SMED30004738

Overview
NameSMED30004738
Smed IDSMED30004738
Length (bp)1941
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004738

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
mechanosensory neuronSMED30004738SMESG000000638.1 AY067542.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
chemosensory neuronSMED30004738SMESG000000638.1 AY067542smed_ncbi_20200123PMID:26525673
Hill et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
head regionSMED30004738SMESG000000638.1 SmedASXL_001128SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004738SMESG000000638.1 SmedASXL_059474SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
mechanoreceptor cellSMED30004738SMESG000000638.1 AY067542.1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
mechanosensory neuronSMED30004738SMESG000000638.1 AY067542.1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
chemosensory neuronSMED30004738SMESG000000638.1 AY067542.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
mechanoreceptor cellSMED30004738SMESG000000638.1 AY067542.1smed_ncbi_20200123PMID:21295481
Molina et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
mechanosensory neuronSMED30004738SMESG000000638.1 AY067542.1smed_ncbi_20200123PMID:21295481
Molina et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30004738SMESG000000638.1 AY067542.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
chemosensory neuronSMED30004738SMESG000000638.1 AY067542.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
chemosensory neuronSMED30004738SMESG000000638.1 AY067542smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
mechanosensory neuronSMED30004738SMESG000000638.1 AY067542.1smed_ncbi_20200123PMID:18287199
Iglesias et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30004738SMESG000000638.1 AY067542smed_ncbi_20200123PMID:30485821
Tewari et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
mechanosensory neuronSMED30004738SMESG000000638.1 AY067542.1smed_ncbi_20200123PMID:23318635
Blassberg et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
chemosensory neuronSMED30004738SMESG000000638.1 AY067542.1smed_ncbi_20200123PMID:20422023
Felix et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
mechanosensory neuronSMED30004738SMESG000000638.1 H.112.3csmed_ncbi_20200123PMID:27074666
Lander et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30004738SMESG000000638.1 H.112.3csmed_ncbi_20200123PMID:27074666
Lander et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
mechanoreceptor cellSMED30004738SMESG000000638.1 AY067542.1smed_ncbi_20200123PMID:17905225
Molina et al., 2007
whole organism asexual adult colorimetric in situ hybridization evidence
mechanosensory neuronSMED30004738SMESG000000638.1 AY067542.1smed_ncbi_20200123PMID:17905225
Molina et al., 2007
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Alignments
SMED30004738 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.006724:16062..19080 -9666
Homology
BLAST of SMED30004738 vs. Ensembl Human
Match: SCNN1B (sodium channel epithelial 1 beta subunit [Source:HGNC Symbol;Acc:HGNC:10600])

HSP 1 Score: 65.4698 bits (158), Expect = 2.388e-10
Identity = 88/408 (21.57%), Postives = 160/408 (39.22%), Query Frame = -1
Query:  238 EAETTFYRFQKMMNVSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYPVTDE--------DEIPDKLILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVV--NVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGT-LNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSL---------------ITIIEIIYLACSLSKHKTERA 1383
            +A   F +  +   V + +   +MI  C    +PC++ +F    +P Y  C+ F++ +T++         E   KLIL +          D +  + ++ G ++ ++E   YP       +  SG +T   +  +   ++ +P SPC VN   V   N ++DY      N T    Y++  C +   Q   ++ C C +     ++  +   E    +C+    N  F    +   C  +L       E  I +C   CN  +Y M      W  +         +E ++ H       S  +D  T +  +R  ++K              +NI F+      I E  A  +  LLS+ GG  G W+G S+               ITII+++ LA SL + + + +
Sbjct:  267 QATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDI-------GQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDY------NTT----YSIQACLRSCFQDHMIRNCNCGH-----YLYPLPRGEK---YCN----NRDFP---DWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSE--------ASEDWIFHV-----LSQERDQSTNITLSRKGIVK--------------LNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQAS 615          
BLAST of SMED30004738 vs. Ensembl Human
Match: SCNN1B (sodium channel epithelial 1 beta subunit [Source:HGNC Symbol;Acc:HGNC:10600])

HSP 1 Score: 65.0846 bits (157), Expect = 2.790e-10
Identity = 88/408 (21.57%), Postives = 160/408 (39.22%), Query Frame = -1
Query:  238 EAETTFYRFQKMMNVSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYPVTDE--------DEIPDKLILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVV--NVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGT-LNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSL---------------ITIIEIIYLACSLSKHKTERA 1383
            +A   F +  +   V + +   +MI  C    +PC++ +F    +P Y  C+ F++ +T++         E   KLIL +          D +  + ++ G ++ ++E   YP       +  SG +T   +  +   ++ +P SPC VN   V   N ++DY      N T    Y++  C +   Q   ++ C C +     ++  +   E    +C+    N  F    +   C  +L       E  I +C   CN  +Y M      W  +         +E ++ H       S  +D  T +  +R  ++K              +NI F+      I E  A  +  LLS+ GG  G W+G S+               ITII+++ LA SL + + + +
Sbjct:  222 QATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDI-------GQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDY------NTT----YSIQACLRSCFQDHMIRNCNCGH-----YLYPLPRGEK---YCN----NRDFP---DWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSE--------ASEDWIFHV-----LSQERDQSTNITLSRKGIVK--------------LNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQAS 570          
BLAST of SMED30004738 vs. Ensembl Human
Match: SCNN1B (sodium channel epithelial 1 beta subunit [Source:HGNC Symbol;Acc:HGNC:10600])

HSP 1 Score: 64.3142 bits (155), Expect = 4.396e-10
Identity = 88/407 (21.62%), Postives = 159/407 (39.07%), Query Frame = -1
Query:  238 AETTFYRFQKMMNVSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYPVTDE--------DEIPDKLILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVV--NVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGT-LNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSL---------------ITIIEIIYLACSLSKHKTERA 1380
            A   F +  +   V + +   +MI  C    +PC++ +F    +P Y  C+ F++ +T++         E   KLIL +          D +  + ++ G ++ ++E   YP       +  SG +T   +  +   ++ +P SPC VN   V   N ++DY      N T    Y++  C +   Q   ++ C C +     ++  +   E    +C+    N  F    +   C  +L       E  I +C   CN  +Y M      W  +         +E ++ H       S  +D  T +  +R  ++K              +NI F+      I E  A  +  LLS+ GG  G W+G S+               ITII+++ LA SL + + + +
Sbjct:  196 ATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDI-------GQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDY------NTT----YSIQACLRSCFQDHMIRNCNCGH-----YLYPLPRGEK---YCN----NRDFP---DWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSE--------ASEDWIFHV-----LSQERDQSTNITLSRKGIVK--------------LNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQAS 543          
BLAST of SMED30004738 vs. Ensembl Human
Match: SCNN1G (sodium channel epithelial 1 gamma subunit [Source:HGNC Symbol;Acc:HGNC:10602])

HSP 1 Score: 53.9138 bits (128), Expect = 9.148e-7
Identity = 76/367 (20.71%), Postives = 146/367 (39.78%), Query Frame = -1
Query:  280 VSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYPVTDEDEIPDKLILG---------LYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVV--NVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENV--ISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEII 1341
            +++ +   E++  C  +   C   +F  F HP++  C+ F+     E+E      +G         LY++++          +++S G KV I+    YP  E       +   T   +    S ++++P S C  +   V   N++N               Y++ +C     Q + V++C C   + P+   A         +C+       +    N + C Y L +  +  E +   S+C   C+  E+++ +                     +A + S+++   +    T ++ R  V K +   D A L      I ++   +  I E  A  +  LLS+FGG LGLW+  S++ +IEII
Sbjct:  247 INMSYSAEELLVTCFFDGVSCDARNFTLFHHPMHGNCYTFN---NRENETILSTSMGGSEYGLQVILYINEEEYNPF-----LVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQCTEDGSDVPIRNIYNA-------------AYSLQICLHSCFQTKMVEKCGCAQYSQPLPPAAN--------YCN-------YQQHPNWMYCYYQL-HRAFVQEELGCQSVCKEACSFKEWTLTTS--------------------LAQWPSVVSEKWLLPVLTWDQGRQ-VNKKLNKTDLAKLL-----IFYKDLNQRSIMESPANSIEMLLSNFGGQLGLWMSCSVVCVIEII 550          
BLAST of SMED30004738 vs. Ensembl Human
Match: ASIC1 (acid sensing ion channel subunit 1 [Source:HGNC Symbol;Acc:HGNC:100])

HSP 1 Score: 48.521 bits (114), Expect = 3.071e-6
Identity = 30/82 (36.59%), Postives = 48/82 (58.54%), Query Frame = -1
Query:  178 MINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTERAASVFKKSIHKRSLKRNSDKN 423
            +++I FE    E I + +AY +  LL D GG +GL+IG S++T++E+   A  + KHK  R     K++  KRS   ++DK 
Sbjct:    6 VLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEA--KRS---SADKG 82          
BLAST of SMED30004738 vs. Ensembl Celegans
Match: asic-2 (Degenerin-like protein asic-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22851])

