLGILFR-KILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGS--EREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTF-KISGLLGPISPILLKI 1591
            V+K  F   ++   +K+   G +  MY       ++ D + +KQ+MIK+F  F DR   AF + R   +   L  L+G++W  +R+ +TP FTSGK+++MS +I D     G  + K        +  ++IK++    T DVI    FG++ +S  +P+ +F    + +FT    ++ V  F+    +L    R K+LP       +  QFF+  ++  +D R K+  K NDF+  M++   ++ E   +   +  S  L+ +++ AQ+ VF +AG+ET+++T++   Y LA  PD QQ L  EI   L +    E+  D L  M  LD ++ E+LR  P    + R  T+D  +  SD   +   KG +  IP++ +H DP I+P+PEKFD  RFDP+  K     +++PFG GPRNC+G+RF  ++ K  +VS+L+ F+      T   L F K S LL     I LK+
Sbjct:   47 VKKYHFRDINQRIYKKFKGQGPIAGMYMFFKRTALITDLDFIKQVMIKDFSYFQDRG--AFTNPRDDPLTGHLFALEGEEWRAMRHKLTPVFTSGKIKQMSKVIVDVGLRLGDAMDKAVKEAKVEEGNVEIKDLCARFTTDVIGSCAFGLECNSLQDPSAEFRQKGREIFTRRRHSTLVQSFIFTNARLARKLRIKVLPD------DLTQFFMSTVKNTVDYRLKNGIKRNDFIEQMIELRAEDQEAAKKGQGIDLSHGLTLEQMAAQAFVFFVAGFETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGELNYDVLAQMTYLDQVLSETLRKHPLLPHLIRETTKDYQIPNSD---IVLDKGILALIPVHNIHHDPEIYPEPEKFDPSRFDPEEVKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVSNRTDVPLIFSKKSFLLTTNDGIYLKV 506          
BLAST of Cytochrome P450 vs. Ensembl Fly
Match: Cyp6a14 (gene:FBgn0033302 transcript:FBtr0302331)

HSP 1 Score: 229.95 bits (585), Expect = 3.351e-68
Identity = 152/471 (32.27%), Postives = 248/471 (52.65%), Query Frame = 2
Query:  227 VQKMGFHTFDKMCRQKY---GKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRAHKM---LTVLKGKDWERVRNLITPTFTSGKLRKMSPLISD-----GIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMF-PKLGILFR-KILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGS--EREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTF-KISGLLGPISPILLKI 1591
            V+K  F   ++   +K+   G +  MY       ++ D + +KQ+MIK+F  F DR   AF + R   +   L  L+G++W  +R+ +TP FTSGK+++MS +I D     G  + K        +  ++IK++    T DVI    FG++ +S  +P+ +F    + +FT    ++ V  F+    +L    R K+LP       +  QFF+  ++  +D R K+  K NDF+  M++   ++ E   +   +  S  L+ +++ AQ+ VF +AG+ET+++T++   Y LA  PD QQ L  EI   L +    E+  D L  M  LD ++ E+LR  P    + R  T+D  +  SD   +   KG +  IP++ +H DP I+P+PEKFD  RFDP+  K     +++PFG GPRNC+G+RF  ++ K  +VS+L+ F+      T   L F K S LL     I LK+
Sbjct:   47 VKKYHFRDINQRIYKKFKGQGPIAGMYMFFKRTALITDLDFIKQVMIKDFSYFQDRG--AFTNPRDDPLTGHLFALEGEEWRAMRHKLTPVFTSGKIKQMSKVIVDVGLRLGDAMDKAVKEAKVEEGNVEIKDLCARFTTDVIGSCAFGLECNSLQDPSAEFRQKGREIFTRRRHSTLVQSFIFTNARLARKLRIKVLPD------DLTQFFMSTVKNTVDYRLKNGIKRNDFIEQMIELRAEDQEAAKKGQGIDLSHGLTLEQMAAQAFVFFVAGFETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGELNYDVLAQMTYLDQVLSETLRKHPLLPHLIRETTKDYQIPNSD---IVLDKGILALIPVHNIHHDPEIYPEPEKFDPSRFDPEEVKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVSNRTDVPLIFSKKSFLLTTNDGIYLKV 506          
BLAST of Cytochrome P450 vs. Ensembl Fly
Match: Cyp6w1 (gene:FBgn0033065 transcript:FBtr0085987)

HSP 1 Score: 227.254 bits (578), Expect = 4.415e-67
Identity = 138/439 (31.44%), Postives = 227/439 (51.71%), Query Frame = 2
Query:  293 MYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELA--FRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNS--FVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDV-----TLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPIL 1582
            +Y    P  V+ D EL+K +MIK+F+ F +R+           +K L   +   W  +R  I+P FTSGK+++M PL+    + L+         T + +K++    T D+IA   FG++ ++  +  ++F  + + +F+ +      F IIF M P L  L R  L     F +E+ +F   ++   + ER ++ +K ND + +++   ++   N  + SK +D      D ++AQ+ VF  AG+ET+A+T+    Y LAKN   Q  L  EI++  G E  I+ + +  MP L  +V E+LR  P    ++R C+Q       TLE     +L    G  I +   AVH DP  WPDPEK+D  RF+  ++      ++MPFG+GPRNC+GMR  LL+ K  +V IL+N     C +T++ + +       P SP++
Sbjct:   73 VYMTHRPALVIRDLELIKTVMIKKFQYFNNRVLQTDPHNDALGYKNLFFARSPGWRELRTKISPVFTSGKIKQMYPLMVKIGKNLQDSAERLGSGTEVQVKDLCSRFTTDLIATIAFGVEANALQDAKSEFFYHNRAIFSLTLSRGIDFAIIF-MIPALASLARVKL-----FSRETTKFIRSSVNYVLKERERTGEKRNDLIDILLALKREAAANPGKMSKEVDL-----DYLVAQAAVFQTAGFETSASTMTMTLYELAKNEALQDRLRQEIVDFFGDEDHISYERIQEMPYLSQVVNETLRKYPIVGYIERECSQPAEGERFTLEPFHNMEL--PHGMSIYMSTVAVHRDPQYWPDPEKYDPERFNSSNRDNLNMDAYMPFGVGPRNCIGMRLGLLQSKLGLVHILRNHRFHTCDKTIKKIEW------APTSPVM 492          
BLAST of Cytochrome P450 vs. Ensembl Fly
Match: Cyp6w1 (gene:FBgn0033065 transcript:FBtr0345485)

HSP 1 Score: 227.254 bits (578), Expect = 4.415e-67
Identity = 138/439 (31.44%), Postives = 227/439 (51.71%), Query Frame = 2
Query:  293 MYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELA--FRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNS--FVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDV-----TLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPIL 1582
            +Y    P  V+ D EL+K +MIK+F+ F +R+           +K L   +   W  +R  I+P FTSGK+++M PL+    + L+         T + +K++    T D+IA   FG++ ++  +  ++F  + + +F+ +      F IIF M P L  L R  L     F +E+ +F   ++   + ER ++ +K ND + +++   ++   N  + SK +D      D ++AQ+ VF  AG+ET+A+T+    Y LAKN   Q  L  EI++  G E  I+ + +  MP L  +V E+LR  P    ++R C+Q       TLE     +L    G  I +   AVH DP  WPDPEK+D  RF+  ++      ++MPFG+GPRNC+GMR  LL+ K  +V IL+N     C +T++ + +       P SP++
Sbjct:   73 VYMTHRPALVIRDLELIKTVMIKKFQYFNNRVLQTDPHNDALGYKNLFFARSPGWRELRTKISPVFTSGKIKQMYPLMVKIGKNLQDSAERLGSGTEVQVKDLCSRFTTDLIATIAFGVEANALQDAKSEFFYHNRAIFSLTLSRGIDFAIIF-MIPALASLARVKL-----FSRETTKFIRSSVNYVLKERERTGEKRNDLIDILLALKREAAANPGKMSKEVDL-----DYLVAQAAVFQTAGFETSASTMTMTLYELAKNEALQDRLRQEIVDFFGDEDHISYERIQEMPYLSQVVNETLRKYPIVGYIERECSQPAEGERFTLEPFHNMEL--PHGMSIYMSTVAVHRDPQYWPDPEKYDPERFNSSNRDNLNMDAYMPFGVGPRNCIGMRLGLLQSKLGLVHILRNHRFHTCDKTIKKIEW------APTSPVM 492          
BLAST of Cytochrome P450 vs. Ensembl Zebrafish
Match: cyp3a65 (cytochrome P450, family 3, subfamily A, polypeptide 65 [Source:ZFIN;Acc:ZDB-GENE-050604-1])

HSP 1 Score: 303.138 bits (775), Expect = 7.335e-96
Identity = 173/473 (36.58%), Postives = 269/473 (56.87%), Query Frame = 2
Query:  233 KMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRA-HKMLTVLKGKDWERVRNLITPTFTSGKLRKM-------SPLISDGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDER------AKSTDKYNDFLALMMKAHKK-ETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKRQ 1603
            K GFH FD  C +KYG+++ +Y G  P+  + D+ ++K ++IKE +  FT+R    FR   A +  +++ +  DW R+R++++P+FTSG+L++M       S ++ D +    KR  +       DIKE FGA +MDV+  T F + IDS  NP + FV N K++  F   N   ++   FP +  +  K+   +  F      FF   +Q    +R        +T K  DFL LM+ +    + ++D E ++    K LS+ EI++QS++F+ AGYET+++TL+F+ Y LA NP+  + L  EI E   ++  +  +TLM+M  LDA + ESLR+ P A R++RVC + V +       L   K  ++ +P YA+H DP  W +PE F   RF   +K++   Y +MPFG+GPRNC+GMRFA + +K AIV ILQ F++  C ET   L    +GLL P  PI LK+  R+
Sbjct:   50 KDGFHVFDMDCFEKYGRIWGIYDGRQPVLCIMDQTIIKTVLIKECYSLFTNRRN--FRLNGALYDAVSIAEDDDWRRIRSVLSPSFTSGRLKEMFGIMKKHSHILVDSMGKTAKRGES------ADIKEFFGAYSMDVVTSTAFSVDIDSLNNPKDPFVTNIKKMLKFDLLNPLFLLIAFFPFMAPVLEKM--DFALFPTSVTDFFYAALQKIKSDRDTKTVAKDNTKKRVDFLQLMVDSQTGVKHKSDGEHTE----KGLSDHEILSQSMIFIFAGYETSSSTLSFLFYNLATNPETMKKLQEEIDETFPNQAPVDYETLMSMDYLDAALSESLRLYPVAARLERVCKKTVEI-----NGLLIPKDLVVMVPTYALHRDPDYWSEPESFKPERFTKGNKESIDPYMYMPFGLGPRNCIGMRFAQVTMKLAIVEILQRFDVSVCDETQVPLELGFNGLLSPKDPIKLKLQPRK 503          
BLAST of Cytochrome P450 vs. Ensembl Zebrafish
Match: cyp3c3 (cytochrome P450, family 3, subfamily c, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-041114-102])

HSP 1 Score: 296.975 bits (759), Expect = 1.116e-93
Identity = 178/505 (35.25%), Postives = 284/505 (56.24%), Query Frame = 2
Query:   98 IKFLLAFVVVYLIYKFGKQNQNLHVKXXXXXXXXXXXXXXXXDVQKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFR-SKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKRQH 1606
            + + L F+V+ L+Y +G        KLG  GP P PF G  L   K GF  FD  C +KYGK++ +Y G  P+ +V D E++K IM+KE +  FT+R E+    +      ++ +K + W+R+R  ++P FTSG+L+++ P+     +   K +     + P+ IKE+    ++DV+  + F + IDS  NP++ FV N K    FS F+  ++   +FP +  L  K+      F +    FF   ++   DE   S  +  DFL LM++    + +    +S+    K L++ EI++QS +F+L GYETT+TTL+F+ + LA NPD  + L  EI +    +  I+ D LM M  L+  + ES+R+ P A R++RVC + V L       +   K  ++AIP Y ++ DP +W  P++F   RF P++K    QY+FMPFG+GPRNC+GMRFAL+ VK  +V +LQNF +  C+ET   +  +++ +  P  PI LK+  R+ 
Sbjct:    9 VTWTLVFLVITLLYMYGVWPHGFFKKLGIPGPRPWPFFGTFLSYTK-GFFNFDMECAKKYGKVWGIYDGRLPILMVTDLEMIKTIMVKECYSTFTNRREVNVDLAGPLADGISAVKDERWKRIRGTLSPYFTSGRLKEIFPIAMTHADRFIKNMQKRDHEQPVKIKEVVAPYSLDVVTSSSFSVDIDSINNPDDPFVTNIKNFLKFSLFSPLILFLTLFPSIANLLGKM--GISVFSRSIMNFFYTALRKIKDEHKDSNGRV-DFLRLMIQNQIPDDQAKDTTSE-QPVKGLTDHEILSQSFIFILGGYETTSTTLSFLLHNLATNPDCLEKLVEEIDKNFPLDTPISYDALMKMDYLEMSINESMRLLPTAPRLERVCKKTVELN-----GITIPKDTLVAIPTYVLNRDPQLWDSPQEFRPERFSPENKSEFLQYAFMPFGLGPRNCIGMRFALMIVKLLVVKLLQNFSLETCKET--QIPLELTPVFQPKVPITLKLTPRKR 501          
BLAST of Cytochrome P450 vs. Ensembl Zebrafish
Match: cyp3c3 (cytochrome P450, family 3, subfamily c, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-041114-102])

HSP 1 Score: 277.715 bits (709), Expect = 1.803e-86
Identity = 159/458 (34.72%), Postives = 261/458 (56.99%), Query Frame = 2
Query:  239 GFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFR-SKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKRQH 1606
            GF  FD  C +KYGK++ +Y G  P+ +V D E++K IM+KE +  FT+R E+    +      +T +K + W+R+R  ++P FTSG+L+++ P+     +   K +     + P+ IKE+  + ++DV+  + F + IDS  NP++ FV N K    F+ F  FV++  +FP +  L  K+      F K +  FF   ++  I E  K ++   DF  LM++    + +    +S+    K L++ EI++QS +F++ GYETT+TTL F+ Y LA NPD  + L  +I +    +  I+ D LM +  L+  + ES+R+ P A R++RVC + V +       +   K  +I IP Y ++ DP +W  P +F   RF P++K    QY+FMPFG+GPRNC+GMR+AL+ VK  +V +LQNF +  C+ET   +  +++ +  P  PI LK+  R+ 
Sbjct:   34 GFFNFDMECAKKYGKVWGIYDGRLPILMVTDLEMIKTIMVKECYSTFTNRREINVDLAGPLADGITAVKDERWKRIRGTLSPYFTSGRLKEIFPIAMTHADRFIKNMQKGDHEQPVKIKEVMASYSLDVVTSSAFSVDIDSINNPDDPFVTNIKNFLKFNLFGLFVLLLTVFPSIANLLGKM--GLSMFSKPTVDFFYKALR-KIKEEHKDSNGRVDFFRLMIQNEIPDDQVKDTTSE-QPEKGLTDHEILSQSFIFIMGGYETTSTTLTFLLYNLAINPDCLEKLVEKIDKNFPLDTPISYDALMKIDYLEMSINESMRLLPTAPRLERVCKKTVEM-----NGITIPKDTMITIPTYVLNQDPQLWDSPHEFRPERFSPENKSEFLQYAFMPFGLGPRNCIGMRYALMIVKLLVVKLLQNFSVETCKET--QIPLELNPVFQPKVPITLKLTPRKR 480          
BLAST of Cytochrome P450 vs. Ensembl Zebrafish
Match: cyp3c3 (cytochrome P450, family 3, subfamily c, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-041114-102])

HSP 1 Score: 277.715 bits (709), Expect = 2.733e-86
Identity = 159/458 (34.72%), Postives = 261/458 (56.99%), Query Frame = 2
Query:  239 GFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFR-SKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKRQH 1606
            GF  FD  C +KYGK++ +Y G  P+ +V D E++K IM+KE +  FT+R E+    +      +T +K + W+R+R  ++P FTSG+L+++ P+     +   K +     + P+ IKE+  + ++DV+  + F + IDS  NP++ FV N K    F+ F  FV++  +FP +  L  K+      F K +  FF   ++  I E  K ++   DF  LM++    + +    +S+    K L++ EI++QS +F++ GYETT+TTL F+ Y LA NPD  + L  +I +    +  I+ D LM +  L+  + ES+R+ P A R++RVC + V +       +   K  +I IP Y ++ DP +W  P +F   RF P++K    QY+FMPFG+GPRNC+GMR+AL+ VK  +V +LQNF +  C+ET   +  +++ +  P  PI LK+  R+ 
Sbjct:   55 GFFNFDMECAKKYGKVWGIYDGRLPILMVTDLEMIKTIMVKECYSTFTNRREINVDLAGPLADGITAVKDERWKRIRGTLSPYFTSGRLKEIFPIAMTHADRFIKNMQKGDHEQPVKIKEVMASYSLDVVTSSAFSVDIDSINNPDDPFVTNIKNFLKFNLFGLFVLLLTVFPSIANLLGKM--GLSMFSKPTVDFFYKALR-KIKEEHKDSNGRVDFFRLMIQNEIPDDQVKDTTSE-QPEKGLTDHEILSQSFIFIMGGYETTSTTLTFLLYNLAINPDCLEKLVEKIDKNFPLDTPISYDALMKIDYLEMSINESMRLLPTAPRLERVCKKTVEM-----NGITIPKDTMITIPTYVLNQDPQLWDSPHEFRPERFSPENKSEFLQYAFMPFGLGPRNCIGMRYALMIVKLLVVKLLQNFSVETCKET--QIPLELNPVFQPKVPITLKLTPRKR 501          
BLAST of Cytochrome P450 vs. Ensembl Zebrafish
Match: cyp3c4 (cytochrome P450, family 3, subfamily C, polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-060929-96])