HSP 1 Score: 75.0998 bits (183), Expect = 6.031e-14
Identity = 102/518 (19.69%), Postives = 195/518 (37.64%), Query Frame = -1
Query:  274 FMGTSSFHGVIQAYHKRNKIDKGSWFISLVICMFGLIGH-LYLIISRYISLPTTIDMVSSVNFDPFPAVAICPV-----TFISRDKFTKYYNTTQVSLNKKLVGDIFYVDALNFWRSLSKQQGKDINSSSVLGKYWDEAETTFYRFQKMMNVSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKF------SYPVTDEDEIPDKLILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISL-----CSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYL 1776
            F   S+   V    +  NKI +  W I++ + + G+  + LY++I+++ S P T++         FP V +C +     + +  +      NT   + +   VG  F  D    +      +  D++S +      D              V   +   ++I  C     PCS   F +F  P+Y  C+ F      +Y V+ E  I   L L L V         D        G ++ +N     PG +S+      G+++   +    + +  KP   C        + + D+ Y   T            C    +Q + + +C+C NP +     A+ +++     C  I+ +         LDCL  L  +Q  +   I L     C+  C++  Y+             +   +F +  +    +S           +   +++   K   +N        +I +  E+   E+  E   Y + N+++D GG  GLW+G+S+I+++E+  L
Sbjct:   13 FSNWSTVAVVPHVANANNKISRIFW-IAIFLFVLGMFAYELYILIAKFFSYPATVNTEILFEKQIFPVVTVCNMNPYKYSVVKSNSAFSSVNTLMTTYSDATVG-TFSTDKWGLYA--DNDETYDLDSRAA-----DALVLEANLISDTAKVPALYTYADLIQDCSFAGIPCSESDFTKFIDPVYGACYSFNEDASLNYSVSREG-IQFGLKLMLTVTQTKTNGNTDSLPTTKLAGARIGVNSRGSSPGLDSNGIDAGVGYESAVSVSLTQNVRAKKPYGTCVDREPDSSDYYKDFIYTLET------------CFNGCKQRDTIAKCQCANPRL-----ALGSTDTA---CQPIKAD---------LDCLQTLKGNQTSSTPNIDLLVECNCNPPCDESTYT-----------PTVSLAQFPSTSYYVATSSTAGVGSCSSTNSKFSSKSDCQKWYNNNGM------IIQVFLETLSYELYTETAGYTVSNVINDLGGQAGLWLGLSVISVVEMTGL 474          
BLAST of SMED30004738 vs. Ensembl Celegans
Match: deg-1 (Degenerin deg-1 [Source:UniProtKB/Swiss-Prot;Acc:P24585])

HSP 1 Score: 66.6254 bits (161), Expect = 3.749e-11
Identity = 36/86 (41.86%), Postives = 52/86 (60.47%), Query Frame = -1
Query:  169 AMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTERAASVFKKSIHKRSLKRNSDKNKII 426
            AMI + +E    E+++E EAY L NL++DFGG LGLW+G S+IT++E+  L   +         S+F KS H+  L R S K K +
Sbjct:  680 AMIEVFYEQLNYELLQESEAYGLVNLIADFGGHLGLWLGFSVITVMEVCVLLVDM--------ISLFFKSRHEEKLLRQSTKRKDV 757          
BLAST of SMED30004738 vs. Ensembl Celegans
Match: deg-1 (Degenerin deg-1 [Source:UniProtKB/Swiss-Prot;Acc:P24585])

HSP 1 Score: 66.6254 bits (161), Expect = 3.749e-11
Identity = 36/86 (41.86%), Postives = 52/86 (60.47%), Query Frame = -1
Query:  169 AMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTERAASVFKKSIHKRSLKRNSDKNKII 426
            AMI + +E    E+++E EAY L NL++DFGG LGLW+G S+IT++E+  L   +         S+F KS H+  L R S K K +
Sbjct:  680 AMIEVFYEQLNYELLQESEAYGLVNLIADFGGHLGLWLGFSVITVMEVCVLLVDM--------ISLFFKSRHEEKLLRQSTKRKDV 757          
BLAST of SMED30004738 vs. Ensembl Celegans
Match: deg-1 (Degenerin deg-1 [Source:UniProtKB/Swiss-Prot;Acc:P24585])

HSP 1 Score: 66.6254 bits (161), Expect = 3.749e-11
Identity = 36/86 (41.86%), Postives = 52/86 (60.47%), Query Frame = -1
Query:  169 AMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTERAASVFKKSIHKRSLKRNSDKNKII 426
            AMI + +E    E+++E EAY L NL++DFGG LGLW+G S+IT++E+  L   +         S+F KS H+  L R S K K +
Sbjct:  680 AMIEVFYEQLNYELLQESEAYGLVNLIADFGGHLGLWLGFSVITVMEVCVLLVDM--------ISLFFKSRHEEKLLRQSTKRKDV 757          
BLAST of SMED30004738 vs. Ensembl Celegans
Match: asic-1 (Degenerin-like protein asic-1 [Source:UniProtKB/Swiss-Prot;Acc:O01635])

HSP 1 Score: 56.9954 bits (136), Expect = 3.909e-8
Identity = 27/48 (56.25%), Postives = 34/48 (70.83%), Query Frame = -1
Query:  283 AMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEI 426
            +MI + FE    E + E EAY   NLLSDFGG LGLW+G+S+ITI E+
Sbjct:  729 SMIEVYFEQLNYESLLESEAYGWSNLLSDFGGQLGLWMGVSVITIGEV 776          
BLAST of SMED30004738 vs. Ensembl Zebrafish
Match: asic4a (acid-sensing (proton-gated) ion channel family member 4a [Source:NCBI gene;Acc:407668])

HSP 1 Score: 53.9138 bits (128), Expect = 3.309e-7
Identity = 26/63 (41.27%), Postives = 41/63 (65.08%), Query Frame = -1
Query:  241 FAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTER 429
            F +++I FE+   E I + +AY +  LL D GG +GL+IG S++TI+EI+     + KH+ ER
Sbjct:  215 FLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASVLTILEILDYVYEVIKHRLER 277          
BLAST of SMED30004738 vs. Ensembl Zebrafish
Match: asic4a (acid-sensing (proton-gated) ion channel family member 4a [Source:NCBI gene;Acc:407668])

HSP 1 Score: 53.9138 bits (128), Expect = 4.358e-7
Identity = 26/63 (41.27%), Postives = 41/63 (65.08%), Query Frame = -1
Query:  241 FAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTER 429
            F +++I FE+   E I + +AY +  LL D GG +GL+IG S++TI+EI+     + KH+ ER
Sbjct:  407 FLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASVLTILEILDYVYEVIKHRLER 469          
BLAST of SMED30004738 vs. Ensembl Zebrafish
Match: asic4b (acid-sensing (proton-gated) ion channel family member 4b [Source:NCBI gene;Acc:407667])

HSP 1 Score: 50.447 bits (119), Expect = 6.298e-6
Identity = 30/88 (34.09%), Postives = 54/88 (61.36%), Query Frame = -1
Query:  166 FAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTERAASVFKKSIHKRSLKRNSDKNKIIR 429
            F +++I FE+   E I + +AY +  LL D GG +GL+IG S++TI+EI+     ++K+K ++   +  K   K++ +RN  + +I R
Sbjct:  411 FLILDIFFEALNYETIEQKKAYDIAGLLGDIGGQMGLFIGASILTILEILDYIYEVAKNKIKQL--LKPKKSQKQTNQRNLIQEQIQR 496          
BLAST of SMED30004738 vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 71.2478 bits (173), Expect = 3.307e-12
Identity = 85/362 (23.48%), Postives = 154/362 (42.54%), Query Frame = -1
Query:  280 VSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYP------VTDEDEIPDKLILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENV--ISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEII 1341
            +++G++  E+I  C  +   C   +F  F HP+Y  C+ F+        V+        L + LY+D+D          + T+ G K+ +++   YP  E       +  +T   ++   S++++ P S C ++  S V+V N Y            KY + +C     Q E V+ C C + + P+         N + +C+       +    + + C + L Y Q+  E +   S C   C+  E+++         +++ K     +E++M    S            L    N   K++T ND A+L     NI ++      I E   Y +  LLS+FGG LGLW+  S+I ++EI+
Sbjct:  258 IAMGYKADELIVTCFFDGLSCDARNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPY-----LSTAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMD-GSDVSVENLYSK----------KYTLQICLNSCFQREMVRTCGCAHYDQPL--------PNGAKYCN-------YEEYPSWIYCYFKL-YKQFVQEELGCQSACRESCSFKEWTL--------TRSLAKWPSLNSEQWMLRVLSW----------ELGEKLN---KNLTKNDLANL-----NIFYQDLNSRSISESPTYNIVTLLSNFGGQLGLWMSCSMICVLEIV 561          
BLAST of SMED30004738 vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 65.855 bits (159), Expect = 1.263e-10
Identity = 84/361 (23.27%), Postives = 153/361 (42.38%), Query Frame = -1
Query:  280 VSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYP------VTDEDEIPDKLILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEF-VNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEII 1341
            +++G++  E+I  C  +   C   +F  F HP+Y  C+ F+        V+        L + LY+D+D          + T+ G K+ +++   YP  E       +  +T   ++   S++++ P S C ++  S V+V N Y            KY + +C     Q E V+ C C + + P+         N + +C+       +    + + C + L Y Q+  E +   C   C +   S++ Y +    + M++ + + + EK                   LN       K++T ND A+L     NI ++      I E   Y +  LLS+FGG LGLW+  S+I ++EI+
Sbjct:  248 IAMGYKADELIVTCFFDGLSCDARNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPY-----LSTAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMD-GSDVSVENLYS----------KKYTLQICLNSCFQREMVRTCGCAHYDQPL--------PNGAKYCN-------YEEYPSWIYCYFKL-YKQFVQEELG--CQSACRE---SLHFYFVLLPQQWMLRVLSWELGEK-------------------LN-------KNLTKNDLANL-----NIFYQDLNSRSISESPTYNIVTLLSNFGGQLGLWMSCSMICVLEIV 540          
BLAST of SMED30004738 vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 64.3142 bits (155), Expect = 4.703e-10
Identity = 84/367 (22.89%), Postives = 148/367 (40.33%), Query Frame = -1
Query:  280 VSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYP------VTDEDEIPDKLILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENV--ISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKD-----YGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEII 1341
            +++G++  E+I  C  +   C   +F  F HP+Y  C+ F+        V+        L + LY+D+D          + T+ G K+ +++   YP  E       +  +T   ++   S++++ P S C ++  S V+V N Y            KY + +C     Q E V+ C C + + P+         N + +C+       +    + + C + L Y Q+  E +   S C   C+  E+++      W                    NS + S+ V       +G  N            ND A+L     NI ++      I E   Y +  LLS+FGG LGLW+  S+I ++EI+
Sbjct:  250 IAMGYKADELIVTCFFDGLSCDARNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPY-----LSTAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMD-GSDVSVENLYS----------KKYTLQICLNSCFQREMVRTCGCAHYDQPL--------PNGAKYCN-------YEEYPSWIYCYFKL-YKQFVQEELGCQSACRESCSFKEWTLTRSLAKW-----------------PSLNSEVRSAWVLQLFYVGHGFFNL-----------NDLANL-----NIFYQDLNSRSISESPTYNIVTLLSNFGGQLGLWMSCSMICVLEIV 551          
BLAST of SMED30004738 vs. Ensembl Xenopus
Match: scnn1b (sodium channel, non voltage gated 1 beta subunit [Source:NCBI gene;Acc:779891])