HSP 1 Score: 276.944 bits (707), Expect = 6.265e-86
Identity = 163/463 (35.21%), Postives = 267/463 (57.67%), Query Frame = 2
Query:  239 GFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRAHKM-------LTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETE-NDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKRQ 1603
            G   FD  C +KYGK++ +Y G  P+ +V D E++K +++KE  C+++ +    R KR   +       + ++K + W+R+R+ ++P FTSG+L+++ P+     +   K +    P+ P+ IKE+    ++DVI  + F + IDS  NP + FVIN K+   F+ FN  +++ L+FP L I  +K+      F K +  FF   ++   D+  K ++   DFL LM++    + +  DS++S+   +K L++ EI++QSLVF+L GYETT+TTL F+ Y LA NPD  + L  EI +    +  I  D LM M  L+  + ES+R+ P A R++R   + V +       L   +G ++ IP Y +  DP IW  P +F   RF P++K    QY+F+PFG+GPRNC+GMR+A++ +K  +V +LQNF +  C+ET   +  +I+    P  PI LK++ R 
Sbjct:   55 GLCNFDMECAKKYGKVWGIYDGRLPILMVTDLEVIKVVLVKE--CYSNFIN---RRKRTTGLAGPFSDGIIMVKDERWKRMRSTLSPYFTSGRLKEIFPIAMTHADRFIKNMQKKDPEQPVKIKEVVAPYSLDVITSSSFSVDIDSINNPEDPFVINVKKFIQFNMFNPLLLLILLFPSLAIPLKKM--GVTLFSKSAMDFFYSVLKKIKDDHNKESEGRVDFLKLMLQNQIPDDQIQDSDTSE-QPAKGLTDHEILSQSLVFILGGYETTSTTLTFLLYNLATNPDCLEKLVEEIDKNFPLDTPITYDALMRMDYLEMAINESMRLLPTAPRLERSAKKTVVI-----NGLTIPEGTLVGIPTYVLSHDPDIWESPGEFRPERFSPENKSEFLQYAFIPFGLGPRNCIGMRYAVMIMKLFVVKLLQNFSVETCKET--QIPLEINVTFQPKVPITLKLIPRS 502          
BLAST of Cytochrome P450 vs. Ensembl Xenopus
Match: cyp3a5 (cytochrome P450 3A29-like [Source:NCBI gene;Acc:100487054])

HSP 1 Score: 340.117 bits (871), Expect = 3.359e-110
Identity = 186/462 (40.26%), Postives = 281/462 (60.82%), Query Frame = 2
Query:  230 QKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRIS---NNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
             + G   FD  C +KYGK++ +Y G  P+  + D  ++K IM+KE +  FT+R +          +L + K + W+R+R +++PTFTSGKL++M PL++   ELL K I    NN    P+D+K IFG+ +MD++  T F + +DS  NPN+ FV NA+ LFTFSFFN   +I ++ P L  L  K+   + F   +   FF D +     +R K T +   DFL LM+ A   E ++  E  K    K LS+ EI+AQSL+F++AGYETT+TTL F++Y +A +PD Q+ L  EI   L ++     D LM M  +D ++ ESLR+ PPA+R+DRVC +  T+E +  T      G +I +P++A+H +P IWP+PE+F   RF  +++K    Y+F+PFG+GPRNC+GMRFAL+ +K A+  +LQNF +  C++T   L     G L P  PI+L ++ +
Sbjct:   45 NRHGLMEFDMECFKKYGKVWGIYEGQKPLLAIVDPVIIKSIMVKECYTNFTNRRDFGLSGPLKSSVL-ISKDEQWKRIRTVLSPTFTSGKLKQMFPLMNHYGELLVKNIHKKINN--KEPLDMKHIFGSYSMDIVLSTSFSVNVDSMNNPNDPFVTNARNLFTFSFFNPLFLISILCPFLVPLLDKM--NFCFLSLKILNFFKDAVASIKKKRQKGTHEDRVDFLQLMVDAQSNEGKSVPEEEK-HGYKELSDTEILAQSLIFIMAGYETTSTTLMFLAYNIATHPDVQRKLEEEIDALLPNKAPPTYDALMKMEYMDMVINESLRMFPPAIRIDRVCKK--TMEINGVT---IPAGVVIVVPLFALHLNPEIWPEPEEFQPERFSKENQKNQDPYNFLPFGVGPRNCIGMRFALVNMKVALTILLQNFRLETCKDTPVPLKICTKGYLKPTKPIILNLIPK 495          
BLAST of Cytochrome P450 vs. Ensembl Xenopus
Match: cyp3a5 (cytochrome P450 3A29-like [Source:NCBI gene;Acc:100487054])

HSP 1 Score: 333.569 bits (854), Expect = 1.614e-107
Identity = 183/460 (39.78%), Postives = 275/460 (59.78%), Query Frame = 2
Query:  230 QKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPD-TPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
             + G   FD  C +KYGK++ +Y G  P+  + D  ++K IMIKE +  FT+R +L         +L V K + W+R+R +++PTFTSGKL++M PL+    ELL K I     +  P+D+K IFG+ +MD++  T F + +DS  NPN+ FV NA+ LF FSFFN   +I ++ P L  L  K+   + F   +   FF D +     +R K T +   D L LM+ A   E E+  E  K    K LS+ EI+AQSL+F++AGYETT+TTL F++Y +A +PD Q+ L  EI   L ++     D LM M  +D ++ E+LR+ PPA+R+DRVC +  T+E +  T      G +I +P++ +H +P IWP+PE+F   RF  +++K    Y+F+PFG+GPRNC+GMRFAL+ +K  +  +LQNF    C++T   L     G L P  PI+L ++ +
Sbjct:   53 NRKGLMEFDMECFKKYGKVWGIYEGQKPLLAIVDPVIIKSIMIKECYSNFTNRRDLGLTGPLKSSVL-VSKDEQWKRIRTVLSPTFTSGKLKQMFPLMKHYGELLVKNIHKKIDNKEPLDMKHIFGSYSMDIVLSTSFSVNVDSMNNPNDPFVTNARNLFKFSFFNPLFLIAILCPFLVPLLDKM--NFCFLSLKILNFFKDAVASIKKKRQKGTHEDRVDLLQLMVDAQSNEGESVPEEEK-HGYKELSDTEILAQSLIFIMAGYETTSTTLMFLAYNIATHPDVQRKLEEEIDALLPNKAPPTYDALMKMEYMDMVINETLRMFPPAIRIDRVCKK--TMEINGVT---IPAGVVIVVPLFVLHLNPEIWPEPEEFQPERFSKENQKNQDPYNFLPFGVGPRNCIGMRFALVNMKLVLTILLQNFRFETCKDTPVPLKICTDGYLKPTKPIILNLIPK 503          
BLAST of Cytochrome P450 vs. Ensembl Xenopus
Match: ENSXETT00000012846.1 (cytochrome P450 3A8-like [Source:NCBI gene;Acc:100487846])

HSP 1 Score: 333.183 bits (853), Expect = 2.715e-107
Identity = 184/461 (39.91%), Postives = 277/461 (60.09%), Query Frame = 2
Query:  230 QKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPD-TPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKST--DKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
             + G   FD  C +KYG ++  Y G  P+  + D  ++K IM+KE +  FT+R +          +L + K + W+R+R +++PTFTSGKL++M PL+    ELL K I     +  P+D+K IFG+ +MD I  T F + +DS  NPN+ FV NA+ LFTFSFF    +I ++ P L  L  K+   + F   +  +FF D +     +R K    D+  DFL LM+ A   E E+  E  K    K LS+ EI+AQSL+F++AGYETT+TTL F++Y +A+ PD Q+ L  EI   L ++     D LM M  +D ++ E+LR+ PPA+R+DRVC +  T+E +  T      G +I +P++A+H +P IWP+PE+F   RF  +++K    Y+F+PFG+GPRNC+GMRFAL+ +K A+  +LQNF++  C++T   L     G L P  PI+L +V +
Sbjct:   53 NRHGLMEFDMKCFKKYGNVWGFYDGPQPVLAILDPVIIKSIMVKECYTNFTNRRDFGLSGPLKSSVL-MSKDEQWKRIRTVLSPTFTSGKLKQMFPLMKHYGELLVKNIHKKIDNKEPLDMKSIFGSYSMDTILSTSFSVNVDSMNNPNDPFVTNARNLFTFSFFKPLFLITILCPFLVPLLDKM--NFCFLSSKFLKFFKDAVASIKKKRQKGAHMDRV-DFLQLMVDAQSNEGESVPEEEK-HRHKELSDTEILAQSLIFIMAGYETTSTTLMFLTYNIARYPDVQRKLEEEINTLLPNKAPPTYDALMKMEYMDMVINETLRLLPPAIRIDRVCKK--TMEINGVT---IPAGVVIVVPLFALHLNPEIWPEPEEFQPERFSKENQKNQDPYNFLPFGVGPRNCIGMRFALVNIKLALTILLQNFKLETCKDTPVPLKVCTRGNLKPTKPIILNLVPK 503          
BLAST of Cytochrome P450 vs. Ensembl Xenopus
Match: cyp3a5 (cytochrome P450 3A29-like [Source:NCBI gene;Acc:100487054])

HSP 1 Score: 330.102 bits (845), Expect = 3.269e-106
Identity = 179/437 (40.96%), Postives = 270/437 (61.78%), Query Frame = 2
Query:  230 QKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRIS---NNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQET 1525
             + G   FD  C +KYGK++ +Y G  P+  + D  ++K IM+KE +  FT+R +          +L + K + W+R+R +++PTFTSGKL++M PL++   ELL K I    NN    P+D+K IFG+ +MD++  T F + +DS  NPN+ FV NA+ LFTFSFFN   +I ++ P L  L  K+   + F   +   FF D +     +R K T +   DFL LM+ A   E ++  E  K    K LS+ EI+AQSL+F++AGYETT+TTL F++Y +A +PD Q+ L  EI   L ++     D LM M  +D ++ ESLR+ PPA+R+DRVC +  T+E +  T      G +I +P++A+H +P IWP+PE+F   RF  +++K    Y+F+PFG+GPRNC+GMRFAL+ +K A+  +LQNF +  C++T
Sbjct:   45 NRHGLMEFDMECFKKYGKVWGIYEGQKPLLAIVDPVIIKSIMVKECYTNFTNRRDFGLSGPLKSSVL-ISKDEQWKRIRTVLSPTFTSGKLKQMFPLMNHYGELLVKNIHKKINN--KEPLDMKHIFGSYSMDIVLSTSFSVNVDSMNNPNDPFVTNARNLFTFSFFNPLFLISILCPFLVPLLDKM--NFCFLSLKILNFFKDAVASIKKKRQKGTHEDRVDFLQLMVDAQSNEGKSVPEEEK-HGYKELSDTEILAQSLIFIMAGYETTSTTLMFLAYNIATHPDVQRKLEEEIDALLPNKAPPTYDALMKMEYMDMVINESLRMFPPAIRIDRVCKK--TMEINGVT---IPAGVVIVVPLFALHLNPEIWPEPEEFQPERFSKENQKNQDPYNFLPFGVGPRNCIGMRFALVNMKVALTILLQNFRLETCKDT 470          
BLAST of Cytochrome P450 vs. Ensembl Xenopus
Match: cyp3a5 (cytochrome P450 3A29-like [Source:NCBI gene;Acc:100487054])

HSP 1 Score: 320.857 bits (821), Expect = 9.765e-103
Identity = 178/450 (39.56%), Postives = 268/450 (59.56%), Query Frame = 2
Query:  260 MCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPD-TPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            +  +K   LY +Y G  P+  + D  ++K IMIKE +  FT+R +L         +L V K + W+R+R +++PTFTSGKL++M PL+    ELL K I     +  P+D+K IFG+ +MD++  T F + +DS  NPN+ FV NA+ LF FSFFN   +I ++ P L  L  K+   + F   +   FF D +     +R K T +   D L LM+ A   E E+  E  K    K LS+ EI+AQSL+F++AGYETT+TTL F++Y +A +PD Q+ L  EI   L ++     D LM M  +D ++ E+LR+ PPA+R+DRVC +  T+E +  T      G +I +P++ +H +P IWP+PE+F   RF  +++K    Y+F+PFG+GPRNC+GMRFAL+ +K  +  +LQNF    C++T   L     G L P  PI+L ++ +
Sbjct:   51 LGNRKVSILYVIYEGQKPLLAIVDPVIIKSIMIKECYSNFTNRRDLGLTGPLKSSVL-VSKDEQWKRIRTVLSPTFTSGKLKQMFPLMKHYGELLVKNIHKKIDNKEPLDMKHIFGSYSMDIVLSTSFSVNVDSMNNPNDPFVTNARNLFKFSFFNPLFLIAILCPFLVPLLDKM--NFCFLSLKILNFFKDAVASIKKKRQKGTHEDRVDLLQLMVDAQSNEGESVPEEEK-HGYKELSDTEILAQSLIFIMAGYETTSTTLMFLAYNIATHPDVQRKLEEEIDALLPNKAPPTYDALMKMEYMDMVINETLRMFPPAIRIDRVCKK--TMEINGVT---IPAGVVIVVPLFVLHLNPEIWPEPEEFQPERFSKENQKNQDPYNFLPFGVGPRNCIGMRFALVNMKLVLTILLQNFRFETCKDTPVPLKICTDGYLKPTKPIILNLIPK 491          
BLAST of Cytochrome P450 vs. Ensembl Mouse
Match: Cyp3a41a (cytochrome P450, family 3, subfamily a, polypeptide 41A [Source:MGI Symbol;Acc:MGI:1858451])

HSP 1 Score: 327.405 bits (838), Expect = 2.255e-105
Identity = 182/457 (39.82%), Postives = 266/457 (58.21%), Query Frame = 2
Query:  239 GFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISD-GIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            G   FD  C +KYGK + ++ G  P+ V+ D E++K +++KE F  FT+R E       + K +++ K ++W+R R L++PTFTSGKL++M P+I   G  L+K  +       P+ +K++ GA ++DVI  T FG+ +DS  NP + FV  AK +    FF+  V   ++FP L  ++  +      F K+S +FF   +    + R  S  K+  DFL LMM AH    + DS        K LS+ EI AQS+VF+ AGYETT++TL+F  Y LA +PD Q+ L  EI E L ++     DT+M M  LD ++ E+LR+ P   R++R C +DV L       +   KG  + IP YA+H DP  WP+PE+F   RF  ++K +   Y +MPFG+GPRNC+GMRFA + +K A+  ++QNF   PCQET   L     GLL P  PI+LK+V R
Sbjct:   56 GLWKFDMECYEKYGKTWGLFDGQMPLFVITDPEMIKNVLVKECFSVFTNRREFGPVGIMS-KAISISKDEEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLMQEAEKGKPVTMKDVLGAYSIDVITSTSFGVNVDSLNNPEDPFVEKAKGILRVDFFDPLVFSVVLFPFLTPVYEML--NICMFPKDSIEFFKKFVNRMKESRLDSKQKHRVDFLQLMMNAHNNSKDKDSH-------KALSDMEITAQSIVFIFAGYETTSSTLSFTLYCLATHPDIQKKLQEEIDETLPNKAPPTYDTVMEMEYLDMVLNETLRLYPIGNRLERFCKKDVEL-----NGVYIPKGSTVMIPSYALHHDPQHWPEPEEFQPERFSKENKGSIDPYLYMPFGIGPRNCIGMRFAFMTMKLALTKVMQNFSFQPCQETQIPLKLSRQGLLQPEKPIVLKVVPR 497          
BLAST of Cytochrome P450 vs. Ensembl Mouse
Match: Cyp3a41b (cytochrome P450, family 3, subfamily a, polypeptide 41B [Source:MGI Symbol;Acc:MGI:3714859])