HSP 1 Score: 62.7734 bits (151), Expect = 1.184e-9
Identity = 82/364 (22.53%), Postives = 140/364 (38.46%), Query Frame = -1
Query:  286 VSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYPVTDEDEIPD---------KLILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVVNVFNDY-EYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFV--NEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIE 1341
            +++G +  ++I  C    +PCS+ +F       Y  C+ F++    ED +           KL+L +          + +  + T+   ++ +++   +P  +    +   G +T   +  +    +  P S C VN  S + V N Y E+N S        Y++  C +   Q + V+ C C +   P+         N S +C       S     + + C Y L       E+ ISLC   CN  +Y M      W        +  V   EK  +H N  +N             RN +++              +NI F+      I E EA  +  LLS+ GG  G W+G S++ IIE
Sbjct:  254 IAMGFKAEDLILTCLFGGQPCSYRNFTRIYDADYGNCYIFNWGQEGEDPMASANPGADFGLKLVLDI-------EQGEYLPYVQTTAAARLILHQQRSFPFVKDLGIYAMPGTETSIAVLVDQLEHMEAPYSSCTVN-GSDIPVQNLYAEFNSS--------YSIQSCLRSCYQEQMVQTCGCADYQYPL--------PNGSEYC-------SNDKYPDWVPCYYGLRDSVADRESCISLCQQPCNDTQYKMVISMADWPSAGAQDWIFHVLSYEKDSSH-NITVN-------------RNGIVR--------------LNIYFQEFNYRSITESEATNVVWLLSNLGGQFGFWMGGSVLCIIE 558          
BLAST of SMED30004738 vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 54.299 bits (129), Expect = 6.087e-7
Identity = 75/363 (20.66%), Postives = 146/363 (40.22%), Query Frame = -1
Query:  280 VSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYP------VTDEDEIPDKLILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENV--ISLCSGLCNQVEYSMYSYTMPWFG-KTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEII 1341
            +++G++  E+I  C  +   C   +F  F HP+Y  C+ F+        V+        L + LY+D+D          + T+ G K+ +++   YP  E       +  +T   ++   S++++ P S C ++  S V+V N Y            KY + +C     Q E V+ C C + + P+         N + +C+       +    + + C + L Y Q+  E +   S C   C+  E+++      W    + ++    +   ++ H NS                 + +   M     A     M+ +       +    + +  +  LLS+FGG LGLW+  S+I ++EI+
Sbjct:  248 IAMGYKADELIVTCFFDGLSCDARNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPY-----LSTAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMD-GSDVSVENLYS----------KKYTLQICLNSCFQREMVRTCGCAHYDQPL--------PNGAKYCN-------YEEYPSWIYCYFKL-YKQFVQEELGCQSACRESCSFKEWTLTRSLAKWPSLNSEVRSAWVLQLFYVGHGNS-----------------HNLFSEMFFWASALAASFMLYVFMMCIYWQCSTSHLSLQIVTLLSNFGGQLGLWMSCSMICVLEIV 561          
BLAST of SMED30004738 vs. Ensembl Mouse
Match: Scnn1b (sodium channel, nonvoltage-gated 1 beta [Source:MGI Symbol;Acc:MGI:104696])

HSP 1 Score: 62.3882 bits (150), Expect = 1.289e-9
Identity = 78/360 (21.67%), Postives = 139/360 (38.61%), Query Frame = -1
Query:  286 VSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYPVTDE--------DEIPDKLILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIE 1341
            V +G+    +I  C    +PCS  +F    +P Y  C+ F++ +T+E         E   KLIL +          D +  + ++ G ++ ++E   YP       +  +G +T   +  +   +  +P SPC +N  S V + N Y    +T       Y++  C     Q   ++ C C +     ++  +   E    +C+    N  F    +   C  NL       E  +S+C   CN  +Y M      W  +         +E ++ H    + S        +  +R  ++K              +NI F+      I E  A  +  LLS+ GG  G W+G S++ +IE
Sbjct:  234 VGMGYAPDRIILACLFGTEPCSHRNFTPIFYPDYGNCYIFNWGMTEETLPSANPGTEFGLKLILDI-------GQEDYVPFLASTAGARLMLHEQRTYPFIREEGIYAMAGTETSIGVLVDKLQRKGEPYSPCTMN-GSDVAIKNLYSVYNTT-------YSIQACLHSCFQDHMIRNCSCGH-----YLYPLPEGEK---YCN----NRDFP---DWAYCYLNLQMSVTQRETCLSMCKESCNDTQYKMTISMADWPSE--------ASEDWILH----VLSQERDQSSNITLSRKGIVK--------------LNIYFQEFNYRTIEESPANNIVWLLSNLGGQFGFWMGGSVLCLIE 537          
BLAST of SMED30004738 vs. Ensembl Mouse
Match: Scnn1g (sodium channel, nonvoltage-gated 1 gamma [Source:MGI Symbol;Acc:MGI:104695])

HSP 1 Score: 52.7582 bits (125), Expect = 1.310e-6
Identity = 76/367 (20.71%), Postives = 145/367 (39.51%), Query Frame = -1
Query:  280 VSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYPVTDEDEIPDKLILG---------LYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTD--SVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENV--ISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEII 1341
            +++ +   E++  C  +   C   +F  F HP+Y  C+ F+     E+       +G         LY+++D          +++S G KV +++ + YP  E       +   T   +    S ++++P S C  +     V N++N               Y++ +C     Q + V++C C   + P+   A         +C+       +    N + C Y L Y  +  E +   S+C   C+  E+++ +    W  +         +EK++ +  +   S  +              K +   D A L      I ++   +  I E  A  +  LLS+FGG LGLW+  S++ +IEII
Sbjct:  253 INMSYSAEELLVTCFFDGMSCDARNFTLFHHPMYGNCYTFN---NRENATILSTSMGGSEYGLQVILYINEDEYNPF-----LVSSTGAKVLVHQQNEYPFIEDVGTEIETAMSTSIGMHLTESFKLSEPYSQCTEDGSDVPVTNIYNA-------------AYSLQICLYSCFQTKMVEKCGCAQYSQPLPPAAN--------YCN-------YQQHPNWMYCYYQL-YQAFVREELGCQSVCKQSCSFKEWTLTTSLAQWPSE--------ASEKWLLNVLTWDQSQQIN-------------KKLNKTDLAKLL-----IFYKDLNQRSIMESPANSIEMLLSNFGGQLGLWMSCSVVCVIEII 556          
BLAST of SMED30004738 vs. UniProt/SwissProt
Match: sp|Q22851|ASIC2_CAEEL (Degenerin-like protein asic-2 OS=Caenorhabditis elegans OX=6239 GN=asic-2 PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 7.672e-13
Identity = 102/518 (19.69%), Postives = 195/518 (37.64%), Query Frame = -1
Query:  274 FMGTSSFHGVIQAYHKRNKIDKGSWFISLVICMFGLIGH-LYLIISRYISLPTTIDMVSSVNFDPFPAVAICPV-----TFISRDKFTKYYNTTQVSLNKKLVGDIFYVDALNFWRSLSKQQGKDINSSSVLGKYWDEAETTFYRFQKMMNVSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKF------SYPVTDEDEIPDKLILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISL-----CSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYL 1776
            F   S+   V    +  NKI +  W I++ + + G+  + LY++I+++ S P T++         FP V +C +     + +  +      NT   + +   VG  F  D    +      +  D++S +      D              V   +   ++I  C     PCS   F +F  P+Y  C+ F      +Y V+ E  I   L L L V         D        G ++ +N     PG +S+      G+++   +    + +  KP   C        + + D+ Y   T            C    +Q + + +C+C NP +     A+ +++     C  I+ +         LDCL  L  +Q  +   I L     C+  C++  Y+             +   +F +  +    +S           +   +++   K   +N        +I +  E+   E+  E   Y + N+++D GG  GLW+G+S+I+++E+  L
Sbjct:   13 FSNWSTVAVVPHVANANNKISRIFW-IAIFLFVLGMFAYELYILIAKFFSYPATVNTEILFEKQIFPVVTVCNMNPYKYSVVKSNSAFSSVNTLMTTYSDATVG-TFSTDKWGLYA--DNDETYDLDSRAA-----DALVLEANLISDTAKVPALYTYADLIQDCSFAGIPCSESDFTKFIDPVYGACYSFNEDASLNYSVSREG-IQFGLKLMLTVTQTKTNGNTDSLPTTKLAGARIGVNSRGSSPGLDSNGIDAGVGYESAVSVSLTQNVRAKKPYGTCVDREPDSSDYYKDFIYTLET------------CFNGCKQRDTIAKCQCANPRL-----ALGSTDTA---CQPIKAD---------LDCLQTLKGNQTSSTPNIDLLVECNCNPPCDESTYT-----------PTVSLAQFPSTSYYVATSSTAGVGSCSSTNSKFSSKSDCQKWYNNNGM------IIQVFLETLSYELYTETAGYTVSNVINDLGGQAGLWLGLSVISVVEMTGL 474          
BLAST of SMED30004738 vs. UniProt/SwissProt
Match: sp|O13263|SCNNH_XENLA (Amiloride-sensitive sodium channel subunit gamma-2 OS=Xenopus laevis OX=8355 GN=scnn1g-b PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.381e-11
Identity = 84/364 (23.08%), Postives = 152/364 (41.76%), Query Frame = -1
Query:  280 VSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYP------VTDEDEIPDKLILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTD--SVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENV--ISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEII 1341
            +++G++  E+I  C  +   C   +F  F HP+Y  C+ F+        V+        L + LY+D+D          + T+ G K+ +++   YP  E       +G +T   ++   S++++ P S C ++    SV N++N              KY + +C     Q E V+ C C + + P+         N + +C+       +    N + C   L Y Q+  E +   S C   C+  E+++         +++ K     +E++M    S            L    N   K++T ND  +L     NI ++      I E   Y +  LLS+FGG LGLW+  S++  +EI+
Sbjct:  250 IAMGYKADELIVTCLFDGLSCDARNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPY-----LSTAAGAKILVHDQDEYPFIEDLGTELETGTETSIGMQLTESTKLSDPYSDCTIDGSDISVENLYNK-------------KYTLQICLNSCFQREMVRSCGCAHYDQPL--------PNGAKYCN-------YEEYPNWIYCYVKL-YKQFVQEELGCQSTCRESCSFKEWTL--------TRSLAKWPSLNSEEWMLRVLSW----------ELGEKLN---KNLTKNDLGNL-----NIFYQDLNSRSISESPTYNIVTLLSNFGGQLGLWMSCSMVCGLEIV 553          
BLAST of SMED30004738 vs. UniProt/SwissProt
Match: sp|P51171|SCNNG_XENLA (Amiloride-sensitive sodium channel subunit gamma OS=Xenopus laevis OX=8355 GN=scnn1g-a PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 4.463e-11
Identity = 84/364 (23.08%), Postives = 154/364 (42.31%), Query Frame = -1
Query:  280 VSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYP------VTDEDEIPDKLILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTD--SVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENV--ISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEII 1341
            +++G++  E+I  C  +   C   +F  F HP+Y  C+ F+        V+        L + LY+D+D          + T+ G K+ +++   YP  E       +  +T   ++   S++++ P S C ++    SV N++N              KY + +C     Q E V+ C C + + P+         N + +C+       +    + + C + + Y Q+  E +   S C   C+  E+++         +++ K     +E++M    S            L    N   K++T ND A+L     NI ++      I E   Y +  LLS+FGG LGLW+  S+I ++EII
Sbjct:  250 IAMGYKADELIVTCFFDGLSCDARNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPY-----LSTAAGAKILVHDQDEYPFIEYLGTELETATETSIGMQLTESAKLSDPYSDCTMDGRDVSVENLYNK-------------KYTLQICLNSCFQREMVRSCGCAHYDQPL--------PNGAKYCN-------YEEYPSWIYCYFKV-YKQFVQEELGCQSACRESCSFKEWTL--------TRSLAKWPSLNSEEWMLRVLSW----------ELGEKLN---KNLTKNDLANL-----NIFYQDLNSRSISESPTYNIVTLLSNFGGQLGLWMSCSMICVLEII 553          
BLAST of SMED30004738 vs. UniProt/SwissProt
Match: sp|O13262|SCNNC_XENLA (Amiloride-sensitive sodium channel subunit beta-2 OS=Xenopus laevis OX=8355 GN=scnn1b-b PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 6.772e-11
Identity = 85/362 (23.48%), Postives = 138/362 (38.12%), Query Frame = -1
Query:  286 VSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYPVTDEDEIPD---------KLILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVVNVFNDY-EYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIE 1341
            V +G +  ++I  C    +PCS+ +F       Y  C+ F++    +D +           KL+L +          + +  + T+   ++ +++   +P  +    +   G +T   +  +   Q+  P S C VN  S + V N Y E+N S        Y++  C +   Q E VK CKC +   P+         N S +C         +   + + C Y L       EN ISLC   CN   Y M      W             E ++ H  S    S       +   RN +I+              +NI F+      I E EA  +  LLS+ GG  G W+G S++ IIE
Sbjct:  254 VDMGFKAEDLILTCLFGGQPCSYRNFTHIYDADYGNCYIFNWGQEGDDTMSSANPGADFGLKLVLDI-------EQDEYLPFLQTTAAARLILHQQRSFPFVKDLGIYAKPGTETSIAVLVDQLQQMEAPYSSCTVN-GSDIPVQNLYEEFNSS--------YSIQSCLRSCYQEEMVKTCKCAHYQYPL--------PNGSEYCTN-------NKHPDWVPCYYGLRDSVAIRENCISLCQQPCNDTHYKMVISMADWPSAGA--------EDWIFHVLSYEKDSSYD----ITVNRNGIIR--------------LNIYFQEFNYRSISESEATNVVWLLSNLGGQFGFWMGGSVLCIIE 558          
BLAST of SMED30004738 vs. UniProt/SwissProt
Match: sp|P24585|DEG1_CAEEL (Degenerin deg-1 OS=Caenorhabditis elegans OX=6239 GN=deg-1 PE=1 SV=2)