HSP 1 Score: 327.405 bits (838), Expect = 2.255e-105
Identity = 182/457 (39.82%), Postives = 266/457 (58.21%), Query Frame = 2
Query:  239 GFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISD-GIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            G   FD  C +KYGK + ++ G  P+ V+ D E++K +++KE F  FT+R E       + K +++ K ++W+R R L++PTFTSGKL++M P+I   G  L+K  +       P+ +K++ GA ++DVI  T FG+ +DS  NP + FV  AK +    FF+  V   ++FP L  ++  +      F K+S +FF   +    + R  S  K+  DFL LMM AH    + DS        K LS+ EI AQS+VF+ AGYETT++TL+F  Y LA +PD Q+ L  EI E L ++     DT+M M  LD ++ E+LR+ P   R++R C +DV L       +   KG  + IP YA+H DP  WP+PE+F   RF  ++K +   Y +MPFG+GPRNC+GMRFA + +K A+  ++QNF   PCQET   L     GLL P  PI+LK+V R
Sbjct:   56 GLWKFDMECYEKYGKTWGLFDGQMPLFVITDPEMIKNVLVKECFSVFTNRREFGPVGIMS-KAISISKDEEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLMQEAEKGKPVTMKDVLGAYSIDVITSTSFGVNVDSLNNPEDPFVEKAKGILRVDFFDPLVFSVVLFPFLTPVYEML--NICMFPKDSIEFFKKFVNRMKESRLDSKQKHRVDFLQLMMNAHNNSKDKDSH-------KALSDMEITAQSIVFIFAGYETTSSTLSFTLYCLATHPDIQKKLQEEIDETLPNKAPPTYDTVMEMEYLDMVLNETLRLYPIGNRLERFCKKDVEL-----NGVYIPKGSTVMIPSYALHHDPQHWPEPEEFQPERFSKENKGSIDPYLYMPFGIGPRNCIGMRFAFMTMKLALTKVMQNFSFQPCQETQIPLKLSRQGLLQPEKPIVLKVVPR 497          
BLAST of Cytochrome P450 vs. Ensembl Mouse
Match: Cyp3a44 (cytochrome P450, family 3, subfamily a, polypeptide 44 [Source:MGI Symbol;Acc:MGI:2449818])

HSP 1 Score: 325.479 bits (833), Expect = 1.621e-104
Identity = 178/460 (38.70%), Postives = 268/460 (58.26%), Query Frame = 2
Query:  239 GFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPP-DTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFF---IDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            G   FD  C +KYGK + ++ G +P+ V+ D E +K +++K+    FT+R E       + K +++ K ++W+R R L++PTFTSG+L++M P+I    ++L K +        P+ +K++ GA +MDVI  T FG+ +DS  NP + FV  AK+     FF+  +   ++FP L  ++  +      F  +S +FF   +D MQ   + R  S  K+  DFL LMM +H    + DS        K  SN EI  QS++F+ AGYETT++TL+F  Y LA +PD Q+ L  EI + L ++     DT+M M  LD ++ E+LR+ P   R++RVC +DV L       +   KG ++ IP YA+H DP  WPDPE+F   RF  ++K +   Y ++PFG+GPRNC+GMRFAL+ +K A+  +LQNF   PCQET   L     G+L P  PI+LK+V R
Sbjct:   56 GIWKFDMECYEKYGKTWGLFDGQTPLLVITDPETIKNVLVKDCLSVFTNRREFGPVGIMS-KAISISKDEEWKRYRALLSPTFTSGRLKEMFPVIEQYGDILVKYLRQEAEKGMPVAMKDVLGAYSMDVITSTSFGVNVDSLNNPEDPFVEEAKKFLRVDFFDPLLFSVVLFPLLTPVYEML--NICMFPNDSIEFFKKFVDRMQ---ESRLDSNQKHRVDFLQLMMNSHNNSKDKDSH-------KAFSNMEITVQSIIFISAGYETTSSTLSFTLYCLATHPDIQKKLQAEIDKALPNKATPTCDTVMEMEYLDMVLNETLRLYPIVTRLERVCKKDVEL-----NGVYIPKGSMVMIPSYALHHDPQHWPDPEEFQPERFSKENKGSIDPYVYLPFGIGPRNCIGMRFALMNMKLAVTKVLQNFSFQPCQETQIPLKLSRQGILQPEKPIVLKVVPR 497          
BLAST of Cytochrome P450 vs. Ensembl Mouse
Match: Cyp3a11 (cytochrome P450, family 3, subfamily a, polypeptide 11 [Source:MGI Symbol;Acc:MGI:88609])

HSP 1 Score: 323.553 bits (828), Expect = 6.960e-104
Identity = 200/501 (39.92%), Postives = 297/501 (59.28%), Query Frame = 2
Query:  107 LLAFVVVYLIYKFGKQNQNLHVKXXXXXXXXXXXXXXXXDVQKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPP-DTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            LLA  +V L+Y++G +   L  K G  GP PLPFLG +L+  K G   FD  C +KYGK + ++ G +P+  V D E +K +++KE F  FT+R +       + K +++ K  +W+R R L++PTFTSGKL++M P+I    ++L K +        P+ +K++ GA +MDVI  T FG+ +DS  NP + FV  AK+L  F FF+  +   ++FP L  ++  +      F K+S +FF   +    + R  S  K+  DFL LMM +H     N+S+    +  K LS+ EI AQS++F+ AGYETT++TL+F  + LA +PD Q+ L +EI E L ++     DT+M M  LD ++ E+LR+ P A R++RVC +DV L       +   KG  + IP YA+H DP  W +PE+F   RF  ++K +   Y ++PFG GPRNC+GMRFAL+ +K A+  I+QNF   PC+ET   L     GLL P  PI+LK+V R
Sbjct:   14 LLAISLV-LLYRYGTRKHELFKKQGIPGPKPLPFLGTVLNYYK-GLWKFDMECYKKYGKTWGLFDGQTPLLAVTDPETIKNVLVKECFSVFTNRRDFGPVGIMS-KAISISKDDEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLRQKAKKGKPVTMKDVLGAYSMDVITSTSFGVNVDSLNNPEDPFVEKAKKLLRFDFFDPLLFSVVLFPFLTPVYEML--NICMFPKDSIEFFKKFVDRMKESRLDSKQKHRVDFLQLMMNSH-----NNSKDK--VSHKALSDMEITAQSIIFIFAGYETTSSTLSFTLHSLATHPDIQKKLQDEIDEALPNKAPPTYDTVMEMEYLDMVLNETLRLYPIANRLERVCKKDVEL-----NGVYIPKGSTVMIPSYALHHDPQHWSEPEEFQPERFSKENKGSIDPYVYLPFGNGPRNCLGMRFALMNMKLALTKIMQNFSFQPCKETQIPLKLSRQGLLQPEKPIVLKVVPR 497          
BLAST of Cytochrome P450 vs. Ensembl Mouse
Match: Cyp3a16 (cytochrome P450, family 3, subfamily a, polypeptide 16 [Source:MGI Symbol;Acc:MGI:106099])

HSP 1 Score: 323.553 bits (828), Expect = 7.187e-104
Identity = 177/457 (38.73%), Postives = 266/457 (58.21%), Query Frame = 2
Query:  239 GFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPP-DTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            G   FD  C +KYGK + ++ G  P+ V+ D E +K +++KE F  FT+R +  F      K +++ K ++W+R R L++PTFTSG L++M P+I    ++L K +        P+ +K++ GA +MDVI  T FG+ IDS  NP + FV NAK++  F +F+   +   +FP L  ++  +      F K+S +FF   +    + R  S  K+  DF+ LMM+A+ K  + DS        K LS  EI AQS++F+ AGYETT++ L+F  Y LA +PD Q+ L  EI E L ++     DT+M M  LD ++ E+LR+ P   R+ RVC +DV +       +   KG  + IP Y +H DP  WP+PE+F   RF  ++K +   Y ++PFG GPRNC+GMRFAL+ +K A++ +LQNF   PC+ET   L      LL P+ PI+LK+V R
Sbjct:   56 GLWKFDMECYEKYGKTWGLFDGQIPLFVITDPETIKNVLVKECFSVFTNRQDF-FPVGIMSKSISLAKDEEWKRYRALLSPTFTSGNLKEMFPVIEQYGDILVKYLRQEAEKGKPVAVKDVLGAYSMDVIISTTFGVNIDSLNNPEDPFVENAKKVLRFDYFDPLSLSVALFPFLTPIYEML--NICMFPKDSIEFFKKFVDRMTENRLDSKQKHRVDFIYLMMEAYNKSKDKDSH-------KALSEIEITAQSIIFIFAGYETTSSILSFTVYSLATHPDIQKKLQEEIDEALPNKAPPTYDTVMAMEYLDMVLNETLRLYPITNRLQRVCKKDVEI-----NGIYIPKGSTVIIPSYVLHHDPQHWPEPEEFQPERFSKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALIKVLQNFSFQPCKETQIPLKLSRELLLQPVKPIVLKVVPR 497          
BLAST of Cytochrome P450 vs. UniProt/SwissProt
Match: sp|P51538|CP3A9_RAT (Cytochrome P450 3A9 OS=Rattus norvegicus OX=10116 GN=Cyp3a9 PE=2 SV=2)

HSP 1 Score: 329.331 bits (843), Expect = 2.695e-105
Identity = 179/460 (38.91%), Postives = 274/460 (59.57%), Query Frame = 2
Query:  233 KMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPD-TPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDS-KTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            + GF  FDK C +KYGKL+ +Y G  P+  + D +++K +++KE +  FT+R           K +++ + ++W+R+R L++PTFTSGKL++M P+I+   ++L + +     +  P  +K+IFGA +MDVI  T FG+ +DS  NP + FV   K+L  F  F+   +   +FP L  LF  +      F ++   FF  +++   + R K  +K   DFL LM+         +S++SK+ DS K LS+ EI+AQS++F+ AGYETT++ L+FV Y LA +PD Q+ L +EI   L ++     DTL+ M  LD +V E+LR+ P A R++RVC  DV +       +   KG ++ IP +A+H DP  WP+PE+F   RF   ++     Y ++PFG GPRNC+GMRFAL+ +K A+  +LQNF   PC+ET   L     GLL P  P+LLK+V R
Sbjct:   54 RKGFWEFDKYCHKKYGKLWGLYDGRQPVLAITDPDIIKTVLVKECYSTFTNRRNFG-PVGILKKAISISEDEEWKRIRALLSPTFTSGKLKEMFPIINQYTDMLVRNMRQGSEEGKPTSMKDIFGAYSMDVITATSFGVNVDSLNNPQDPFVEKVKKLLKFDIFDPLFLSVTLFPFLTPLFEAL--NVSMFPRDVIDFFKTSVERMKENRMKEKEKQRMDFLQLMI---------NSQNSKVKDSHKALSDVEIVAQSVIFIFAGYETTSSALSFVLYLLAIHPDIQKKLQDEIDAALPNKAHATYDTLLQMEYLDMVVNETLRLYPIAGRLERVCKTDVEI-----NGVFIPKGTVVMIPTFALHKDPHYWPEPEEFRPERFSKKNQDNINPYMYLPFGNGPRNCIGMRFALMNMKVALFRVLQNFSFQPCKETQIPLKLSKQGLLQPEKPLLLKVVSR 496          
BLAST of Cytochrome P450 vs. UniProt/SwissProt
Match: sp|P11707|CP3A6_RABIT (Cytochrome P450 3A6 OS=Oryctolagus cuniculus OX=9986 GN=CYP3A6 PE=2 SV=2)

HSP 1 Score: 329.331 bits (843), Expect = 2.890e-105
Identity = 183/460 (39.78%), Postives = 275/460 (59.78%), Query Frame = 2
Query:  233 KMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPP-DTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDS-KTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            + G   FD  CR+KYGK++ ++ G  P+ V+ D +++K +++KE +  FT+R           K +++ + +DW+RVR L++PTFTSGKL++M P+I+   ++L K +        P+D+KEIFGA +MDVI  T FG+ IDS  NP + FV N +RL  FSFF+  ++   +FP L  +F  +      F K+   F   +++   D+R K   K   DFL LM+         +S++SK +DS K L + E++AQS++ L AGYETT++TL+F+ + LA +PD QQ L  EI   L ++     DTL+ M  LD +V E+LR+ P A R++RVC +DV +  +        KG I+ +P YA+H DP  W +P++F   RF   +K     Y + PFG GPRNC+GMRFAL+ +K A+V ++QNF    C+ET   L     GLL P  PI+LK+V R
Sbjct:   52 RKGIWDFDIECRKKYGKMWGLFDGRQPLMVITDPDMIKTVLVKECYSVFTNRRSFG-PVGFMKKAVSISEDEDWKRVRTLLSPTFTSGKLKEMLPIIAQYGDVLVKNLRQEAEKGKPVDLKEIFGAYSMDVITGTSFGVNIDSLRNPQDPFVKNVRRLLKFSFFDPLLLSITLFPFLTPIFEAL--HISMFPKDVMDFLKTSVEKIKDDRLKDKQKRRVDFLQLMI---------NSQNSKEIDSHKALDDIEVVAQSIIILFAGYETTSSTLSFIMHLLATHPDVQQKLQEEIDTLLPNKELATYDTLVKMEYLDMVVNETLRLYPIAGRLERVCKKDVDINGT-----FIPKGTIVMMPTYALHRDPQHWTEPDEFRPERFSKKNKDNINPYIYHPFGAGPRNCLGMRFALMNIKLALVRLMQNFSFKLCKETQVPLKLGKQGLLQPEKPIVLKVVSR 494          
BLAST of Cytochrome P450 vs. UniProt/SwissProt
Match: sp|Q9JMA7|CP341_MOUSE (Cytochrome P450 3A41 OS=Mus musculus OX=10090 GN=Cyp3a41a PE=1 SV=2)

HSP 1 Score: 327.405 bits (838), Expect = 1.577e-104
Identity = 182/457 (39.82%), Postives = 266/457 (58.21%), Query Frame = 2
Query:  239 GFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISD-GIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            G   FD  C +KYGK + ++ G  P+ V+ D E++K +++KE F  FT+R E       + K +++ K ++W+R R L++PTFTSGKL++M P+I   G  L+K  +       P+ +K++ GA ++DVI  T FG+ +DS  NP + FV  AK +    FF+  V   ++FP L  ++  +      F K+S +FF   +    + R  S  K+  DFL LMM AH    + DS        K LS+ EI AQS+VF+ AGYETT++TL+F  Y LA +PD Q+ L  EI E L ++     DT+M M  LD ++ E+LR+ P   R++R C +DV L       +   KG  + IP YA+H DP  WP+PE+F   RF  ++K +   Y +MPFG+GPRNC+GMRFA + +K A+  ++QNF   PCQET   L     GLL P  PI+LK+V R
Sbjct:   56 GLWKFDMECYEKYGKTWGLFDGQMPLFVITDPEMIKNVLVKECFSVFTNRREFGPVGIMS-KAISISKDEEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLMQEAEKGKPVTMKDVLGAYSIDVITSTSFGVNVDSLNNPEDPFVEKAKGILRVDFFDPLVFSVVLFPFLTPVYEML--NICMFPKDSIEFFKKFVNRMKESRLDSKQKHRVDFLQLMMNAHNNSKDKDSH-------KALSDMEITAQSIVFIFAGYETTSSTLSFTLYCLATHPDIQKKLQEEIDETLPNKAPPTYDTVMEMEYLDMVLNETLRLYPIGNRLERFCKKDVEL-----NGVYIPKGSTVMIPSYALHHDPQHWPEPEEFQPERFSKENKGSIDPYLYMPFGIGPRNCIGMRFAFMTMKLALTKVMQNFSFQPCQETQIPLKLSRQGLLQPEKPIVLKVVPR 497          
BLAST of Cytochrome P450 vs. UniProt/SwissProt
Match: sp|P04800|CP3A1_RAT (Cytochrome P450 3A1 OS=Rattus norvegicus OX=10116 GN=Cyp3a1 PE=1 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 3.066e-104
Identity = 177/458 (38.65%), Postives = 270/458 (58.95%), Query Frame = 2
Query:  236 MGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPP-DTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            MG   FD  C +KYGK++ ++ G  P+  + D E++K +++KE F  FT+R +         K ++V K ++W+R R L++PTFTSG+L++M P+I    ++L K +        P+ +K++FGA +MDVI  T FG+ +DS  NP + FV   K+L  F FF+   +  ++FP L  ++  +      F K+S +FF   +    + R  S  K+  DFL LMM AH    + +S ++       LS+ EI AQS++F+ AGYE T++TL+FV + LA +PD Q+ L  EI   L ++     DT+M M  LD ++ E+LR+ P   R++RVC +DV +       +   KG ++ IP YA+H DP  WP+PE+F   RF  ++K +   Y ++PFG GPRNC+GMRFAL+ +K A+  +LQNF   PC+ET   L     GLL P  PI+LK+V R
Sbjct:   55 MGLWKFDVECHKKYGKIWGLFDGQMPLFAITDTEMIKNVLVKECFSVFTNRRDFGPVGIMG-KAVSVAKDEEWKRYRALLSPTFTSGRLKEMFPIIEQYGDILVKYLKQEAETGKPVTMKKVFGAYSMDVITSTSFGVNVDSLNNPKDPFVEKTKKLLRFDFFDPLFLSVVLFPFLTPIYEML--NICMFPKDSIEFFKKFVYRMKETRLDSVQKHRVDFLQLMMNAHNDSKDKESHTA-------LSDMEITAQSIIFIFAGYEPTSSTLSFVLHSLATHPDTQKKLQEEIDRALPNKAPPTYDTVMEMEYLDMVLNETLRLYPIGNRLERVCKKDVEI-----NGVFMPKGSVVMIPSYALHRDPQHWPEPEEFRPERFSKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCKETQIPLKLSRQGLLQPTKPIILKVVPR 497          
BLAST of Cytochrome P450 vs. UniProt/SwissProt
Match: sp|P79401|CP3AT_PIG (Cytochrome P450 3A29 OS=Sus scrofa OX=9823 GN=CYP3A29 PE=2 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 6.795e-104
Identity = 179/460 (38.91%), Postives = 272/460 (59.13%), Query Frame = 2
Query:  233 KMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPP-DTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMD-SKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            + G   FDK C Q+YGK++ +Y G  P+  V D  ++K +++KE +  FT+R             L++ + ++W+R+R L++PTFTSGKL++M P+IS   +LL   +        P+ +K+IFGA +MDVI  T FG+ IDS  NP + FV N+K+L  FSFF+ F++  + FP L  +F  +      F K S  FF  +++   + R     K   D L LM+         +S++SK MD  K+LSN+E++AQ ++F+ AGYETT++ L+ ++Y LA +PD QQ L  EI     ++     D L  M  LD +V E+LR+ P A R++R C +DV +       +   KG ++ +P++ +H DP +WP+PE+F   RF   HK T   Y+++PFG GPRNC+GMRFAL+ +K A+V +LQNF   PC+ET   L     GL  P  P++LKI+ R
Sbjct:   54 RKGVDHFDKKCFQQYGKMWGVYDGRQPLLAVTDPNMIKSVLVKECYSVFTNRRSFGPLGA-MRNALSLAEDEEWKRIRTLLSPTFTSGKLKEMFPIISHYGDLLVSNLRKEAEKGKPVTMKDIFGAYSMDVITSTAFGVNIDSLNNPQDPFVENSKKLLKFSFFDPFLLSLIFFPFLTPIFEVL--NITLFPKSSVNFFTKSVKRMKESRLTDQQKRRVDLLQLMI---------NSQNSKEMDPHKSLSNEELVAQGIIFIFAGYETTSSALSLLAYELATHPDVQQKLQEEIEATFPNKAPPTYDALAQMEYLDMVVNETLRLYPIAARLERACKKDVEIHG-----VFVPKGTVVVVPVFVLHRDPDLWPEPEEFRPERFSKKHKDTINPYTYLPFGTGPRNCIGMRFALMNMKLALVRVLQNFSFKPCKETQIPLKLTTQGLTQPEKPVVLKILPR 496          
BLAST of Cytochrome P450 vs. TrEMBL
Match: L7N381 (Uncharacterized protein OS=Xenopus tropicalis OX=8364 GN=cyp3a5 PE=3 SV=2)