HSP 1 Score: 66.6254 bits (161), Expect = 4.769e-10
Identity = 36/86 (41.86%), Postives = 52/86 (60.47%), Query Frame = -1
Query:  169 AMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTERAASVFKKSIHKRSLKRNSDKNKII 426
            AMI + +E    E+++E EAY L NL++DFGG LGLW+G S+IT++E+  L   +         S+F KS H+  L R S K K +
Sbjct:  680 AMIEVFYEQLNYELLQESEAYGLVNLIADFGGHLGLWLGFSVITVMEVCVLLVDM--------ISLFFKSRHEEKLLRQSTKRKDV 757          
BLAST of SMED30004738 vs. TrEMBL
Match: A0A2A2KG54 (Uncharacterized protein OS=Diploscapter pachys OX=2018661 GN=WR25_19009 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.239e-16
Identity = 113/534 (21.16%), Postives = 209/534 (39.14%), Query Frame = -1
Query:  274 FMGTSSFHGVIQAYHKRNKIDKGSWFISLVICMFGLIGHLYLIISRYISLPTTIDMVSSVNFDPFPAVAIC---PVTFI---SRDKFTKYYNTTQVSLNKKLVGDIFYVDALNFWRSLSKQQGKDINSSSVLGKYWDEAETTFYRFQKMMNVSIGHRNY---EMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYPVTDEDE----------IPDKLILGLYVXXXXXXXXXDIKTIITSH--GGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQY--FNENVISL----CSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKS--MTDNDQASLCFA----MINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYL 1776
            F   S+  GV    +   K+ +  W I  +  +      LY++I+++++ P  ++         FP + +C   P+ +    S  KF+   N    +    + G +   D    +    K   +D  +   L               K+    +    Y   E+I  C  ++ PC+ + F +  +P+Y  C+ F     +ED+          I   L L + V             + T+H  G +V IN     P  E++  +   G+QT   +    +++  +P   C VN +              T+I   Y Y +  C    +Q +  + C C  P  P+         +   +C+  + N         LDCL +L  DQ    N N+ ++    C+  C++  Y+  S ++ WF  T             ++Y        V D G    A +C   +  MTD D     +     +++I FES   ++  E  +Y +G +++D GG  GLW+G+S+I+++E++ L
Sbjct:   12 FANWSTVCGVPHIANSSTKLSRAFWVIVFIAMVSMFSYELYIMIAKFLTYPAMVNTNLPFEEQRFPVITVCNFNPLKYSVVKSDSKFSDI-NDLMETYKSAVAGTLASSDKWGLYDVKDKPFDRDTRAQEAL----------ILETAKLSQADLDAATYSFEELITECSFSSAPCNKDAFTKIFNPVYGACYSF-----NEDKALNYSCNRAGIKFGLKLLITVSQTKAEGGGGWDFLPTTHSAGARVAINAPGTLPSLEATGINAGVGYQTAISVNTAHTNRAKRPYGIC-VNREPT-----------DTDIYANYTYTLETCFNGCRQRKTNEVCSCTTPRFPL--------PSGMSYCEPTKAN---------LDCLASLKGDQTNKANPNMNAMTECDCNPPCSEDSYTTTS-SLAWFPAT-------------SYYVG------VGDTGKEGVAGSCSPDNTKMTDPDACKEWYQGNSLLLSIFFESLIYDLYNEVPSYGIGAVINDLGGQAGLWMGLSVISVVEMVGL 480          
BLAST of SMED30004738 vs. TrEMBL
Match: A0A267H6C0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004814g2 PE=3 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.591e-15
Identity = 86/366 (23.50%), Postives = 153/366 (41.80%), Query Frame = -1
Query:  274 IGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYPVTDEDEIPDK-------LILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSP-CQVNTDSVVNVFNDYEYNGSTNITIP-YKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQA---SLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYL 1335
            IG++  +M+  C +    CS  +F  F HP+Y  C+ F+  VT+   +  K       L L LY+D         + T+  S G  V ++E +  P  E S      G +T   +KQ     +  P S  C ++  +    +N   Y       +P   Y  ++C +   Q +   RC C +P +P        +   +L   +   NS+  S+  + +CL+ +   ++  E   S C   C +++Y        W   +M  E +  ++  M  YN ++              R  +    TD+ +A   S     + + F  P        + Y + +LLSD GG +GLW+G+S++T+ E+I +
Sbjct:  238 IGYQISDMLVDCSMGTSYCSVSNFTRFLHPMYGNCYTFNAAVTNSSRVSVKQQGPLFGLTLTLYIDQSDY-----VSTVAQSAGAVVVLHEPTTQPFPEESGIRVSPGRETYIGMKQTYKKLLGSPYSDNCAIDYKTANKKYN--MYRSLDEWALPNVNYTKMVCLKTCIQRKTESRCNCSSPKLP----PSNITRTPALPICKYSYNSTSKSVSQEAECLHAVQESEF--ETCRSGCQSQCEEMQYDASISMAAW--PSMGYESDAFHQVMM--YNPIV--------------RTQMDGHKTDDSKADFISQNMVKLIVFFADPETRTEISTKGYEITDLLSDMGGQVGLWLGLSVLTLFELIEM 572          
BLAST of SMED30004738 vs. TrEMBL
Match: A0A267GUI2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004814g1 PE=3 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.601e-15
Identity = 86/366 (23.50%), Postives = 153/366 (41.80%), Query Frame = -1
Query:  274 IGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYPVTDEDEIPDK-------LILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSP-CQVNTDSVVNVFNDYEYNGSTNITIP-YKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQA---SLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYL 1335
            IG++  +M+  C +    CS  +F  F HP+Y  C+ F+  VT+   +  K       L L LY+D         + T+  S G  V ++E +  P  E S      G +T   +KQ     +  P S  C ++  +    +N   Y       +P   Y  ++C +   Q +   RC C +P +P        +   +L   +   NS+  S+  + +CL+ +   ++  E   S C   C +++Y        W   +M  E +  ++  M  YN ++              R  +    TD+ +A   S     + + F  P        + Y + +LLSD GG +GLW+G+S++T+ E+I +
Sbjct:  245 IGYQISDMLVDCSMGTSYCSVSNFTRFLHPMYGNCYTFNAAVTNSSRVSVKQQGPLFGLTLTLYIDQSDY-----VSTVAQSAGAVVVLHEPTTQPFPEESGIRVSPGRETYIGMKQTYKKLLGSPYSDNCAIDYKTANKKYN--MYRSLDEWALPKVNYTKMVCLKTCIQRKTESRCNCSSPKLP----PSNITRTPALPICKYSYNSTSKSVSQEAECLHAVQESEF--ETCRSGCQSQCEEMQYDASISMAAW--PSMGYESDAFHQVMM--YNPIV--------------RTQMDGHKTDDSKADFISQNMVKLIVFFADPETRTEISTKGYEITDLLSDMGGQVGLWLGLSVLTLFELIEM 579          
BLAST of SMED30004738 vs. TrEMBL
Match: A0A1I8IQL9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.406e-14
Identity = 116/536 (21.64%), Postives = 203/536 (37.87%), Query Frame = -1
Query:  286 VDGFMGTSSFHGVIQAYHKRNKIDKGSWFISLVICMFGLIGHLYLIISRYISLPTTIDMVSSVNFDPFPAVAICPVTFISRDKFTKYYNTTQVSLNKKLVG--DIFYVDALNFWRSLSKQQGKDINSSSVLGKYWDEAETTFYRFQKMMNVSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFS--YPVTDEDEIPDKLILGLYVXXXXXXX-----XXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVVNVFNDYEY-NGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISLCSGLCNQVEYSMYSYTMPWFGKTMIK---EMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQ------FES--------------PRKEIIR---EYEAYLLGNLLSDFGGILGLWIGMSLITIIE 1785
            +  F   +S HG+ + + ++    +  W + ++  + GL  H Y  IS +   P +       N   FP V IC        KF +  ++     N+ ++    + Y+ A+ F  + +  Q  +  S       +   E   + +       +  R  +M+ FC+ N + CS + F  F H  Y  CF F     +     +   L+L LY             ++ + T + + G +V +++    P       + PSG QT+  L Q  +S  N P   C+  T      F+ Y++  G+T     Y+  +  C  +        +C C     PV  +   + E +  FC +I    +    I  +  +      ++  +N   L +   NQ+    Y+  +P   K  I    E EF NE             + +   +L     C +  +      S C  M          F+S              P+   +R   E  +Y L NL SD GGI+GLWIG+S++T+ E
Sbjct:   21 IHSFASRTSAHGLSRFFSQQIPWLRLLWIVVVMGALTGLTMHTYKQISLFRDYPVSSTTRLLTNKFTFPDVTICDPLM---KKFLRKQSSDLRRSNESILNYFVLSYMMAMQFANNKNSNQSDEAISVQATKMAYASFEHAVHTWPIFNMTEVSARMLDMLVFCQYNQETCSEKDFKVFYHRDYGNCFSFKPHNRLMKSSGVEKGLVLVLYSPSVDHIQNNDWYSNIVTTGLETGGLRVVVHQKDTIPYPSEYGINSPSGMQTVLALNQVQTSLANTPTKQCEPRTR-----FHAYDHILGNTQ---SYEKQLTDCTTFEHMKRVRDKCNCTIEG-PVPTETYGSGERRINFCHDIMGAQNPERTIKLIKNMV-----EFLRKNRNDLINPRNNQLNMLAYN-NLPMHEKQAISAALEHEFHNE-------------VKQRLKSL----RCALPELRSGRSQSKCLNMCKYTTYDFSVFQSRWPDLSLEIRLRVYPKTLTVRQLFEERSYELVNLFSDLGGIMGLWIGVSMVTLCE 521          
BLAST of SMED30004738 vs. TrEMBL
Match: A0A3M7T8U7 (Acid-sensing ion channel 2 OS=Brachionus plicatilis OX=10195 GN=BpHYR1_051251 PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 2.357e-14
Identity = 113/549 (20.58%), Postives = 231/549 (42.08%), Query Frame = -1
Query:  169 MGTSSFHGVIQAYHKRNKIDKGSWFISLVICMFGLIGHLYLIISRYISLPTTIDMVSSVNFDPFPAVAICPVTFISRDKFTKYYNTTQVSLNKKLVGDIFYVDALNFWRSLSKQQGKD--INSSSVLGKYWDEAETTFYRFQKMMNVSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYPVT---DEDEIPDK---LILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNI--PVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISLCSGLCNQVEYS----MYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTERAASVFKKSIHKRSLKRNSDKNKII 1773
            + +++ HG+      ++   K  WFI L +     + +L   I  Y S       V+ V+++   ++    VTF +++ F      +Q ++ + L        + +F+ SL K    +  + S +  G  +      + ++   ++ SI     +M+  C  NN  C+ + F          C+KF+       ++  IP +   L+L L+     +        +I S G ++ I+ +S  P  E    + P+GF+T   + ++  S++  P S C  N  S+ + F+ Y Y    N+   Y+    L   YH+ ++  ++C C +P+     F  A +N+ + ++ C   +  + F        C +              LC   CN   Y+    +  +  P++ K +I+  +             IN ++V+++ T    ++ V+               +N+ +      +I+EY A     L+++ GG LGL +G+SL++++EI  L              +FK  I K + KR++++NK++
Sbjct:   18 LESTTGHGIPNLVRNKSWPIKILWFICLSLSTGYCVYNLTKSIVDYFSF----SAVTKVSYERLDSIEFPTVTFCNKNPFLVRKPNSQNNMEENLKNQ-----SKDFFDSLLKLNASESSLESFTRFGYSYSYNTLQYKKYLTRVSFSID----DMLISCRFNNFKCTKDDFKVMFVAGLGNCYKFNGATKTGIEKTTIPGQKNGLMLELFSGYPNEEY-----DLIRSSGIQLFIHNSSTIPFVEFDAINLPTGFETDIWISKQHVSKLPSPFSNCIQNIFSL-DSFDSYLYEKCVNLLDRYQQKTCLLLCYHEYVK--QQCGCYSPDAFNITFNQACENTNSMAIGC-VFEAYAKFHQTGESSKCSH--------------LCPIECNSDNYNFRTFLADFPTPFYAKVLIEHGK-------------INPNLVRNFTTFQNVKDSVL--------------AVNVFYNDISLNVIKEYPAKTFEQLVAEIGGFLGLCVGISLLSVVEIFEL--------------IFKIIIIKSNYKRSNEQNKVL 489          
BLAST of SMED30004738 vs. Ensembl Cavefish
Match: asic4b (acid-sensing ion channel 4 [Source:NCBI gene;Acc:103044180])

HSP 1 Score: 54.6842 bits (130), Expect = 2.116e-7
Identity = 61/265 (23.02%), Postives = 103/265 (38.87%), Query Frame = -1
Query:  241 GFQTMFRLKQEGSSQINKPRSPCQVNTDSVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTER 1035
            GFQT    +++  S + +P   C+ +T+ V+  ++               Y+V  CR + + I+  + C C   ++P   D    ++ K               +   L  L     D          C   CN   Y          GK +   M  +  K  A Y              L+R  +     + DN      F +++I FE+   E I + +AY +  LL D GG +GL+IG S++TI+EI+     + KH+ +R
Sbjct:  279 GFQTFVSCQEQRLSYLPQPWGNCRASTEPVIPGYD--------------TYSVSACRLHCESIQVQRECNCRMIHMPGSADICTPAKVKC--------------VDRALGLLQKSTGDS-------CPCETPCNVTRY----------GKEL--SMVKIPSKGSARY--------------LSRKYHTTEDYIRDN------FLILDIYFEALNYETIEQKKAYDIAGLLGDIGGQMGLFIGASILTILEILDYIYEVIKHRIKR 476          
BLAST of SMED30004738 vs. Ensembl Cavefish
Match: ENSAMXT00000047165.1 (acid-sensing ion channel 1 [Source:NCBI gene;Acc:103026179])