HSP 1 Score: 340.117 bits (871), Expect = 5.274e-107
Identity = 186/462 (40.26%), Postives = 281/462 (60.82%), Query Frame = 2
Query:  230 QKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRIS---NNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
             + G   FD  C +KYGK++ +Y G  P+  + D  ++K IM+KE +  FT+R +          +L + K + W+R+R +++PTFTSGKL++M PL++   ELL K I    NN    P+D+K IFG+ +MD++  T F + +DS  NPN+ FV NA+ LFTFSFFN   +I ++ P L  L  K+   + F   +   FF D +     +R K T +   DFL LM+ A   E ++  E  K    K LS+ EI+AQSL+F++AGYETT+TTL F++Y +A +PD Q+ L  EI   L ++     D LM M  +D ++ ESLR+ PPA+R+DRVC +  T+E +  T      G +I +P++A+H +P IWP+PE+F   RF  +++K    Y+F+PFG+GPRNC+GMRFAL+ +K A+  +LQNF +  C++T   L     G L P  PI+L ++ +
Sbjct:   45 NRHGLMEFDMECFKKYGKVWGIYEGQKPLLAIVDPVIIKSIMVKECYTNFTNRRDFGLSGPLKSSVL-ISKDEQWKRIRTVLSPTFTSGKLKQMFPLMNHYGELLVKNIHKKINN--KEPLDMKHIFGSYSMDIVLSTSFSVNVDSMNNPNDPFVTNARNLFTFSFFNPLFLISILCPFLVPLLDKM--NFCFLSLKILNFFKDAVASIKKKRQKGTHEDRVDFLQLMVDAQSNEGKSVPEEEK-HGYKELSDTEILAQSLIFIMAGYETTSTTLMFLAYNIATHPDVQRKLEEEIDALLPNKAPPTYDALMKMEYMDMVINESLRMFPPAIRIDRVCKK--TMEINGVT---IPAGVVIVVPLFALHLNPEIWPEPEEFQPERFSKENQKNQDPYNFLPFGVGPRNCIGMRFALVNMKVALTILLQNFRLETCKDTPVPLKICTKGYLKPTKPIILNLIPK 495          
BLAST of Cytochrome P450 vs. TrEMBL
Match: F6VTP9 (Uncharacterized protein OS=Monodelphis domestica OX=13616 GN=LOC100013114 PE=3 SV=1)

HSP 1 Score: 337.421 bits (864), Expect = 8.462e-106
Identity = 181/460 (39.35%), Postives = 280/460 (60.87%), Query Frame = 2
Query:  233 KMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEF-KCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNN-PPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDS-KTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            + G   FDK C QKYGK++  Y G  P+  + D +++K +++KEF   FT+R             +TV +G+ W+R+R++I+PTFT+GKL++M P+I   I++L   I      D  +++K+IFGA ++DVI  T FG+ IDS   PN+  +++ K+L +FSF +  +I+ L+FP L  +  K+        KE+  F ++  +  I +R KS  +   DFL LM+ +   +  N S S K  +S K L+  EI+AQ++ F+ AGYETT+TTL F++Y LA +P+ Q+ L  EI   L ++     DT+  M  LD +V E+LR+ P   R++R+C +     T++   +   KG ++ IP+Y +H DP  WP+PE+F   RFD + +K+   Y F+PFG GPRNCVGMRFALL +K A+V++LQNF + PC+ET   L  +  G + P  PI+LK+V R
Sbjct:   54 RKGILEFDKQCFQKYGKMWGFYDGRLPILAILDPDIIKIVLVKEFYTLFTNRRNFGLNGI-LDSGITVAEGEKWKRIRSIISPTFTTGKLKEMFPIIKHHIDVLVNNIEKKVAQDESVNMKDIFGAYSLDVITSTSFGVDIDSINKPNDPLLVHIKKLLSFSFMSPLLILILVFPSLVPILEKM--NLSLLSKENIDFLVNASRRIIADRKKSNSRDRVDFLQLMIDS---QVMNGSRSEKRNNSPKALTEMEIVAQAVTFIFAGYETTSTTLNFITYNLATHPEIQKKLLEEIDSTLPNKAVPTYDTIFQMEYLDMVVNETLRLFPLGGRIERICQK-----TAEINGITIPKGTVMLIPVYVLHHDPEYWPEPEEFRPERFDQEGRKSIDPYVFLPFGAGPRNCVGMRFALLTLKTALVTLLQNFTMEPCKETPIPLELETKGFMQPKKPIILKLVPR 502          
BLAST of Cytochrome P450 vs. TrEMBL
Match: A0A091TGZ2 (Cytochrome P450 3A29 (Fragment) OS=Phaethon lepturus OX=97097 GN=N335_06883 PE=3 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 1.322e-105
Identity = 191/461 (41.43%), Postives = 280/461 (60.74%), Query Frame = 2
Query:  233 KMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPP-DTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAK--STDKYNDFLALMMKAHKKETENDSESSKLMDS-KTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            + G   FD+MC +KYGK++ ++ G  P+  V D  L+K I++KE +  FT+R +    S      L V + + W+R+R +++PTFTSGKL++M P+I+   E+L K I      D  + +K+IFGA +MDV+A T F + IDS +NPN+ FV N K+L   SF N  VI  ++FP +  L +K+  +      +   FF D       ER K  STD+  DFL LM+ +   ++ NDS      DS K+LS++EI+AQ+L+F+ AGYETT++TL+++SY LA +PD QQ L +EI   L ++      T+M M  LD +V ESLR+ PPA R++RVC + V L       +   KG ++ IP Y +H DP+ WP+PE+F   RF  D +++   Y+F+PFG GPRNC+GMRFALL  K A+V +LQNF    C++T   L       + P  PI+LK+V R
Sbjct:   54 RHGVLNFDQMCFEKYGKIWGIFDGRQPVLAVLDPILIKNILVKECYTIFTNRRKFGL-SGILELGLHVAEDEKWKRIRAILSPTFTSGKLKEMFPIINHYGEILVKNIEKKAANDEFVTMKDIFGAYSMDVVASTSFSVNIDSMSNPNDPFVTNIKKLLKISFLNPVVIFLVLFPFVTPLLKKM--EVTLLPSKVMDFFQDVFIKMKKEREKGSSTDRV-DFLQLMVDS---QSSNDSSKPAETDSYKSLSDEEILAQALIFVFAGYETTSSTLSYLSYNLATHPDVQQRLQDEIDANLTNKATPTYTTIMQMDYLDMVVNESLRLFPPAGRIERVCKKTVEL-----NGVTIPKGMVVIIPTYVLHHDPAYWPEPEEFRPERFSKDSRESVDPYTFLPFGAGPRNCIGMRFALLVTKVALVVLLQNFSFRTCKDTPIPLVMDTKSFMQPKQPIVLKMVPR 502          
BLAST of Cytochrome P450 vs. TrEMBL
Match: A0A1U7T770 (cytochrome P450 3A5 isoform X1 OS=Tarsius syrichta OX=1868482 GN=CYP3A160 PE=3 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 5.620e-105
Identity = 201/513 (39.18%), Postives = 305/513 (59.45%), Query Frame = 2
Query:   74 LLLSYIFDIKFLLAFVVVYLIYKFGKQNQNLHVKXXXXXXXXXXXXXXXXDVQKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISD-GIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDS-KTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            L+  +  +   LLA  +V L+Y +G  +  L  KLG  GP PLPF+GN+L  QK GF  FD+ C +KYGK++ +Y G  P+  + D +++K +++KE +  FT+R             +++ + ++W+R+R+L++PTFTSGKL++M P+I+  G  L+K    N     PI++K+ FGA +MDVI  T FG+ +DS  NP + FV   K+   F F +  +    +FP L  +F  +      F KE+  FF +++    + R K   K+  DFL LM+         DS++SK M+S K L++ EI+AQS++F+ AGYETT++ L+F+ Y LA +PD QQ L  EI     ++     D LM M  LD +V E+LR+ P A+R++RVC +D+ +      +L   KG ++ IP YA+H DP  W +PE+F   RF   +K +   Y ++PFG GPRNC+GMRFAL+ +K A+V +LQNF   PC+ET   +     GLL P  PI+L+I  R
Sbjct:    3 LIPDFAMETWVLLAISLV-LLYLYGIHSYGLFKKLGIPGPTPLPFVGNVLSYQK-GFWQFDEECYKKYGKMWGLYDGRKPVLAITDPDIIKTVLVKECYSVFTNRRSFG-PVGFMKSAISISENEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVKNMKQNAEKGKPINLKDFFGAYSMDVITATSFGVNVDSLNNPQDPFVEQTKKFLKFDFLDPLLFTITLFPFLTPVFEAL--NISVFPKEAINFFKNSVHKMKESRLKDKQKHRVDFLQLMI---------DSQNSKEMESHKALTDLEIVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDRTFPNKAPTTYDALMQMEYLDMVVNETLRLFPIAIRIERVCKKDIEI-----NRLFIPKGTVVMIPTYALHRDPKYWTEPEEFRPERFSKKNKDSIDPYIYLPFGTGPRNCIGMRFALMNMKLALVRVLQNFSFKPCKETQIPMKLGTKGLLHPEKPIVLRIESR 496          
BLAST of Cytochrome P450 vs. TrEMBL
Match: A0A0H4IV24 (Cytochrome P450 3A22 OS=Sus scrofa OX=9823 GN=CYP3A22 PE=2 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 8.182e-105
Identity = 177/460 (38.48%), Postives = 275/460 (59.78%), Query Frame = 2
Query:  233 KMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPP-DTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTD-KYNDFLALMMKAHKKETENDSESSKLMDS-KTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            + G   FDK C Q+YGK++ +Y G  P+  V D  ++K +++KE +  FT+R             L++ + ++W+R+R L++PTFTSGKL++M P+IS   +LL + +         I+ KEIFGA +MDVI  T FG+ +DS  NP + FV  A++L  F F + F++  ++FP L   F  +      F + S +FF  +++   + R K    +  D L LM+         +S++SK  D+ K LS+ E++AQS++F+ AGYETT+++L+F++Y LA +PD QQ L  EI     S+   + D L  M  LD +V E LR+ P A R++RVC +DV +       +   KG ++ +P++++H DP +WP+PE+F   RF   +K +   Y+++PFG GPRNC+GMRFAL+ +K A+V +LQNF   PC+ET   L     GL+ P  PILLK+V R
Sbjct:   54 RKGVDHFDKKCFQQYGKMWGVYDGRQPLLAVTDPNMIKSVLVKECYSVFTNRRSFGPLGA-MRNALSLAEDEEWKRIRTLLSPTFTSGKLKEMFPIISHYGDLLVRNLRKEAEKGNSINTKEIFGAYSMDVITSTAFGVNVDSLNNPRDPFVQYARKLLRFDFLDPFILSIILFPFLSPFFEVL--DITLFPRSSVKFFTQSVKRMKESRLKDQQMRRVDLLQLMI---------NSQNSKETDAHKALSDQELVAQSIIFIFAGYETTSSSLSFLAYILATHPDVQQKLQEEIDATFPSKALPSYDALAQMEYLDMVVNEILRLYPIAARLERVCKKDVEIHG-----VSVPKGTVMMVPVFSIHRDPELWPEPEEFRPERFSKKNKDSINPYTYLPFGTGPRNCIGMRFALMNMKLALVRVLQNFSFKPCKETQTTLKLSSQGLIQPEKPILLKVVPR 496          
BLAST of Cytochrome P450 vs. Ensembl Cavefish
Match: cyp3a65 (cytochrome P450 3A30-like [Source:NCBI gene;Acc:103031034])

HSP 1 Score: 314.694 bits (805), Expect = 1.739e-100
Identity = 168/460 (36.52%), Postives = 263/460 (57.17%), Query Frame = 2
Query:  233 KMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPP-DTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN-DFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKRQ 1603
            K GF  FD  C +KYGK++ +Y    P+  + D E+LK I+IKE +  FT+R          +  +++++  DW+R+R++++P+FTSG+L++M  ++      L + +          DIKEIFGA +MDV+  T F + IDS  NP++ FV N K++  F F N   +   +FP +  +  K+   + FF      FF   ++    +R  S +K   DFL LM+ + K E     +   +     L++ EI++QS++F+ AGYETT++TL+F  Y +A NP+  + L  EI +   +E  I  D +M M  LDA + ESLR+ PPA R++RVC + V +      +L   +  ++  P++ +H DP  WP+P+ F   RF   +K+    + +MPFG GPRNC+GMRFAL+ +K AIV ILQ F+++  +ET   L   ISGLL P  PI LK + R+
Sbjct:   54 KQGFQNFDLECFKKYGKVWGIYDARQPVLCIMDREILKTILIKECYSLFTNRRNFRLNGP-LYDAVSIIEDDDWKRIRSVLSPSFTSGRLKEMFGIMKTHSHTLVQNLGKTSKRGEAADIKEIFGAYSMDVVTSTAFSVDIDSLNNPDDPFVTNIKKMLKFDFLNPLFVAVALFPFIAPVLEKM--NFCFFPPAVMDFFYAALKKIKSQRVSSDNKKRVDFLQLMIDSQKSEKVEHHDKGAI---HGLTDHEILSQSMIFIFAGYETTSSTLSFFFYNIATNPETMKKLQQEIDQTFPNESLIQYDAVMNMDYLDAALSESLRLYPPAARLERVCKKTVEI-----NRLTIPQNTVVLAPVFPLHRDPEYWPEPDTFKPERFTKGNKENIDPFVYMPFGSGPRNCIGMRFALVTIKLAIVEILQRFDVILSEETKVPLELGISGLLAPKDPIKLKFIPRK 502          
BLAST of Cytochrome P450 vs. Ensembl Cavefish
Match: ENSAMXT00000012911.2 (cytochrome P450 3A56-like [Source:NCBI gene;Acc:103031560])