HSP 1 Score: 53.5286 bits (127), Expect = 5.097e-7
Identity = 34/87 (39.08%), Postives = 53/87 (60.92%), Query Frame = -1
Query:  163 MINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTERAASVFKKSIHKRSLKRNSDKNKIIRI 423
            +++I FE+   E I + +AY L  LL D GG +GL+IG S++TI+E+      + K+K  R A   KKS HKRS   N+D+  ++ +
Sbjct:  440 VLDIFFEALNYETIEQKKAYELAGLLGDIGGQMGLFIGASILTILELFDYLYEVIKYKLCRCA---KKS-HKRS--NNNDRGAVLSL 520          
BLAST of SMED30004738 vs. Ensembl Cavefish
Match: ENSAMXT00000038299.1 (acid-sensing ion channel 1 [Source:NCBI gene;Acc:103026179])

HSP 1 Score: 53.1434 bits (126), Expect = 6.745e-7
Identity = 34/87 (39.08%), Postives = 53/87 (60.92%), Query Frame = -1
Query:  163 MINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTERAASVFKKSIHKRSLKRNSDKNKIIRI 423
            +++I FE+   E I + +AY L  LL D GG +GL+IG S++TI+E+      + K+K  R A   KKS HKRS   N+D+  ++ +
Sbjct:  412 VLDIFFEALNYETIEQKKAYELAGLLGDIGGQMGLFIGASILTILELFDYLYEVIKYKLCRCA---KKS-HKRS--NNNDRGAVLSL 492          
BLAST of SMED30004738 vs. Ensembl Cavefish
Match: asic4a (acid-sensing ion channel 4 [Source:NCBI gene;Acc:103040152])

HSP 1 Score: 50.8322 bits (120), Expect = 3.700e-6
Identity = 24/64 (37.50%), Postives = 41/64 (64.06%), Query Frame = -1
Query:  238 FAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTERA 429
            F +++I FE+   E I + +AY +  LL D GG +GL+IG S++T++EI+     + K + +RA
Sbjct:  410 FLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASILTVLEILDYIYEVVKRRLQRA 473          
BLAST of SMED30004738 vs. Ensembl Nematostella
Match: EDO42137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2F2])

HSP 1 Score: 59.3066 bits (142), Expect = 3.397e-9
Identity = 74/316 (23.42%), Postives = 129/316 (40.82%), Query Frame = -1
Query:  196 IKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQIN--KPRSPCQVNTDSVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRAR--NCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTERAASVFKKSIHKRSLK 1131
            ++ I    G KVTI++  + P           G  T  ++ +  + +I+  K RS    N  S  N+F  Y      N+T    Y+++ C+        ++RC C N N P         +     C+  +LNS+       +DCL N  YD + + +    C   C++V + +   +  W  ++                        V  Y    R R  N +  S +     S   A +++ +      +++E  AY   +LLSD GG +G+WIG+S +T  E+I L C +  + + R+    KK +H  S +
Sbjct:  242 LEGITEVAGMKVTISDQGVLPFPGQQGIRIMPGQSTGIQMTKLQTRRIDPFKNRSCESSNEMSDKNLFFGY------NMT----YSIMACKYSCLNARKIERCGCTNYNTPEM------QKRNIPLCN--RLNSTI------IDCL-NKAYDTFEDGSCDRECPPSCSEVSFDLTVSSARWPARSFE----------------------VTKYAYFLRVRVLNKIASSSSKYFVNSENIAQVHVYYGELDYLLVQETLAYTFMSLLSDIGGQMGMWIGISALTCAELIELVCVILANMSNRS----KKIVHINSFR 506          
BLAST of SMED30004738 vs. Ensembl Nematostella
Match: EDO39446 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA83])

HSP 1 Score: 58.9214 bits (141), Expect = 3.650e-9
Identity = 110/523 (21.03%), Postives = 200/523 (38.24%), Query Frame = -1
Query:  274 ESIKVKEKKAVDGFMGTSSFHGVIQAYHKRNKIDKGSWFISLVICMFGLIGHLYLIISRYISLPTTIDMVSSVNFDP--FPAVAICPVTFISRDKFTKYYNTTQVSLNKKLVGDIFYVDALNFWRSLSKQQGKDINSSSVLGKYWDEAETTFYRFQKMMNVSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYPVTDEDEIPDKL--ILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISLCSGLCNQVEY-----SMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYL 1815
            ES++V  +  ++ F   ++ HG   A    N++ +  W + L++    LI  L     R +   + +  V + N D   FPA++IC    + + K         +  + +   D+      + W ++S+    D +    + +Y              +N+S+  ++     + +     C+  HF  F    Y  C+ F+    +   I        GL +  D Q +        T  G +V +++ S +P  E      P GF T  RL ++  S +  P +          N   D  Y   +       Y ++ C  Y   +  VKRC C        +  +      + +C   Q+ +          C+Y     + F  N+ S C   C++VE+     S+Y Y    F +T+  E               I ++  K +    R R  VI+              +N+ ++    E+ +E EAY + +L  DFGG +GL++G S++TI E I L
Sbjct:   14 ESVEVPRESLLEAFSSYTTLHGFHFALSSTNRVRQIIWILLLILTSVVLIYQLAYSTQRVLEYASMV-QVETRNEDSITFPAISICSNNMMQKSKI--------LGKDAQRYLDLLDQKKEDQWDAISQSFSPDFDIEKAVHQY-------------GLNLSLAMKSCHYGRYLK-----CNPSHFTTFKEFRYGLCYTFNSGKRESAFISHDTGPTSGLSITLDAQPEEYYSLYSSTGTGFRVIVHDQSEFPWVEKHGWEIPPGFSTNVRLARKEISSLESPYNS---------NCSRDTNYASQS-------YCLVQC--YSDMV--VKRCGC-------HMLGMTEETGHTPWCSPQQIKA----------CVYTT--SRRFQPNMCS-CPVRCSRVEFDVQLSSLY-YPPDNFWETISNERSLT-----------IYANDTKKFQEWYRRR--VIQ--------------LNVFYKELTTEVRKEKEAYTISDLAGDFGGNMGLFLGCSILTIAEFIDL 441          
BLAST of SMED30004738 vs. Ensembl Nematostella
Match: EDO37667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF92])

HSP 1 Score: 55.4546 bits (132), Expect = 4.115e-8
Identity = 27/66 (40.91%), Postives = 38/66 (57.58%), Query Frame = -1
Query:  253 NDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKH 450
            N  A   F  + I +E    E+I EY +Y L N +SD GG LGLWIG+S +T  E++ L   ++ H
Sbjct:  162 NADARAYFVKLQIFYEELNHEVIEEYRSYELVNFVSDIGGQLGLWIGISALTASELVELLIVIALH 227          
BLAST of SMED30004738 vs. Ensembl Nematostella
Match: EDO26902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAR9])

HSP 1 Score: 53.1434 bits (126), Expect = 8.033e-8
Identity = 26/59 (44.07%), Postives = 35/59 (59.32%), Query Frame = -1
Query:  253 FAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKH 429
            F  + I +E    E+I EY +Y L N +SD GG LGLWIG+S +T  E I L   ++ H
Sbjct:    3 FVKLQIFYEELNHEVIEEYRSYELVNFVSDIGGQLGLWIGISALTASEFIELLIVIALH 61          
BLAST of SMED30004738 vs. Ensembl Nematostella
Match: EDO37452 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFR0])

HSP 1 Score: 55.0694 bits (131), Expect = 8.369e-8
Identity = 27/66 (40.91%), Postives = 38/66 (57.58%), Query Frame = -1
Query:  253 NDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKH 450
            N  A   F  + I +E    E+I EY +Y L N +SD GG LGLWIG+S +T  E++ L   ++ H
Sbjct: 1055 NADARAYFVKLQIFYEELNHEVIEEYRSYELVNFVSDIGGQLGLWIGISALTASELVELLIVIALH 1120          
BLAST of SMED30004738 vs. Ensembl Medaka
Match: asic4a (acid sensing ion channel subunit family member 4 [Source:NCBI gene;Acc:101159336])

HSP 1 Score: 51.2174 bits (121), Expect = 2.457e-6
Identity = 23/63 (36.51%), Postives = 41/63 (65.08%), Query Frame = -1
Query:  241 FAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTER 429
            F +++I FE+   E I + +AY +  LL D GG +GL+IG S++T++EI+     + +H+ +R
Sbjct:  407 FLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASILTVLEILDYVFEVIRHRLQR 469          
BLAST of SMED30004738 vs. Planmine SMEST
Match: SMESG000000638.1 (SMESG000000638.1)