HSP 1 Score: 302.368 bits (773), Expect = 1.198e-95
Identity = 166/460 (36.09%), Postives = 264/460 (57.39%), Query Frame = 2
Query:  233 KMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDER-AKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKRQH 1606
            + GFH FD  C +KYGK++ ++ G  P+  + D+ ++K I++KE +  FT+R ++    +  +  L V K +DW+R+RN ++P+FTSG+L++M  ++      L K +  +  +  I +K++FGA +MDVI  T F + IDS  NP + FV N K++    F +   I+ ++FP    L  K+  K  FF +    FF+ +++    ER AK+     D L LM+ +   +TE+D +  ++   K LS+ EI++QS+ F+ AGYET+++TL+F  Y +A NP+  + L  EI +   ++  +  D +M M  L+A + ES+R+ P   R++RVC      ET +   L   +G  I IP++ +H DP  W DP  F+  RF   +K+    Y +MPFG GPRNC+GMRFALL +K AIV ILQ F+++        L   I   L P  PI LK + R +
Sbjct:   54 RKGFHAFDMECYRKYGKIWGIFDGREPVLSIADQTIVKSILVKECYTYFTNRRDVGLNGE-LYDALFVTKDEDWKRIRNHLSPSFTSGRLKEMFGIMKTHTNTLVKNLEKSRKNEGIAVKDVFGAYSMDVITSTAFSVDIDSMNNPKDPFVTNIKKMLDIDFLSPIFIVAMVFPFALPLLEKM--KISFFSQSVSDFFLGSLKKIKTEREAKNHKSRVDILQLMVDS---QTEDDQQGEEM--KKGLSDHEILSQSMSFIFAGYETSSSTLSFFFYNIATNPETMKKLQREIDQTFPNKTPVNYDAVMNMEYLEAALNESMRLFPVVARLERVCK-----ETIEINGLTIPQGTSIMIPVFPLHRDPEYWSDPSTFNPERFTKGNKENVDPYVYMPFGSGPRNCIGMRFALLAMKLAIVEILQRFDVINPDPNQVPLKLGIHPFLSPKYPIKLKFIPRAN 500          
BLAST of Cytochrome P450 vs. Ensembl Cavefish
Match: ENSAMXT00000056570.1 (cytochrome P450 3A56-like [Source:NCBI gene;Acc:103031560])

HSP 1 Score: 291.197 bits (744), Expect = 2.527e-91
Identity = 165/461 (35.79%), Postives = 259/461 (56.18%), Query Frame = 2
Query:  233 KMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTP-IDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDER-AKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKRQH 1606
            + GFH FD  C +KYGK++  + G   +  + D+ ++K I++KE +  FT+R +     +  +  L + K +DW+R+RN ++P+FTSG+L++M  +I      L K +  +  +T  + +KE+FGA +MDVI  T F + IDS  NP++ FV N K+L  F  F+   ++  +FP L  L  K+  K+  F      FF  +++    ER AK+     D L LM+ +   +TE + +  ++   K L++ EI++QS++F+ AGYET+++TL+F  Y +A NP+  + L  EI +   +   +  D +M M  LDA + ES+R+ P   R++RVC      ET +   L   +G  I IP++ +H DP  WPDP  F+  RF   +K+    Y +MPFG GPRNC+GMRFA L +K AIV ILQ F ++        L    +  L P  PI LK   R +
Sbjct:   54 RKGFHVFDMECYRKYGKIWGFFEGRDRVLCIVDKSIVKSILVKECYTYFTNRRDFGLNGE-LYDALFITKDEDWKRIRNHLSPSFTSGRLKEMFGIIQTHANTLVKNLEKSSKNTEGVAVKEVFGAYSMDVITSTAFSVDIDSMNNPDDPFVTNIKKLLDFDVFSPLFLLAGLFPFLIPLLEKM--KFSIFPAAVADFFFVSLKKIKAERKAKNHKSRVDILQLMVDS---QTEGEQQGEEM--KKGLTDHEILSQSMIFIFAGYETSSSTLSFFFYNIATNPETMKKLQQEIDQTFPNNAPVQYDAVMNMEYLDAALNESMRLFPSVARLERVCK-----ETIEINGLTIPQGTSIMIPVFPLHRDPEYWPDPSTFNPERFTKGNKENIDPYVYMPFGSGPRNCIGMRFAQLAMKLAIVEILQRFNVINPDPDQVPLKLGTNIFLAPKDPIKLKFPPRAN 501          
BLAST of Cytochrome P450 vs. Ensembl Cavefish
Match: ENSAMXT00000037313.1 (cytochrome P450 3A30-like [Source:NCBI gene;Acc:103030124])

HSP 1 Score: 267.7 bits (683), Expect = 1.819e-82
Identity = 170/462 (36.80%), Postives = 261/462 (56.49%), Query Frame = 2
Query:  239 GFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFR-SKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDG----IELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKRQH 1606
            GF  FD  C +KYGK++ +Y G  P+ +V D E++K IM+K+ +  FT+R E+           +TV+K + W R+R  ++P FTSG+L+++ P+        IE LKKR     PD P+ +K++F   +MDV+A   F + IDS  NP++ F  + K+ F FSFF+   +  ++FP    +  K+   +  F K   +FF  +++   D+      K  DF+ LM++    + + +S SS+    K L++ EI++QS +F+L GYETT+TTL F+ Y LA NPD    L  EI E       +  D LM +  L+ ++ ES+R+ P A R++RVC + V L       +   K  ++ IP Y +H DP +W  PE+F   RF P++      Y FMPFG+GPRNCVGMRFAL+ +K  +V +LQNF +  C+ET   +  ++  L  P  P+ LK   R H
Sbjct:   55 GFQNFDTECYKKYGKVWGIYDGRLPILMVLDHEMIKSIMVKDCYSVFTNRREMNKELVGPFSDGITVVKDEKWRRIRGSLSPFFTSGRLKEIFPIAEKYGDRFIENLKKR----SPDGPVKVKDVFAPFSMDVVASASFSVDIDSINNPDDPFGAHIKKFFNFSFFSPLFLFLVLFPSAAGILGKM--GFSMFAKSDMEFFYTSLKKLKDQHNNMNHKRVDFMQLMIQGQISDHQAES-SSEEQPIKGLTDHEILSQSFIFMLGGYETTSTTLTFLLYNLATNPDCLNKLMKEIDEMFPHGAPVTYDALMKLEYLEMVINESMRLFPTAPRLERVCKKTVEL-----NGITIPKDTLVTIPAYVLHRDPQLWESPEEFRPERFSPENNID--PYLFMPFGLGPRNCVGMRFALMIMKLVVVKLLQNFNVETCKET--QIPLQLDTLFRPKVPVTLKFTPRAH 500          
BLAST of Cytochrome P450 vs. Ensembl Cavefish
Match: ENSAMXT00000038927.1 (cytochrome P450 3A30-like [Source:NCBI gene;Acc:103030124])

HSP 1 Score: 267.7 bits (683), Expect = 1.819e-82
Identity = 170/462 (36.80%), Postives = 261/462 (56.49%), Query Frame = 2
Query:  239 GFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFR-SKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDG----IELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKRQH 1606
            GF  FD  C +KYGK++ +Y G  P+ +V D E++K IM+K+ +  FT+R E+           +TV+K + W R+R  ++P FTSG+L+++ P+        IE LKKR     PD P+ +K++F   +MDV+A   F + IDS  NP++ F  + K+ F FSFF+   +  ++FP    +  K+   +  F K   +FF  +++   D+      K  DF+ LM++    + + +S SS+    K L++ EI++QS +F+L GYETT+TTL F+ Y LA NPD    L  EI E       +  D LM +  L+ ++ ES+R+ P A R++RVC + V L       +   K  ++ IP Y +H DP +W  PE+F   RF P++      Y FMPFG+GPRNCVGMRFAL+ +K  +V +LQNF +  C+ET   +  ++  L  P  P+ LK   R H
Sbjct:   55 GFQNFDTECYKKYGKVWGIYDGRLPILMVLDHEMIKSIMVKDCYSVFTNRREMNKELVGPFSDGITVVKDEKWRRIRGSLSPFFTSGRLKEIFPIAEKYGDRFIENLKKR----SPDGPVKVKDVFAPFSMDVVASASFSVDIDSINNPDDPFGAHIKKFFNFSFFSPLFLFLVLFPSAAGILGKM--GFSMFAKSDMEFFYTSLKKLKDQHNNMNHKRVDFMQLMIQGQISDHQAES-SSEEQPIKGLTDHEILSQSFIFMLGGYETTSTTLTFLLYNLATNPDCLNKLMKEIDEMFPHGAPVTYDALMKLEYLEMVINESMRLFPTAPRLERVCKKTVEL-----NGITIPKDTLVTIPAYVLHRDPQLWESPEEFRPERFSPENNID--PYLFMPFGLGPRNCVGMRFALMIMKLVVVKLLQNFNVETCKET--QIPLQLDTLFRPKVPVTLKFTPRAH 500          
BLAST of Cytochrome P450 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010493.1 (pep scaffold:Pmarinus_7.0:GL494623:34025:53335:-1 gene:ENSPMAG00000009498.1 transcript:ENSPMAT00000010493.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 245.743 bits (626), Expect = 8.655e-75
Identity = 152/464 (32.76%), Postives = 245/464 (52.80%), Query Frame = 2
Query:  239 GFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNN-PPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQ----FFIDNM--QMAID-ERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKRQ 1603
            GF  FD+   Q+YG+++ +Y G  P+ +V D  +LKQI++K+  + FT+  ++         + TV   + W+R+RN+++PTF+SGK+++M PLI    ++L K +         +D+K+  G   ++    T + + I     P    +++  ++   + +N  V  F     L  LF   +P +E+ G   F      F  N+  Q   D     ST    DFL LM+ A   ET  +  +      K L++ E+ AQ+++FLLAG+ETT+T + FV+Y LA NPD Q  +  EI E L  ++  + + L  M  LD +V E++R+ PPA R+DRVC +  T++      L   K  +I +  + +H DP  W +P +F   RF  + K+    Y ++PFG GPRNC+GMRFAL+ VK A+  ILQ +    C ET          +L    P+LLK+ +R+
Sbjct:   56 GFRAFDEESFQRYGRVWGIYDGRLPVLMVADTNMLKQILVKDCLEFFTNHRKIGLNELFGEGLSTV-DDEQWKRIRNILSPTFSSGKIKQMYPLILRCADVLVKNLHEKCQSGKSVDLKQGNGEWRLETNRVTAYKIFIALVKRPPPPLLLSRSKMININIYN--VQRF----SLSALFPVFVPLFEYMGLSLFPKKICIFFKNIVQQFKTDISMNYSTKGRVDFLQLMVDAQLSETVQNGANPH--SEKYLTDSELEAQAILFLLAGFETTSTAITFVAYCLACNPDVQTKVQQEIDEFLPDDKAPSYEILNEMEYLDMVVSETMRMYPPAARLDRVCKRTTTVDN-----LVIPKDVVITVSTWVLHYDPQHWEEPNEFRPERFTKEAKEARDPYCYLPFGQGPRNCIGMRFALMSVKIAVCRILQRYSFQMCSETTIPPKLAKGSILQTEKPLLLKVSERK 505          
BLAST of Cytochrome P450 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004192.1 (pep scaffold:Pmarinus_7.0:GL501190:14217:30704:1 gene:ENSPMAG00000003752.1 transcript:ENSPMAT00000004192.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 241.891 bits (616), Expect = 2.491e-73
Identity = 153/470 (32.55%), Postives = 249/470 (52.98%), Query Frame = 2
Query:  239 GFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPP-DTPIDIK-EIFGALTMDVIA--RTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVII----FLMFP--KLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYN---DFLALMMKAHKKE-TENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKRQ 1603
            GF  FD    +KYG+++ +Y G  P+ +V D  +LKQI++K+  + FT+R +    S     +L + + + W+R+RN++TP F+ GK+++M PLI    E+L + +      + P+D+K E FG+  +D +      FG  +  +  P++      K +F   F   F +I    FL+ P  +LG+           F K++  FF   +Q   ++R K  +      DFL  M+ A   E T N +E         L++ E+ +Q+++FL+AGY+ T+T++ F++Y LA NPD Q  +  EI   L   +    +TL  M  LD +VCE+LR+   + R DRVC +     T+    L   KG ++ +P++ +H DP  W +P +F   RF  + K+    Y ++PFG GPRNC+GMRFAL+ VK A+  ILQ +    C ET     F  +  L    P+ +K+V R+
Sbjct:   56 GFREFDAESFRKYGRVWGIYDGRVPVLMVTDTNMLKQILVKDCLESFTNRRKFGL-SGPIKDVLLIAEDEHWKRIRNVLTPAFSGGKIKQMCPLIQRCAEVLVQNLHEPCQLEQPVDLKDEKFGSGILDHLEFEGEGFGEIVKQKVFPHDPVPKALKYIFLCEFSPLFAVILFFPFLISPLERLGV---------TLFDKKAIHFFHKIVQQMKNKRQKGLNDMQGRVDFLQQMVNAQLSENTSNGNED--------LTDGELESQAVLFLMAGYDNTSTSITFLAYCLACNPDVQTKVQQEIDTILPDGKLPDYETLKQMEYLDMVVCETLRMYSSSSRTDRVCKK-----TTVVNDLVIPKGVVVTVPLWVLHYDPQYWDEPHEFRPERFTKEAKEARDPYCYLPFGHGPRNCIGMRFALMSVKIAVCRILQRYSFQTCSETTIPPQFNKNTFLQLEKPLKVKVVARK 502          
BLAST of Cytochrome P450 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010515.1 (pep scaffold:Pmarinus_7.0:GL494623:61763:74387:-1 gene:ENSPMAG00000009504.1 transcript:ENSPMAT00000010515.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 232.646 bits (592), Expect = 6.372e-70
Identity = 143/462 (30.95%), Postives = 237/462 (51.30%), Query Frame = 2
Query:  239 GFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTP-IDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFG-----KESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKRQ 1603
            GF  FD+   +KYG+++  Y G  P+ VV D  +LK +++K+  + FT+R  +         M ++   + W+R+RN+++PTF+ GK+++M PLI    + L K +         +D+KE+  +  + +         I    N    F  +  R     F      I L  P    +F +++P  EF G     K++  FF   ++ +     K+     DFL LM+     ++  +  +      K L++ E+ AQ+++FLLAGYETT+T + FV+Y LA NPD Q  +  EI   L ++   + + L  M  LD +V E+LR+ PP  R DRVC +     T+    L   KG ++ +P++ +H DP  W +PE+F   RF  + K+    Y ++PFG GPRNC+GMRFAL+ +K  +  ILQ +    C ET        +  L   +P+L+++ +R+
Sbjct:   51 GFKEFDQNSFKKYGRIWGTYDGRLPLLVVADTSILKTVLVKDSLEFFTNRRNIGLNGPFKEAM-SIANDEKWKRIRNVLSPTFSGGKIKQMCPLIVRCADSLVKNLREKCQSGKLVDLKELHVSCKLRISLPKSLCALIGKYGN----FTSDTSRQMVLCFTG----INLTTP----IFPELVPPLEFLGLSFFPKKASSFFTTIVRQSDVNIKKNNKGRVDFLQLMVDVQLSKSMQNGANPH--SDKYLTDSELEAQAILFLLAGYETTSTAITFVAYCLACNPDVQTKVQQEIDRFLPNDTLPSYEILKQMEYLDMVVSETLRMYPPTSRTDRVCKK-----TTVVNDLVIPKGVVVTVPLWVLHYDPQYWDEPEEFRPERFSKEAKEARDPYCYLPFGQGPRNCIGMRFALMSMKIVVCRILQRYSFHACNETTIPPKLTKNPFLQLENPLLVQVSERK 492          
BLAST of Cytochrome P450 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000063.1 (pep scaffold:Pmarinus_7.0:GL478178:2662:7225:1 gene:ENSPMAG00000000058.1 transcript:ENSPMAT00000000063.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.667 bits (496), Expect = 1.935e-58
Identity = 112/272 (41.18%), Postives = 152/272 (55.88%), Query Frame = 2
Query:  797 FGKESFQFFIDNMQMAIDERAKS--TDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKRQH 1606
            F K+   FF+ N+Q    ER K   TD+  DFL  M+ A   ++  D E   ++  K L++ EI++Q++VFLLAGYETTA TL +++Y LA + D Q  L  EI   L  E       L     L  +V ESLR+ PPA R++R+   DV L       +   KG +I IP++ +H     W DP  F   RF  + ++   QY ++PFG GPRNC+GMRFAL+ VK AIVS+L+ F  V C ET       I GLL P  PI+LK  +R H
Sbjct:   19 FPKDVLSFFMSNLQRLKSERRKGEHTDRV-DFLQTMVDAQISDSVMD-EHGGIIPYKALTDSEILSQAMVFLLAGYETTAVTLTYIAYNLAVHVDVQDKLLEEIDATLPPEAPYCYRIL-----LPHVVSESLRLYPPAGRLERIAKMDVEL-----GGIPVPKGTVIGIPVFVIHRHSEHWDDPTAFRPERFSKEAREQRDQYCYLPFGAGPRNCIGMRFALINVKIAIVSLLRRFTFVTCPETKIPAEIGIRGLLEPKEPIILKFAERNH 278          
BLAST of Cytochrome P450 vs. Ensembl Sea Lamprey
Match: cyp4t8 (cytochrome P450, family 4, subfamily T, polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-031219-3])

HSP 1 Score: 131.339 bits (329), Expect = 5.315e-33
Identity = 99/375 (26.40%), Postives = 166/375 (44.27%), Query Frame = 2
Query:  425 LTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGI-ELLKK--RISNNPPDTPIDIKEIFG---ALTMDVIARTMFGMQIDSQTNPNNQFV--------INAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEI 1507
            L VL G  W R R L+TP F    L+    +I      +L K  R++   P       E+FG    L +  I +  F  + + QT   N +V        +  +R   F+  N +V  + + P  G  F+K         ++  +   + +++   +      +  DFL +++            SS+  D ++LS++EI  +    + AG++TTA+ L++V + LA NP  Q+   +E    L    +   D +  +P    ++ ESLR+ PP   + R  TQ + L            G  + + I+ +H +   W DPE FD  RF  ++      Y+F+PF  GPRNC+   FAL E++  +  IL  F I
Sbjct:  122 LLVLSGPKWFRNRRLLTPGFHYEILKPYIAIIGQSTASMLDKWERLTEKQPTL-----EVFGDISLLMLHSILKCAFSYEGNCQTEAGNSYVRAVYELTDLVHRRFRNFALHNKWV--YYLTPA-GRRFQKAKGHAHKHTEDVIRRRRETLKLEAQQDKTQQKRNLDFLDILL------------SSRDADGQSLSDEEIRTEVDTIMFAGHDTTASGLSWVLHALASNPHHQEVCRDEAARVLAGRSQPEWDDISNLPYTTMVIKESLRLYPPVPSIIRKLTQPLKLPHGH----VLPAGMRVCVSIFCIHRNEEFWKDPEVFDPLRFSQENSAHRHPYAFIPFSAGPRNCIDQNFALNELRVTVAMILSRFRI 472          
BLAST of Cytochrome P450 vs. Ensembl Yeast
Match: ERG11 (Lanosterol 14-alpha-demethylase; catalyzes C-14 demethylation of lanosterol to form 4,4''-dimethyl cholesta-8,14,24-triene-3-beta-ol in ergosterol biosynthesis pathway; transcriptionally down-regulated when ergosterol is in excess; member of cytochrome P450 family; associated and coordinately regulated with the P450 reductase Ncp1p; human CYP51A1 functionally complements the lethality of the erg11 null mutation [Source:SGD;Acc:S000001049])

HSP 1 Score: 83.9593 bits (206), Expect = 1.325e-17
Identity = 104/448 (23.21%), Postives = 186/448 (41.52%), Query Frame = 2
Query:  227 VQKMGFHTFDKMCRQKYGKLYPMYFGGSPMTV-VGDEELLKQIMIKEFKCFTDRMELAFRSKRAHKMLTVLKGK----DWERVRNLITPTFTSGKLRKMS-----PLISDGIELLKK-----RISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMA-IDERAKSTD-KYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECL-GSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNG-----QYSF-----------MPFGMGPRNCVGMRFALLEV 1468
            V  M  + F + C++KYG ++     G  MTV +G +         EF       +++  +  AH + T + GK    D    R +    F  G L K +     PLI++ +    +     R++     T ID+      +T+   +R++ G ++ ++ + +  ++ +            F  I  +FP L        P   +  ++  Q  I    M+ I ER K+ D +  D +  +MK           +S   D   +++ EI    +  L+ G  T+A T A++   LA+ PD QQ+LY E M  L G ++E+  D L  MP+L+  + E+LR+  P   + R   +D+ +     T      G  + +     H     +P+  +F+ HR++ D   +        Y F           +PFG G   C+G  FA  ++
Sbjct:   71 VYGMKPYEFFEECQKKYGDIFSFVLLGRVMTVYLGPKG-------HEFVFNAKLADVSAEAAYAH-LTTPVFGKGVIYDCPNSRLMEQKKFVKGALTKEAFKSYVPLIAEEVYKYFRDSKNFRLNERTTGT-IDVMVTQPEMTIFTASRSLLGKEMRAKLDTDFAYLYS-------DLDKGFTPINFVFPNL--------PLEHYRKRDHAQKAISGTYMSLIKERRKNNDIQDRDLIDSLMK-----------NSTYKDGVKMTDQEIANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQELYEEQMRVLDGGKKELTYDLLQEMPLLNQTIKETLRMHHPLHSLFRKVMKDMHVPN---TSYVIPAGYHVLVSPGYTHLRDEYFPNAHQFNIHRWNKDSASSYSVGEEVDYGFGAISKGVSSPYLPFGGGRHRCIGEHFAYCQL 480          
BLAST of Cytochrome P450 vs. Ensembl Yeast
Match: DIT2 (N-formyltyrosine oxidase; sporulation-specific microsomal enzyme involved in the production of N,N-bisformyl dityrosine required for spore wall maturation, homologous to cytochrome P-450s; SWAT-GFP and mCherry fusion proteins localize to the endoplasmic reticulum and vacuole respectively [Source:SGD;Acc:S000002810])

HSP 1 Score: 68.1662 bits (165), Expect = 1.317e-12
Identity = 99/466 (21.24%), Postives = 182/466 (39.06%), Query Frame = 2
Query:  269 QKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE--FKCFTDRMELAFRSKRAHKMLTVLK--GKDWERVRNLIT---------PTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQF---VINAKRLFTFSFFNSFVII-FLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWP------DPEKF--DYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKI 1591
            +KYG +   +FG     +V   E L QI   E  F    ++ ++ + +  A+    V+   G  W   RN +T         P F + K+            L+K R+      T I +  +   + +D I++   G    + T+  N F   +I  K+     FF +F  +  L  P     F+ ++   E   K      ++N +      A S          +++AH  E         ++D K L+++ +     + L+AG+E          Y LAK  +  Q+   + +  +   + +A+     +P+L+A + E +R+ PP   +   CT   T       ++   KG  +    +    DP  W        PE++  D      + +    + +   F  G R C+G + AL E++ ++  +L+ F      E  E LT       GP+ P+ LK+
Sbjct:   64 EKYGAV-KFFFGSRWNILVSRSEYLAQIFKDEDTFAKSGNQKKIPYSALAAYTGDNVISAYGAVWRNYRNAVTNGLQHFDDAPIFKNAKIL---------CTLIKNRLLEG--QTSIPMGPLSQRMALDNISQVALGFDFGALTHEKNAFHEHLIRIKKQIFHPFFLTFPFLDVLPIPSRKKAFKDVVSFRELLVKRVQDELVNNYKFEQTTFAASD---------LIRAHNNE---------IIDYKQLTDNIV-----IILVAGHENPQLLFNSSLYLLAKYSNEWQEKLRKEVNGITDPKGLAD-----LPLLNAFLFEVVRMYPPLSTIINRCT---TKTCKLGAEIVIPKGVYVGYNNFGTSHDPKTWGTTADDFKPERWGSDIETIRKNWRMAKNRCAVTGFHGGRRACLGEKLALTEMRISLAEMLKQFRWSLDPEWEEKLT-----PAGPLCPLNLKL 481          
BLAST of Cytochrome P450 vs. Ensembl Yeast
Match: ERG5 (C-22 sterol desaturase; a cytochrome P450 enzyme that catalyzes the formation of the C-22(23) double bond in the sterol side chain in ergosterol biosynthesis; may be a target of azole antifungal drugs [Source:SGD;Acc:S000004617])

HSP 1 Score: 63.1586 bits (152), Expect = 5.347e-11
Identity = 61/280 (21.79%), Postives = 119/280 (42.50%), Query Frame = 2
Query:  794 FFGKE----SFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSE--REIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVG-----MRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            ++GK+    + + F +  QMA D  A          A     H  +  ND +S   +  +  +N EI      FL A  + +++   ++   +A  PD    +  E +    ++   E+  D +  M   + ++ E+LR  PP + V  V  ++  +  +        KG ++   +Y    DP ++ +P++F   R+    K +  + +++ FG GP  C+G     + FA L  K+A+ +   +  + P  E +     K+   + P   +LL   KR
Sbjct:  262 WYGKKTADMAMKIFENCAQMAKDHIAAGGKPVCVMDAWCKLMHDAKNSNDDDSR--IYHREFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPNYTAP----KGAMLIPTLYPALHDPEVYENPDEFIPERWVEGSKASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFALYTDFHH-TVTPLSEKI-----KVFATIFPKDDLLLTFKKR 529          
BLAST of Cytochrome P450 vs. Ensembl Nematostella
Match: EDO36023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJV6])

HSP 1 Score: 291.967 bits (746), Expect = 4.474e-92
Identity = 173/451 (38.36%), Postives = 256/451 (56.76%), Query Frame = 2
Query:  269 QKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDR-MELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDT-PIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTF-SFFNSFVIIF-LMFPKLGILFRKI-LPKWEFFGKESFQFFIDNMQMAIDERAKS-TDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSERE-IANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            + YG+L   Y G     +V D E+ KQI++KEF  F +R +  + ++    K L  L+  DW R+R+ ITPTF++ KL+++ PLI++   +L +++     D   +D+   +G  TM+ I  T FG+   +QTNPN+QFV NA+RLF   S F    ++F  + P + ++ +++ L K    GK S  F +D  +  I  R ++ +    D L +++ A   ET +D    K      LS+DEI+AQ   F+LAGYETT+ T+AF SY LA NPD Q  L  EI E   +  +    DT++ M  L+ +V E+LR+ PP  R  R C Q  T+         F KG I+ IP++A+H DP IWP+PEKF   RF  + K+    Y+ +PFG GPRNC+GMRFALLE K A+V IL+ + +  C ET   +  + +  + P   I LKI KR
Sbjct:   75 KTYGRLCGYYMGTRAAILVADPEMAKQILVKEFDKFVNRPIVQSAQTPPTDKTLLSLQDDDWRRLRHTITPTFSAVKLKQVLPLINESCRILVEKLGEACKDGKSVDVLRSYGKFTMETIVTTAFGIDCQTQTNPNDQFVPNAQRLFGGQSLFRMLAVLFPYLQPIVSLMVKQLGLGKQTETGK-SAMFIVDAARQIIKHRRETGSQGRKDLLEILLSA---ETTDDDGRRK----NKLSDDEIVAQCFTFILAGYETTSNTMAFTSYLLALNPDKQDRLIEEIDEVAATVGDNFDYDTVLGMEYLEMVVQEALRLYPPGFRFGRTCNQSCTINGQ-----FFPKGCIVLIPVFAMHRDPEIWPEPEKFQPERFTAEAKQARHPYAHLPFGGGPRNCIGMRFALLEAKMALVYILRYYRLERCPETEVPVQLQGTITISPKHGIYLKITKR 512          
BLAST of Cytochrome P450 vs. Ensembl Nematostella
Match: EDO36004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJV2])

HSP 1 Score: 277.715 bits (709), Expect = 9.684e-87
Identity = 167/471 (35.46%), Postives = 255/471 (54.14%), Query Frame = 2
Query:  275 YGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDR------MELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDT-PIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKL----GILFRKI-LPKWEFFGKESFQFFIDNMQMAIDERAKSTDK----------------YNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSERE-IANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            YG+L   Y G     +V D E+ +QI++KEF  F +R      + L+       K L  L+  DW R+R+ +TPTF++ K++++ PLIS+   +L +++     D   +D+   +   TM+ I  T FG+   +QTNPN+QF+ NA+R F     + F I+ ++FP L     ++ R++ L +    GK S  F +D  +  I  R ++  K                  D L +++ A   ET +D    K      LS+DEI+AQ   F+LAG++ T+ T+AF SY LA NPD Q  L  EI +   +  +    DT++ M  LD +V E+LR+ PP  R+ R C Q  T+         F KG ++ IP+YA+H DP IWP+PEKF   RF  + K+    Y+++PFG GPRNC+GMRFALL+VK A+V IL+++ +  C ET   L  +    + P   + L+I KR
Sbjct:   44 YGRLCGYYRGTRASILVADPEMAQQILVKEFDKFVNRGVSEGLLPLSSHIPPTDKNLISLQDDDWRRLRHFVTPTFSAVKIKQVVPLISESCRILVEQLGQACKDGKSVDVCRTYVKFTMETIVSTAFGIDCQTQTNPNDQFLSNAQRYFGKP--SPFTILAVLFPYLQPIISVMVRRLGLGRQTEIGK-SVMFIVDAARQIIKHRRETGSKGVKYLHFPQGEPSGPRKKDLLEILLSA---ETTDDDGKRK----NKLSDDEIVAQCFTFILAGFQNTSNTMAFTSYLLALNPDKQDRLIEEIDDVAATVGDNFDYDTVLGMEYLDMVVQEALRLYPPGFRLGRTCNQSCTINGQ-----FFPKGCLVMIPVYAIHRDPEIWPEPEKFQPERFTAEAKQARHPYAYLPFGEGPRNCIGMRFALLKVKMALVYILRHYRLERCPETEVPLQLQGFISMSPKHGMHLRITKR 499          
BLAST of Cytochrome P450 vs. Ensembl Nematostella
Match: EDO30263 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1A1])

HSP 1 Score: 269.24 bits (687), Expect = 1.702e-83
Identity = 168/467 (35.97%), Postives = 250/467 (53.53%), Query Frame = 2
Query:  224 DVQKMG-FHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRAHKMLTVLKGKD--WERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDT--PIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFF-GKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECL-----GSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKI 1591
            D+Q++G  H       Q+YGK++    G +P  VVGD E+LK +M+KEF+ F +R  L FR  R+  +  +    D  W+R+R+ +TPTFTSGKLR+M+P I +  + L  +I     DT   +DI  +F  +T++VI  T FG+  + Q NPNN F   AK +F      +F+ +FLM P   + F+     + F     + ++FID  +  + +R   T    DF+ LM+ A   +            S+ LS+ EI+AQS+ FLLAG+ET++  L+  +Y+LA NP+ Q+ L  EI          S  E+AND    +  LD +V E LR+ PP   ++R C Q   +       +    G  + IP Y++H DP  WP+P+KFD  RF    K++   + F+PFG GPRNC+GMRFAL EVK  +  IL  ++ V   +T   L       L P   I L+I
Sbjct:   58 DIQRLGGIHVAPVRLMQEYGKVFAWSVGRTPAIVVGDPEILKHVMVKEFQNFRNRF-LLFRDTRSEMLHGMFSATDDKWKRIRSTLTPTFTSGKLRQMNPKIRESCDTLMDKIGKVA-DTGESVDILGMFCQMTLEVILSTAFGIDSEVQKNPNNTFSDKAKEIFKSP---TFLRMFLMLPFASVFFKI----FRFLIHNNNMKYFIDLSKEILSKRHDKTFNRKDFVDLMLSAVNPD-----------GSRKLSDPEIIAQSVTFLLAGHETSSNALSATAYYLALNPEVQERLRLEIRMAAETNSDKSPHELAND----LEYLDCVVNEVLRLHPPVHTMNRECAQACVI-----NGITIPAGMDVTIPFYSLHHDPDAWPEPDKFDPERFRGPAKESRHPFQFIPFGAGPRNCIGMRFALNEVKLVLFQILSKYKFVRSPDTQVPLVLIPGATLIPRDGIYLRI 495          
BLAST of Cytochrome P450 vs. Ensembl Nematostella
Match: EDO33559 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRX8])

HSP 1 Score: 263.462 bits (672), Expect = 1.114e-81
Identity = 157/439 (35.76%), Postives = 237/439 (53.99%), Query Frame = 2
Query:  266 RQKYGKLYPMYF-GGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRA-HKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKEIFG-ALTMDVIARTMFGMQIDSQTNPNN-QFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAID-ERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIAN-DTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLG 1564
            R+KYG+LY M+  G  P  VV D E++K IM+KEF  F DR             M+T  K + W R+RN ++P F++ K++ M PLI+   ++L  +++             F   LTMD I +T FG+Q ++QTN ++  F    K L T +     V +  + P    +F K  P        +F+  ++  +M ++ +++   ++  D L LM+ A   E            SK LS+ E++AQSL+FL+AGYETT  TL+FV+Y LA NP+ Q+ L  EI      E E+ + DT+  +P LD ++ E+LR+ PP     R CTQD  ++        F+KG  I I  Y++H DP  W DPE+FD  RF  +  ++   YS++PFG GP NCVGMRFA +E+K A+V +L+ F  V   +T  +    +  LLG
Sbjct:   38 RKKYGRLYAMFLVGKKPCVVVADPEIVKHIMVKEFSSFRDRPSFVMEQPEPFDSMMTSAKYEKWHRIRNTLSPAFSAHKMKLMVPLINSSCDVLINKLTKVAESGESFFTHKFHQGLTMDTILKTAFGIQSEAQTNYDDPAFKAARKSLSTSTTRRVIVTLLFLMPFKNYIF-KAFPSLVI---GNFEGLLEMTKMIVEVKKSNLHNEAKDMLDLMLSAAANENT----------SKKLSDMEVLAQSLIFLIAGYETTNITLSFVAYSLATNPEVQEKLQREIDSVWTEEDEMPSYDTVHNLPYLDMVISETLRLYPPGFVASRECTQDCVIKGYR-----FRKGLPIFIDAYSMHHDPEFWTDPERFDPERFSSEANQSRDPYSYLPFGHGPHNCVGMRFAQMEMKLALVRVLKKFSYVATADTPASPPVVVRALLG 457          
BLAST of Cytochrome P450 vs. Ensembl Nematostella
Match: EDO30264 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1A2])