HSP 1 Score: 1160.98 bits (3002), Expect = 0.000e+0
Identity = 572/572 (100.00%), Postives = 572/572 (100.00%), Query Frame = -1
Query:  136 MNEILEKDMKAIESIKVKEKKAVDGFMGTSSFHGVIQAYHKRNKIDKGSWFISLVICMFGLIGHLYLIISRYISLPTTIDMVSSVNFDPFPAVAICPVTFISRDKFTKYYNTTQVSLNKKLVGDIFYVDALNFWRSLSKQQGKDINSSSVLGKYWDEAETTFYRFQKMMNVSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYPVTDEDEIPDKLILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTERAASVFKKSIHKRSLKRNSDKNKIIRIGIENEAYEN 1851
            MNEILEKDMKAIESIKVKEKKAVDGFMGTSSFHGVIQAYHKRNKIDKGSWFISLVICMFGLIGHLYLIISRYISLPTTIDMVSSVNFDPFPAVAICPVTFISRDKFTKYYNTTQVSLNKKLVGDIFYVDALNFWRSLSKQQGKDINSSSVLGKYWDEAETTFYRFQKMMNVSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYPVTDEDEIPDKLILGLYVDDDYQRDTDDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTERAASVFKKSIHKRSLKRNSDKNKIIRIGIENEAYEN
Sbjct:    1 MNEILEKDMKAIESIKVKEKKAVDGFMGTSSFHGVIQAYHKRNKIDKGSWFISLVICMFGLIGHLYLIISRYISLPTTIDMVSSVNFDPFPAVAICPVTFISRDKFTKYYNTTQVSLNKKLVGDIFYVDALNFWRSLSKQQGKDINSSSVLGKYWDEAETTFYRFQKMMNVSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYPVTDEDEIPDKLILGLYVDDDYQRDTDDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTERAASVFKKSIHKRSLKRNSDKNKIIRIGIENEAYEN 572          
BLAST of SMED30004738 vs. Planmine SMEST
Match: SMESG000056126.1 (SMESG000056126.1)

HSP 1 Score: 72.0182 bits (175), Expect = 7.141e-13
Identity = 133/543 (24.49%), Postives = 200/543 (36.83%), Query Frame = -1
Query:  274 GFMGTSSFHGVIQAYHKRNKIDKGSWFISLVICMFGLIGHLYLIISRYISLPTTIDMVSSVNFDPFPAVAICPVTFISRDKFTKYYNTTQVSLNKKLVGDIFYVDALNFWRSLSKQQGKDINSSSVLGKYWDEAETTFYRFQKMMNVSIGHRNYEMIFFCEINNKPCSWEHFLEFDH--PIYKRCFKFSYPVTDEDE--------IPD-KLILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSL-FCDEIQLNSSFSSIINQLDCLYNLDYDQYF---NENVIS------LCS--GLCNQVEYSMYSYTMP------WFGKTMIKEMEFVNEKFMAHYN------SLINSSIVKDYGTLNRARNCVIKSMTDNDQ------ASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYL 1779
            GF   S+ H +      RN   +  W I  +    G + +L  II +Y   P   ++        FP ++ C V  I       ++        K+L     +     F  S   +  ++  S  +   Y  + + + Y F +   V  GH  +  IF C     PC+W HF E  H  P Y  CF F    +  D          PD K+I+   +    Q   D    + T  G  V ++EA  YP  +   E F     T   LK      +N       VN    +   N   Y+  T  +  +      C     Q +   RCKCL  N+PV      + + K L FC  +++N +    IN  D   N      F   ++  I+      LCS       V +S Y           W  K  + E+E +    M HYN        +  ++VK Y   + ++   I++ + N            F  I +   S   + I E   Y L  LL D GG +GLWIG SLIT+ E + L
Sbjct:   41 GFSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFVFPDISFCLVNPI-------HFPPVGTRQYKQLEHQ--FAMYFKFRNSTHLKARQEALSFMMYKNYSLDIDLSDYLFIQP-EVHYGHPAWSAIFLCVYMQSPCNWTHF-EVRHVWP-YGNCFTFVVNNSRRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYPD---EGFIVDSYTQIDLKITTKVHLN-------VNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPV------SKKFKHLPFCLAVEVNET----INNRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYLWLEK--LGELEKLQ---MRHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDL 546          
BLAST of SMED30004738 vs. Planmine SMEST
Match: SMESG000056126.1 (SMESG000056126.1)

HSP 1 Score: 71.633 bits (174), Expect = 8.549e-13
Identity = 132/542 (24.35%), Postives = 199/542 (36.72%), Query Frame = -1
Query:  274 GFMGTSSFHGVIQAYHKRNKIDKGSWFISLVICMFGLIGHLYLIISRYISLPTTIDMVSSVNFDPFPAVAICPVTFISRDKFTKYYNTTQVSLNKKLVGDIFYVDALNFWRSLSKQQGKDINSSSVLGKYWDEAETTFYRFQKMMNVSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPI-YKRCFKFSYPVTDEDE--------IPD-KLILGLYVXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTDSVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSL-FCDEIQLNSSFSSIINQLDCLYNLDYDQYF---NENVIS------LCS--GLCNQVEYSMYSYTMP------WFGKTMIKEMEFVNEKFMAHYN------SLINSSIVKDYGTLNRARNCVIKSMTDNDQ------ASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYL 1779
            GF   S+ H +      RN   +  W I  +    G + +L  II +Y   P   ++        FP ++ C V  I       ++        K+L     +     F  S   +  ++  S  +   Y  + + + Y F +   V  GH  +  IF C     PC+W HF E  H   Y  CF F    +  D          PD K+I+   +    Q   D    + T  G  V ++EA  YP  +   E F     T   LK      +N       VN    +   N   Y+  T  +  +      C     Q +   RCKCL  N+PV      + + K L FC  +++N +    IN  D   N      F   ++  I+      LCS       V +S Y           W  K  + E+E +    M HYN        +  ++VK Y   + ++   I++ + N            F  I +   S   + I E   Y L  LL D GG +GLWIG SLIT+ E + L
Sbjct:   33 GFSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFVFPDISFCLVNPI-------HFPPVGTRQYKQLEHQ--FAMYFKFRNSTHLKARQEALSFMMYKNYSLDIDLSDYLFIQP-EVHYGHPAWSAIFLCVYMQSPCNWTHF-EVRHVWPYGNCFTFVVNNSRRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYPD---EGFIVDSYTQIDLKITTKVHLN-------VNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPV------SKKFKHLPFCLAVEVNET----INNRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYLWLEK--LGELEKLQ---MRHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDL 538          
BLAST of SMED30004738 vs. Planmine SMEST
Match: SMESG000021654.1 (SMESG000021654.1)