HSP 1 Score: 263.462 bits (672), Expect = 3.903e-81
Identity = 169/492 (34.35%), Postives = 254/492 (51.63%), Query Frame = 2
Query:  224 DVQKMG-FHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMEL--AFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTP---------------------------IDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFF-GKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEI-----MECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKI 1591
            D+Q++G  H       Q+YGK++    G +P  VVGD E+LK +M+KEF+ F +R  +    RS+  H M +     +W+R+R+ +TPTFTSGKLR+M+P + +  + L  +I     DT                            +DI  +F  +++++I  T FG+    Q NPNN F   AK +F      +F+ +FLM P   +LF+     + F     + ++FID  +  + +R   T    DF+ LM+ A   +            S+ LS+ EI+AQS+ FLLAG+ET++ TL+  +Y+LA NP+ Q+ L  EI          S +E+AND    +  LD +V E LRI PPA  ++R C Q   +       +    G  + IPIY++H DP  WP+P+KFD  RF    K++   + F+PFG GPRNC+GMRFAL EVK  +  IL  ++ V   +T   L       L P   I L+I
Sbjct:   58 DIQRLGGIHVAPVRLMQEYGKVFAWSVGRTPAIVVGDPEILKHVMVKEFQNFRNRFVVFKDIRSEMRHGMFSA-TDDNWKRIRSTLTPTFTSGKLRQMTPKMRESCDTLMDKIGKVA-DTAYLVRGIKNYHFAKIGNFSKKCAIQGESVDILGMFSPMSLEIILSTAFGIDSQVQKNPNNTFSDKAKEIFKSP---TFLRMFLMLPFASVLFKI----FRFLIQNNNIKYFIDLSKEILSKRHDKTFNRKDFVDLMLSAVNPD-----------GSRKLSDPEIIAQSVTFLLAGHETSSNTLSATAYYLALNPEVQERLRLEIRMAAETNSEKSPQELAND----LEYLDCVVNEVLRIHPPAHTINRECAQACVI-----NGITIPAGMDVTIPIYSLHHDPDAWPEPDKFDPERFRGPAKESRHPFQFIPFGAGPRNCIGMRFALNEVKLVLFQILSKYKFVRSPDTQVPLVLIPGAALIPRDGIYLRI 520          
BLAST of Cytochrome P450 vs. Ensembl Medaka
Match: cyp3a (cytochrome P450, family 3, subfamily A [Source:NCBI gene;Acc:101155406])

HSP 1 Score: 301.212 bits (770), Expect = 2.086e-95
Identity = 161/463 (34.77%), Postives = 259/463 (55.94%), Query Frame = 2
Query:  233 KMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLI----SDGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQ-MAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKRQ 1603
            + GF  FD+ CR+KYGK + +Y G  P+  + D   +K +++KE +  FT+R            +    +   W+R+R++++P+FTSG+L++M  ++    ++ +  +KK+      D P+++K+ FG  +MDV+  T F + IDS  NP++ FV N K++  F F N   ++   FP LG +  K+  +  FF   +F FF   +Q +  D +        DFL LM+ + K            +  K LS+ EI++Q+++F+ AGYETT+++L F++Y LA NP+  + L  EI     ++  I    L+ M  LD++V ESLR+ P A R++RV    V +       L   K  ++ +P + +  DP +WP+PEKF   RF  ++K+T   Y++MPFG GPRNC+GMRFAL+ +K A+V ILQ +    C+ET       I GL+ P  PI LK+V R 
Sbjct:   54 RKGFPIFDEECRKKYGKTWGIYDGRQPVLCITDPATIKAVLVKECYSLFTNRRNFHLNGPMYDSVFNA-EDDQWKRIRSVLSPSFTSGRLKEMFDIMKHHSANLVNSMKKKADK---DEPLNLKDHFGPYSMDVVTSTAFSVDIDSLNNPSDPFVTNIKKMLKFDFLNPLFLLVAFFPFLGPIMEKM--ELSFFPASAFDFFYSALQKIKSDHKNNKQKSRIDFLQLMIDSQKNNQNG-------LQDKGLSDHEILSQAMIFIFAGYETTSSSLTFLAYNLATNPEVMKKLQKEIDATFPNKAPIQYAPLLEMEYLDSVVNESLRLYPIAARLERVAKATVEV-----NGLVIPKDMVVMVPTWPIQRDPELWPEPEKFKPERFSKENKETFDPYTYMPFGAGPRNCIGMRFALVSMKLALVEILQQYSFSVCKETEIPFELDIQGLIAPKRPIFLKLVPRS 498          
BLAST of Cytochrome P450 vs. Ensembl Medaka
Match: tbxas1 (thromboxane A synthase 1 [Source:NCBI gene;Acc:101158441])

HSP 1 Score: 300.056 bits (767), Expect = 3.388e-94
Identity = 168/478 (35.15%), Postives = 253/478 (52.93%), Query Frame = 2
Query:  269 QKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPD-TPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKST--DKYNDFLALMMKA----------------HKKET-------ENDSESSKLMDS-------KTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKRQ 1603
            + +G++   Y G  P+ V+ D +LL+Q+M+K+F  F +RM L F +K     L  LK + W RVR+++TP+F++ K+++M PLI+   E+L K ++ +       DI   FG  TMDVIA   F  Q+DSQ  P++ FV +A+  FTFSFF   ++ F+ FP L     + +P       E   FFI N+Q  I +R +     +  DFL LM+ A                H  ET        +D ESS+  +S       K ++ DE++ Q+ +FLLAGYETT++TL F  Y LA +P+ Q  +  E+ +            +  +  +D +V E+LR+ PP  R  R   +D  +       +   KG  + IP   +H DP  W +PEKF   RF  + K +   + ++PFG GPRNCVGMR A LE+K A+  + ++F +V C ET   L  K S  LGP + I +KI KR+
Sbjct:   76 KTHGRVCGYYLGRKPVVVIADPDLLRQVMVKDFSSFPNRMTLRFATKPMVDCLLALKDERWRRVRSILTPSFSAAKMKEMVPLINTVTEVLMKNLTTHAESGQAFDIHRCFGFFTMDVIASVAFATQVDSQNKPDDPFVHHAQMFFTFSFFRPMMMFFIAFPSLMAPVARFIPNKR--RDEMSNFFIHNIQKIIKQREEQPPDQRRRDFLQLMLDARTAKECASLDQFDTSNHGDETLTNPKAASSDQESSRSEESALRRPQKKMMTEDEVVGQAFIFLLAGYETTSSTLGFTCYLLAVHPECQHKVQQEVDQFFSRHESPDYTNIQELKYMDMVVSETLRLYPPGFRFAREVEEDCVV-----NGVRLPKGATLEIPAGFLHYDPEYWSEPEKFIPERFTAEAKASRHPFVYLPFGSGPRNCVGMRLAQLEIKMALAHLFRSFSVVACSETKVPLELKSSSTLGPKNGIFVKITKRE 546          
BLAST of Cytochrome P450 vs. Ensembl Medaka
Match: cyp3a40 (cytochrome P450 3A40 [Source:NCBI gene;Acc:100125817])

HSP 1 Score: 298.13 bits (762), Expect = 3.853e-94
Identity = 165/466 (35.41%), Postives = 261/466 (56.01%), Query Frame = 2
Query:  233 KMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLI----SDGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEF--FGKESFQFFIDNMQM--AIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKRQ 1603
            + GF  FD+ CR+KYGK + +Y G  P+  + D   +K +++KE +  FT+R          +  +++ +   W+R+R++++P+FTSG+L++M  ++    ++ I+ +KK++     D P+++KE FG  +MDV+  T F + IDS  NP++ FV N K++  F F N   +    FP LG     IL K+EF  F      FF   ++   A  E  K   +  DFL LM+ + K            +  K LS+ EI++Q+++F+ AGYETT+++L F++Y LA NP+  + L  EI     ++  +    LM M  LD +V ESLR+ P A R++RV    V +       L   K  ++ +P + +H DP +WP+PEKF   RF  ++K T   Y++MPFG GPRNC+GMRFAL+ +K A+V ILQ ++   C+ET       + G L P  PI LK+  R 
Sbjct:   54 RKGFFNFDEECRKKYGKTWGIYDGRQPVLCITDPATIKAVLVKECYSLFTNRRNFRLNGP-LYDAVSIAEDDQWKRIRSVLSPSFTSGRLKEMFDIMKHHSANLIQSMKKKVDK---DEPLEMKEYFGPYSMDVVTSTAFSVDIDSLNNPSDPFVTNIKKMLKFDFLNPLFLAVAFFPFLG----PILEKFEFSLFPSSVMDFFFAALRKIKANHENNKQKSRI-DFLQLMIDSQKNNQNG-------LQDKGLSDHEILSQAMIFIFAGYETTSSSLTFLAYNLATNPEVMKKLQKEIDATFPNKAPVQYVPLMEMEYLDCVVNESLRLYPIAARLERVAKATVEV-----NGLVIPKDMVVMVPTWPLHRDPELWPEPEKFKPERFSKENKDTFDPYTYMPFGAGPRNCIGMRFALVMMKLAVVEILQTYDFSVCKETEVPFEMDVQGFLAPKRPIQLKLTPRS 498          
BLAST of Cytochrome P450 vs. Ensembl Medaka
Match: cyp3a40 (cytochrome P450 3A40 [Source:NCBI gene;Acc:100125817])

HSP 1 Score: 294.278 bits (752), Expect = 9.889e-93
Identity = 166/466 (35.62%), Postives = 262/466 (56.22%), Query Frame = 2
Query:  233 KMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLI----SDGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEF--FGKESFQFFIDNMQM--AIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKRQ 1603
            + GF  FD+ CR+KYGK + +Y G  P+  + D   +K +++KE +  FT+R          +  +++ +   W+R+R++++P+FTSG+L++M  ++    ++ I+ +KK++     D P+++KE FG  +MDV+  T F + IDS  NP++ FV N K++  F F N   +    FP LG     IL K+EF  F      FF   ++   A  E  K   +  DFL LM+ + K            +  K LS+ EI++Q+++F+ AGYETT+++L F++Y LA NP+  + L  EI     ++  +    LM M  LD +V ESLR+ P A R++RV    V +       L   K  ++ +P + +H DP +WP+PEKF   RF  ++K T   Y++MPFG GPRNC+GMRFAL+ +K A+V ILQ ++   C+ET      K+ G L P  PI LK+  R 
Sbjct:   54 RKGFFNFDEECRKKYGKTWGIYDGRQPVLCITDPATIKAVLVKECYSLFTNRRNFRLNGP-LYDAVSIAEDDQWKRIRSVLSPSFTSGRLKEMFDIMKHHSANLIQSMKKKVDK---DEPLEMKEYFGPYSMDVVTSTAFSVDIDSLNNPSDPFVTNIKKMLKFDFLNPLFLAVAFFPFLG----PILEKFEFSLFPSSVMDFFFAALRKIKANHENNKQKSRI-DFLQLMIDSQKNNQNG-------LQDKGLSDHEILSQAMIFIFAGYETTSSSLTFLAYNLATNPEVMKKLQKEIDATFPNKAPVQYVPLMEMEYLDCVVNESLRLYPIAARLERVAKATVEV-----NGLVIPKDMVVMVPTWPLHRDPELWPEPEKFKPERFSKENKDTFDPYTYMPFGAGPRNCIGMRFALVMMKLAVVEILQTYDFSVCKETEFPFELKM-GFLAPKRPIQLKLTPRS 497          
BLAST of Cytochrome P450 vs. Ensembl Medaka
Match: ENSORLT00000004968.2 (cytochrome P450 3A30 [Source:NCBI gene;Acc:101155538])

HSP 1 Score: 276.944 bits (707), Expect = 4.850e-86
Identity = 152/460 (33.04%), Postives = 256/460 (55.65%), Query Frame = 2
Query:  230 QKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE-FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKRQH 1606
            Q  G   F++ C+ KYG ++ +Y G SP+ ++ D +++K +++KE +  FT+R  +          +  +K + W+R+R+ I+P FTSG+L+++ P ++   + L  ++     + PIDIK+     ++DV+    F ++ D   NPN+   + A +   F+ +   +II ++FP    L +    K+E   + S  FF D ++   D+         DFL +M+++   E+E   ++ K   SK L+  EI+ Q+  F+L GYETT+TTL+ + Y LA NPDA   L  EI   L  +  ++ D L  +  LD ++CESLR+ PPA  +DRVC + + +       L   +G ++ IP++ +H DP  W  P+ F   RF  +++     Y++MPFG+GPRNCVGMR+A+L +K  IV +LQN+ +  C++TL  + F       P+ PI LK V R+ 
Sbjct:   52 QMKGLFAFNRECQAKYGDVWGLYEGRSPLLMIADPKIIKTVLVKECYSTFTNRRNVFDDDGPLGNGVAAVKDERWKRIRSTISPCFTSGRLKQVFPFVARYADRLVNKLQKMNLNEPIDIKQFVAPYSLDVVTSASFSVETDCINNPNDPVNVQAIKATNFNLWP--MIIRMIFPLGARLLKHF--KFEIIPRSSVDFFCDVIKKIKDQHNAGKLTRPDFLQVMIESEIPESE--VKNKKDEPSKGLTEQEILFQAFSFILGGYETTSTTLSHIFYNLAINPDAMHTLQEEIDANLQKDVPVSYDKLNGLEYLDQVLCESLRLIPPAPLLDRVCKKTMQI-----NGLTIPEGTVVGIPVHLLHRDPRFWDSPDLFRPDRFSKENEGALNPYAYMPFGLGPRNCVGMRYAILVMKMVIVRLLQNYTLESCKDTLIPIQFNWK--FQPLKPIKLKFVPRKR 498          
BLAST of Cytochrome P450 vs. Planmine SMEST
Match: SMESG000013783.1 (SMESG000013783.1)

HSP 1 Score: 998.808 bits (2581), Expect = 0.000e+0
Identity = 505/512 (98.63%), Postives = 506/512 (98.83%), Query Frame = 2
Query:   65 MIGLLLSYIFDIKFLLAFVVVYLIYKFGKQNQNLHVKXXXXXXXXXXXXXXXXDVQKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            MIGLLLSYIFDIKFLLAFVVVYLIYKFGKQNQNLHVKLGHNGPPPLPFLGNLLDVQKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKE FGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFS FNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALM KAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTK+CFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPD KKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLE LTFKISGLL PISPILLKIVKR
Sbjct:    1 MIGLLLSYIFDIKFLLAFVVVYLIYKFGKQNQNLHVKLGHNGPPPLPFLGNLLDVQKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKEFFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSLFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALM-KAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKVCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDRKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLEKLTFKISGLLSPISPILLKIVKR 511          
BLAST of Cytochrome P450 vs. Planmine SMEST
Match: SMESG000013786.1 (SMESG000013786.1)

HSP 1 Score: 988.023 bits (2553), Expect = 0.000e+0
Identity = 498/512 (97.27%), Postives = 504/512 (98.44%), Query Frame = 2
Query:   65 MIGLLLSYIFDIKFLLAFVVVYLIYKFGKQNQNLHVKXXXXXXXXXXXXXXXXDVQKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            MIGLLLSYIFDIKFLLAFVVVYLIYKFGKQNQNLHVKLGHNGPPPLPFLGNLLDVQKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKR HKMLT L GKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPP+TPIDIKE FGALTMDVIARTMFG+QIDSQTNP +QFVINAK+LFTFSFFNSFVIIFL+FPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREI NDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTK+CFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLE LTFKIS LLGPISPILLKIVKR
Sbjct:    1 MIGLLLSYIFDIKFLLAFVVVYLIYKFGKQNQNLHVKLGHNGPPPLPFLGNLLDVQKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRDHKMLTDLNGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPNTPIDIKEFFGALTMDVIARTMFGLQIDSQTNPKSQFVINAKKLFTFSFFNSFVIIFLLFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIPNDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKVCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLEKLTFKISVLLGPISPILLKIVKR 512          
BLAST of Cytochrome P450 vs. Planmine SMEST
Match: SMESG000013783.1 (SMESG000013783.1)

HSP 1 Score: 984.941 bits (2545), Expect = 0.000e+0
Identity = 505/533 (94.75%), Postives = 506/533 (94.93%), Query Frame = 2
Query:   65 MIGLLLSYIFDIKFLLAFVVVYLIYKFGKQNQNLHVKXXXXXXXXXXXXXXXXDVQKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYH---------------------RFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            MIGLLLSYIFDIKFLLAFVVVYLIYKFGKQNQNLHVKLGHNGPPPLPFLGNLLDVQKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKE FGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFS FNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLAL MKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTK+CFKKGDIIAIPIYAVHSDPSIWPDPEKFDYH                     RFDPD KKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLE LTFKISGLL PISPILLKIVKR
Sbjct:    1 MIGLLLSYIFDIKFLLAFVVVYLIYKFGKQNQNLHVKLGHNGPPPLPFLGNLLDVQKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKEFFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSLFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLAL-MKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKVCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRLSDHLFIGPPISILEFDYILRFDPDRKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLEKLTFKISGLLSPISPILLKIVKR 532          
BLAST of Cytochrome P450 vs. Planmine SMEST
Match: SMESG000013786.1 (SMESG000013786.1)

HSP 1 Score: 916.761 bits (2368), Expect = 0.000e+0
Identity = 441/455 (96.92%), Postives = 447/455 (98.24%), Query Frame = 2
Query:  236 MGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            MGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKR HKMLT L GKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPP+TPIDIKE FGALTMDVIARTMFG+QIDSQTNP +QFVINAK+LFTFSFFNSFVIIFL+FPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREI NDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTK+CFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLE LTFKIS LLGPISPILLKIVKR
Sbjct:    1 MGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRDHKMLTDLNGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPNTPIDIKEFFGALTMDVIARTMFGLQIDSQTNPKSQFVINAKKLFTFSFFNSFVIIFLLFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIPNDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKVCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLEKLTFKISVLLGPISPILLKIVKR 455          
BLAST of Cytochrome P450 vs. Planmine SMEST
Match: SMESG000013783.1 (SMESG000013783.1)

HSP 1 Score: 895.19 bits (2312), Expect = 0.000e+0
Identity = 440/468 (94.02%), Postives = 441/468 (94.23%), Query Frame = 2
Query:  260 MCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYH---------------------RFDPDHKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLGPISPILLKIVKR 1600
            MCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKE FGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFS FNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLAL MKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTK+CFKKGDIIAIPIYAVHSDPSIWPDPEKFDYH                     RFDPD KKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLE LTFKISGLL PISPILLKIVKR
Sbjct:    1 MCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKEFKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSPLISDGIELLKKRISNNPPDTPIDIKEFFGALTMDVIARTMFGMQIDSQTNPNNQFVINAKRLFTFSLFNSFVIIFLMFPKLGILFRKILPKWEFFGKESFQFFIDNMQMAIDERAKSTDKYNDFLAL-MKAHKKETENDSESSKLMDSKTLSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECLGSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKTKVCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRLSDHLFIGPPISILEFDYILRFDPDRKKTNGQYSFMPFGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLEKLTFKISGLLSPISPILLKIVKR 467          
The following BLAST results are available for this feature:
BLAST of Cytochrome P450 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYP3A46.984e-10138.43cytochrome P450 family 3 subfamily A member 4 [Sou... [more]
CYP3A71.024e-9937.25cytochrome P450 family 3 subfamily A member 7 [Sou... [more]
CYP3A74.163e-9737.04cytochrome P450 family 3 subfamily A member 7 [Sou... [more]
CYP3A51.128e-9636.74cytochrome P450 family 3 subfamily A member 5 [Sou... [more]
CYP3A7-CYP3A51P1.553e-9637.04CYP3A7-CYP3A51P readthrough [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp-25A24.456e-5630.59CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-25A12.367e-5529.45CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-25A33.829e-5530.39CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-25A43.916e-4927.33CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-13A75.811e-4729.62Putative cytochrome P450 CYP13A7 [Source:UniProtK... [more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp9c17.598e-7533.26gene:FBgn0015040 transcript:FBtr0072321[more]
Cyp6a143.351e-6832.27gene:FBgn0033302 transcript:FBtr0345575[more]
Cyp6a143.351e-6832.27gene:FBgn0033302 transcript:FBtr0302331[more]
Cyp6w14.415e-6731.44gene:FBgn0033065 transcript:FBtr0085987[more]
Cyp6w14.415e-6731.44gene:FBgn0033065 transcript:FBtr0345485[more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp3a657.335e-9636.58cytochrome P450, family 3, subfamily A, polypeptid... [more]
cyp3c31.116e-9335.25cytochrome P450, family 3, subfamily c, polypeptid... [more]
cyp3c31.803e-8634.72cytochrome P450, family 3, subfamily c, polypeptid... [more]
cyp3c32.733e-8634.72cytochrome P450, family 3, subfamily c, polypeptid... [more]
cyp3c46.265e-8635.21cytochrome P450, family 3, subfamily C, polypeptid... [more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp3a53.359e-11040.26cytochrome P450 3A29-like [Source:NCBI gene;Acc:10... [more]
cyp3a51.614e-10739.78cytochrome P450 3A29-like [Source:NCBI gene;Acc:10... [more]
ENSXETT00000012846.12.715e-10739.91cytochrome P450 3A8-like [Source:NCBI gene;Acc:100... [more]
cyp3a53.269e-10640.96cytochrome P450 3A29-like [Source:NCBI gene;Acc:10... [more]
cyp3a59.765e-10339.56cytochrome P450 3A29-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp3a41a2.255e-10539.82cytochrome P450, family 3, subfamily a, polypeptid... [more]
Cyp3a41b2.255e-10539.82cytochrome P450, family 3, subfamily a, polypeptid... [more]
Cyp3a441.621e-10438.70cytochrome P450, family 3, subfamily a, polypeptid... [more]
Cyp3a116.960e-10439.92cytochrome P450, family 3, subfamily a, polypeptid... [more]
Cyp3a167.187e-10438.73cytochrome P450, family 3, subfamily a, polypeptid... [more]
back to top
BLAST of Cytochrome P450 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51538|CP3A9_RAT2.695e-10538.91Cytochrome P450 3A9 OS=Rattus norvegicus OX=10116 ... [more]
sp|P11707|CP3A6_RABIT2.890e-10539.78Cytochrome P450 3A6 OS=Oryctolagus cuniculus OX=99... [more]
sp|Q9JMA7|CP341_MOUSE1.577e-10439.82Cytochrome P450 3A41 OS=Mus musculus OX=10090 GN=C... [more]
sp|P04800|CP3A1_RAT3.066e-10438.65Cytochrome P450 3A1 OS=Rattus norvegicus OX=10116 ... [more]
sp|P79401|CP3AT_PIG6.795e-10438.91Cytochrome P450 3A29 OS=Sus scrofa OX=9823 GN=CYP3... [more]
back to top
BLAST of Cytochrome P450 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
L7N3815.274e-10740.26Uncharacterized protein OS=Xenopus tropicalis OX=8... [more]
F6VTP98.462e-10639.35Uncharacterized protein OS=Monodelphis domestica O... [more]
A0A091TGZ21.322e-10541.43Cytochrome P450 3A29 (Fragment) OS=Phaethon leptur... [more]
A0A1U7T7705.620e-10539.18cytochrome P450 3A5 isoform X1 OS=Tarsius syrichta... [more]
A0A0H4IV248.182e-10538.48Cytochrome P450 3A22 OS=Sus scrofa OX=9823 GN=CYP3... [more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp3a651.739e-10036.52cytochrome P450 3A30-like [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000012911.21.198e-9536.09cytochrome P450 3A56-like [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000056570.12.527e-9135.79cytochrome P450 3A56-like [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000037313.11.819e-8236.80cytochrome P450 3A30-like [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000038927.11.819e-8236.80cytochrome P450 3A30-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010493.18.655e-7532.76pep scaffold:Pmarinus_7.0:GL494623:34025:53335:-1 ... [more]
ENSPMAT00000004192.12.491e-7332.55pep scaffold:Pmarinus_7.0:GL501190:14217:30704:1 g... [more]
ENSPMAT00000010515.16.372e-7030.95pep scaffold:Pmarinus_7.0:GL494623:61763:74387:-1 ... [more]
ENSPMAT00000000063.11.935e-5841.18pep scaffold:Pmarinus_7.0:GL478178:2662:7225:1 gen... [more]
cyp4t85.315e-3326.40cytochrome P450, family 4, subfamily T, polypeptid... [more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ERG111.325e-1723.21Lanosterol 14-alpha-demethylase; catalyzes C-14 de... [more]
DIT21.317e-1221.24N-formyltyrosine oxidase; sporulation-specific mic... [more]
ERG55.347e-1121.79C-22 sterol desaturase; a cytochrome P450 enzyme t... [more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO360234.474e-9238.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360049.684e-8735.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302631.702e-8335.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335591.114e-8135.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302643.903e-8134.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytochrome P450 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp3a2.086e-9534.77cytochrome P450, family 3, subfamily A [Source:NCB... [more]
tbxas13.388e-9435.15thromboxane A synthase 1 [Source:NCBI gene;Acc:101... [more]
cyp3a403.853e-9435.41cytochrome P450 3A40 [Source:NCBI gene;Acc:1001258... [more]
cyp3a409.889e-9335.62cytochrome P450 3A40 [Source:NCBI gene;Acc:1001258... [more]
ENSORLT00000004968.24.850e-8633.04cytochrome P450 3A30 [Source:NCBI gene;Acc:1011555... [more]
back to top
BLAST of Cytochrome P450 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013783.10.000e+098.63SMESG000013783.1[more]
SMESG000013786.10.000e+097.27SMESG000013786.1[more]
SMESG000013783.10.000e+094.75SMESG000013783.1[more]
SMESG000013786.10.000e+096.92SMESG000013786.1[more]
SMESG000013783.10.000e+094.02SMESG000013783.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004747 ID=SMED30004747|Name=Cytochrome P450|organism=Schmidtea mediterranea sexual|type=transcript|length=1738bp
CATATTGATACATTCTTGTTTTAATTTCCGAATACAATCATAATTGTTTG
ATTATAACTTTCAAATGATCGGTCTCCTGTTGAGTTACATTTTTGACATT
AAATTTCTTCTTGCTTTCGTTGTTGTATATTTGATATACAAATTTGGAAA
ACAAAATCAAAATCTTCATGTAAAACTCGGTCATAATGGGCCCCCTCCAT
TGCCATTTCTTGGTAATTTATTAGACGTTCAAAAAATGGGATTTCACACA
TTTGATAAAATGTGTCGTCAGAAATATGGAAAGCTTTATCCAATGTATTT
CGGTGGTAGTCCAATGACAGTCGTTGGTGACGAGGAACTGTTGAAACAAA
TAATGATTAAGGAGTTCAAATGTTTTACTGACCGGATGGAATTAGCCTTT
CGCAGTAAGAGAGCTCATAAAATGCTCACAGTTTTGAAAGGAAAAGATTG
GGAACGAGTTAGAAATCTAATTACGCCAACATTTACATCTGGAAAACTTC
GCAAGATGTCGCCATTAATTTCTGACGGAATTGAATTGCTAAAGAAACGT
ATTTCGAACAATCCTCCAGACACTCCAATCGACATTAAAGAAATTTTTGG
TGCCCTTACGATGGATGTGATTGCTCGCACAATGTTTGGAATGCAAATAG
ACTCTCAAACGAATCCTAACAACCAATTTGTCATTAATGCAAAAAGATTA
TTCACATTTTCATTTTTCAATTCATTTGTCATTATATTTTTGATGTTTCC
GAAATTGGGAATTCTTTTTCGTAAAATTCTTCCGAAATGGGAGTTCTTTG
GTAAAGAATCATTCCAATTTTTCATTGACAATATGCAAATGGCCATTGAT
GAAAGAGCGAAATCGACAGATAAATATAATGATTTCTTGGCCTTGATGAT
GAAGGCCCATAAAAAGGAAACTGAAAATGATTCAGAAAGCTCAAAGCTAA
TGGATTCAAAAACTCTATCGAATGATGAAATAATGGCTCAGTCTTTGGTA
TTTCTACTGGCTGGCTATGAGACTACTGCCACAACTCTTGCGTTTGTTTC
ATACTTTTTAGCAAAGAATCCGGACGCCCAACAAGATCTGTATAATGAAA
TTATGGAATGCTTGGGTAGTGAGAGAGAAATTGCTAACGATACTTTAATG
ACCATGCCGATCCTGGATGCTATTGTATGTGAAAGTCTGAGAATCTGTCC
TCCTGCTGTAAGAGTGGATCGAGTATGCACTCAAGATGTTACGCTTGAGA
CATCAGATAAAACTAAACTCTGCTTTAAAAAAGGAGATATAATTGCAATT
CCAATTTATGCCGTTCATTCCGATCCATCAATTTGGCCAGATCCAGAAAA
GTTTGATTATCACCGGTTTGATCCTGACCACAAGAAGACGAATGGACAGT
ATTCCTTCATGCCGTTCGGAATGGGGCCTCGAAATTGTGTCGGAATGAGA
TTTGCTCTTCTAGAAGTGAAATGGGCTATAGTGAGTATTTTGCAGAATTT
CGAAATAGTTCCTTGCCAAGAAACTTTGGAAAATCTAACGTTCAAAATAT
CTGGACTGTTGGGTCCAATTAGTCCGATTTTATTAAAGATTGTCAAACGA
CAACATGAATAATTGTCCATTGAGAATTTAGAAAATGTACTTTTACTTTT
GATTATTTCTATAGATTTTCCAACTGGATTTTAATTTTGTTTTAATTTTT
TTTTAAATATTAAATCGCAAATATCTATTAAAAAAAAA
back to top

protein sequence of SMED30004747-orf-1

>SMED30004747-orf-1 ID=SMED30004747-orf-1|Name=SMED30004747-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=516bp
MIGLLLSYIFDIKFLLAFVVVYLIYKFGKQNQNLHVKLGHNGPPPLPFLG
NLLDVQKMGFHTFDKMCRQKYGKLYPMYFGGSPMTVVGDEELLKQIMIKE
FKCFTDRMELAFRSKRAHKMLTVLKGKDWERVRNLITPTFTSGKLRKMSP
LISDGIELLKKRISNNPPDTPIDIKEIFGALTMDVIARTMFGMQIDSQTN
PNNQFVINAKRLFTFSFFNSFVIIFLMFPKLGILFRKILPKWEFFGKESF
QFFIDNMQMAIDERAKSTDKYNDFLALMMKAHKKETENDSESSKLMDSKT
LSNDEIMAQSLVFLLAGYETTATTLAFVSYFLAKNPDAQQDLYNEIMECL
GSEREIANDTLMTMPILDAIVCESLRICPPAVRVDRVCTQDVTLETSDKT
KLCFKKGDIIAIPIYAVHSDPSIWPDPEKFDYHRFDPDHKKTNGQYSFMP
FGMGPRNCVGMRFALLEVKWAIVSILQNFEIVPCQETLENLTFKISGLLG
PISPILLKIVKRQHE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000232copulatory apparatus
PLANA:0002089reproductive organ
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036396Cyt_P450_sf
IPR001128Cyt_P450
IPR002401Cyt_P450_E_grp-I
IPR017972Cyt_P450_CS
Vocabulary: molecular function
TermDefinition
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037heme binding
GO:0005506iron ion binding
GO:0004497monooxygenase activity
GO:0016491oxidoreductase activity
GO:0016712oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002401Cytochrome P450, E-class, group IPRINTSPR00463EP450Icoord: 447..457
score: 55.94
coord: 457..480
score: 32.16
coord: 324..350
score: 25.97
coord: 412..436
score: 29.45
coord: 181..199
score: 21.42
coord: 68..87
score: 27.31
coord: 92..113
score: 17.92
coord: 304..321
score: 27.96
IPR001128Cytochrome P450PRINTSPR00385P450coord: 315..332
score: 41.92
coord: 448..457
score: 60.5
coord: 457..468
score: 43.23
coord: 368..379
score: 36.46
IPR001128Cytochrome P450PFAMPF00067p450coord: 42..507
e-value: 7.5E-107
score: 357.9
IPR036396Cytochrome P450 superfamilyGENE3DG3DSA:1.10.630.10coord: 23..514
e-value: 3.6E-140
score: 469.7
IPR036396Cytochrome P450 superfamilySUPERFAMILYSSF48264Cytochrome P450coord: 39..511
NoneNo IPR availablePANTHERPTHR24302FAMILY NOT NAMEDcoord: 17..509
NoneNo IPR availablePANTHERPTHR24302:SF15coord: 17..509
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 213..235
IPR017972Cytochrome P450, conserved sitePROSITEPS00086CYTOCHROME_P450coord: 450..459