HSP 1 Score: 67.781 bits (164), Expect = 1.514e-11
Identity = 127/567 (22.40%), Postives = 215/567 (37.92%), Query Frame = -1
Query:  214 VDGFMGTSSFHGVIQAYHKRNKIDKGSWFISLVICMFGLIGHLYLIISRYISLPTTIDMVSSVNFDPFPAVAICPVTFISRDKFTKYYNTTQVSLNKKLVGDIFYVDALNFWRSLSKQQGKDINSSSVLGKYWDEAETTFYRFQKMMNVSIGHRNYEMIFFCEINNKPCSWEHFLEFDHPIYKRCFKFSYPVTDED---EIPDKLILG---------LY--VXXXXXXXXXDIKTIITSHGGKVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQ--INKPRSPCQVNTDSVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSSII----------NQL--DCLYNLDYDQYFNENVI---SLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGT-------LNRARNCVIKSMTD---NDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTERAAS--VFKKSI 1785
            +  F   S+ HG+    H ++   +  WF   +   FGLI +L+ +  R++  P   D         FP + IC    I       Y+     S +++L+ ++F             Q+ K    S     Y     ++ Y +   ++V   H  +  I  C   N+ C+W HF      +Y  CF F+      D    IP+ + L          LY  +        D   +I   HG  V I+E   +P     +  F   + T F LK    S   +N   +P       VV  ++ ++   S N T        +     Q+I   K C+C     P+      +  +K  +C     N+S+ ++           N+L  +CL   D  ++F+ N +   S    +  +  + M+  T+        +EME   ++ + H+N  ++    K + T       ++      +K  TD    D     F  +     S   + + E E Y L  LL D GG +GLW+G SLITI EI      L +  T R +   ++KK +
Sbjct:   20 IQNFASKSTVHGINHFVHAKSAKRRLLWFSIGISVSFGLIFNLFYLFERFLQSPVLTDYHHEAIAFSFPDITICLTNPI-------YFPPNGSSRHRQLM-ELF-------------QKYKHFKKSKT--PYASRVHSSDYFYMNKVDV-YSHTPWNTIIHCSYMNQNCNWTHFHTTTLTVYGNCFTFNASKVTPDYGRHIPNSIFLNHMTPDFSLILYKSIFIPQYFKNDPFSSIFMPHGVIVMIHEEGTFPLITECY--FVDSY-TQFDLKIVKKSHLFVNNKCNP-------VVKYYSYFDPFASANKTFIGGNLECILNTVQQKIS--KYCECQWHAFPIL-----SVNSKLPYCLTSAFNASYLNLCLTRAFELVDKNKLRSNCL--DDRCEHFSFNTVVSHSSYPAINERKTHQMWLRTL--------REME---QRELLHFN--VSDLFSKAFNTEKAHTDNISSIEGAFLKQRTDLLNEDFIDNNFIQLRFIPGSLFMDYVEESEEYPLIRLLGDIGGCVGLWVGASLITIFEIFDFITELWRISTLRKSQSIIYKKYV 530          
BLAST of SMED30004738 vs. Planmine SMEST
Match: SMESG000069546.1 (SMESG000069546.1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.426e-11
Identity = 55/213 (25.82%), Postives = 94/213 (44.13%), Query Frame = -1
Query:  274 CRQYHQQIECVKRCKCLNPNIPVFVDAIKNSENKSLFCDEIQLNSSFSS---IINQLDCLYN--------LDYDQYFNENVISLCSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKDYGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGNLLSDFGGILGLWIGMS---LITIIEIIYL 870
            C +   Q  CV  CKC NP +P++    KN       C    LN++F S   I+    C+ N          Y ++FN          CN+V+Y              I++ + +  +  + + +     ++K +    +     I + +D ++    + +I I+ E P+ ++ +E   Y    LLSD GG++GLW+GMS   L  I EIIY+
Sbjct:  306 CMKVESQKLCVSNCKCYNPFLPIY----KNETGSPRIC----LNATFYSEEEILKNAKCMVNRLRKFKSFFLYRRFFNPKCQDYQLIKCNEVKYK-------------IEKEKLLFAELSSGFTTQRRRKVIKGFSKWFQR----IDNRSDFERIRDNYIVITIKREFPKGDLYKEEYEYPFSQLLSDIGGLMGLWLGMSVVGLFEIFEIIYM 493          
The following BLAST results are available for this feature:
BLAST of SMED30004738 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCNN1B2.388e-1021.57sodium channel epithelial 1 beta subunit [Source:H... [more]
SCNN1B2.790e-1021.57sodium channel epithelial 1 beta subunit [Source:H... [more]
SCNN1B4.396e-1021.62sodium channel epithelial 1 beta subunit [Source:H... [more]
SCNN1G9.148e-720.71sodium channel epithelial 1 gamma subunit [Source:... [more]
ASIC13.071e-636.59acid sensing ion channel subunit 1 [Source:HGNC Sy... [more]
back to top
BLAST of SMED30004738 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asic-26.031e-1419.69Degenerin-like protein asic-2 [Source:UniProtKB/S... [more]
deg-13.749e-1141.86Degenerin deg-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
deg-13.749e-1141.86Degenerin deg-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
deg-13.749e-1141.86Degenerin deg-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
asic-13.909e-856.25Degenerin-like protein asic-1 [Source:UniProtKB/S... [more]
back to top
BLAST of SMED30004738 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004738 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
asic4a3.309e-741.27acid-sensing (proton-gated) ion channel family mem... [more]
asic4a4.358e-741.27acid-sensing (proton-gated) ion channel family mem... [more]
asic4b6.298e-634.09acid-sensing (proton-gated) ion channel family mem... [more]
back to top
BLAST of SMED30004738 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdh123.307e-1223.48cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
cdh121.263e-1023.27cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
cdh124.703e-1022.89cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
scnn1b1.184e-922.53sodium channel, non voltage gated 1 beta subunit [... [more]
cdh126.087e-720.66cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
back to top
BLAST of SMED30004738 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Scnn1b1.289e-921.67sodium channel, nonvoltage-gated 1 beta [Source:MG... [more]
Scnn1g1.310e-620.71sodium channel, nonvoltage-gated 1 gamma [Source:M... [more]
back to top
BLAST of SMED30004738 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q22851|ASIC2_CAEEL7.672e-1319.69Degenerin-like protein asic-2 OS=Caenorhabditis el... [more]
sp|O13263|SCNNH_XENLA1.381e-1123.08Amiloride-sensitive sodium channel subunit gamma-2... [more]
sp|P51171|SCNNG_XENLA4.463e-1123.08Amiloride-sensitive sodium channel subunit gamma O... [more]
sp|O13262|SCNNC_XENLA6.772e-1123.48Amiloride-sensitive sodium channel subunit beta-2 ... [more]
sp|P24585|DEG1_CAEEL4.769e-1041.86Degenerin deg-1 OS=Caenorhabditis elegans OX=6239 ... [more]
back to top
BLAST of SMED30004738 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2A2KG541.239e-1621.16Uncharacterized protein OS=Diploscapter pachys OX=... [more]
A0A267H6C01.591e-1523.50Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GUI21.601e-1523.50Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8IQL91.406e-1421.64Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A3M7T8U72.357e-1420.58Acid-sensing ion channel 2 OS=Brachionus plicatili... [more]
back to top
BLAST of SMED30004738 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
asic4b2.116e-723.02acid-sensing ion channel 4 [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000047165.15.097e-739.08acid-sensing ion channel 1 [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000038299.16.745e-739.08acid-sensing ion channel 1 [Source:NCBI gene;Acc:1... [more]
asic4a3.700e-637.50acid-sensing ion channel 4 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of SMED30004738 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004738 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004738 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO421373.397e-923.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394463.650e-921.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376674.115e-840.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO269028.033e-844.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374528.369e-840.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30004738 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
asic4a2.457e-636.51acid sensing ion channel subunit family member 4 [... [more]
back to top
BLAST of SMED30004738 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000638.10.000e+0100.00SMESG000000638.1[more]
SMESG000056126.17.141e-1324.49SMESG000056126.1[more]
SMESG000056126.18.549e-1324.35SMESG000056126.1[more]
SMESG000021654.11.514e-1122.40SMESG000021654.1[more]
SMESG000069546.12.426e-1125.82SMESG000069546.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004738 ID=SMED30004738|Name=SMED30004738|organism=Schmidtea mediterranea sexual|type=transcript|length=1941bp
TACTGTGCCGTTATTCGGGTTTGAACGCACAAAGCATTTAATGTTGGATT
ATTATTAAATAATGGAAATGTTTAGTGAAATCAATAATTTCGCTAATAAA
AGTTAGGTGCAATAAAGTATCATCGATACCGTCTAATTTTCATACGCCTC
ATTTTCTATTCCGATTCTGATAATTTTGTTTTTATCGGAATTCCTTTTCA
GACTTCTCTTGTGGATTGACTTTTTGAAAACTGAAGCAGCGCGTTCAGTT
TTGTGTTTACTCAACGAGCATGCTAAGTATATGATTTCAATAATTGTTAT
CAGAGACATTCCAATCCACAGTCCTAAAATCCCGCCGAAATCACTGAGTA
AATTCCCCAATAAATATGCCTCATATTCTCGAATAATTTCCTTTCTGGGA
GATTCAAATTGAATATTAATCATTGCGAAACACAAGCTGGCTTGATCATT
ATCTGTCATGGATTTGATTACGCAATTGCGTGCTCTATTCAATGTTCCAT
AATCCTTCACAATTGATGAATTAATTAGACTGTTGTAATGGGCCATGAAT
TTCTCATTGACAAACTCCATTTCTTTGATCATTGTTTTACCGAACCAAGG
CATAGTATAAGAATACATTGAATATTCTACCTGATTACACAATCCCGAAC
ATAATGATATAACATTCTCATTAAAATACTGATCATAATCTAAATTATAA
AGACAATCAAGCTGATTAATAATGCTTGAAAAGGAAGAATTAAGCTGAAT
CTCATCGCAAAAGAGTGATTTATTTTCAGAATTCTTAATAGCATCAACAA
ATACTGGAATGTTCGGATTTAAACACTTGCATCTTTTAACGCATTCTATT
TGTTGATGGTATTGTCTGCAAAGTATCACATTGTATTTATATGGTATTGT
GATATTTGTTGAGCCATTATATTCATAATCGTTGAAAACGTTGACCACTG
AATCAGTATTAACTTGGCATGGAGACCTTGGTTTATTGATTTGACTGCTA
CCTTCTTGTTTCAATCGAAACATCGTTTGGAATCCTGACGGAAAATGTTC
AAATGAACTTTCAGTTCCAGGGTAAATACTTGCTTCATTTATAGTAACCT
TTCCTCCATGAGAGGTTATTATCGTTTTAATATCATCAGTGTCTCTTTGA
TAGTCATCATCAACATAAAGCCCCAATATCAATTTATCTGGAATTTCATC
TTCATCAGTTACCGGATAGGAGAATTTAAAACATCGCTTATAAATCGGAT
GATCGAATTCAAGGAAATGTTCCCATGAGCAAGGTTTATTGTTAATTTCA
CAAAAGAAAATCATTTCATAATTTCGATGACCTATTGAAACATTCATCAT
TTTCTGGAATCTATAGAAAGTGGTTTCAGCTTCATCCCAATACTTTCCAA
GAACTGAACTACTGTTTATGTCTTTGCCTTGTTGTTTACTTAGGGACCTC
CAGAAATTCAAGGCATCGACGTAGAAAATATCCCCAACTAGCTTTTTATT
AAGGGAAACTTGAGTTGTATTGTAATACTTGGTGAATTTATCCCTGCTAA
TAAAGGTAACCGGACATATTGCGACAGCAGGAAAAGGATCAAAATTCACT
GAAGAGACCATGTCAATAGTTGTGGGCAAACTTATATATCTACTGATTAT
TAGGTAGAGATGCCCAATTAAGCCAAACATACAAATAACTAAACTGATGA
ACCAGCTCCCTTTATCAATTTTATTTCGTTTATGATATGCTTGAATCACT
CCATGAAACGATGAGGTACCCATAAAACCATCAACAGCCTTTTTTTCTTT
TACTTTAATGGATTCAATCGCTTTCATATCCTTTTCCAAAATTTCATTCA
TTTTCAATTTATAATTTGTTTCCAAAGAACACTTTTAAATAAAATCTTTT
TTGTATTTTTTTTATTGAATATTTCAAAAGAAAATACTTTG
back to top

protein sequence of SMED30004738-orf-1

>SMED30004738-orf-1 ID=SMED30004738-orf-1|Name=SMED30004738-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=573bp
MNEILEKDMKAIESIKVKEKKAVDGFMGTSSFHGVIQAYHKRNKIDKGSW
FISLVICMFGLIGHLYLIISRYISLPTTIDMVSSVNFDPFPAVAICPVTF
ISRDKFTKYYNTTQVSLNKKLVGDIFYVDALNFWRSLSKQQGKDINSSSV
LGKYWDEAETTFYRFQKMMNVSIGHRNYEMIFFCEINNKPCSWEHFLEFD
HPIYKRCFKFSYPVTDEDEIPDKLILGLYVDDDYQRDTDDIKTIITSHGG
KVTINEASIYPGTESSFEHFPSGFQTMFRLKQEGSSQINKPRSPCQVNTD
SVVNVFNDYEYNGSTNITIPYKYNVILCRQYHQQIECVKRCKCLNPNIPV
FVDAIKNSENKSLFCDEIQLNSSFSSIINQLDCLYNLDYDQYFNENVISL
CSGLCNQVEYSMYSYTMPWFGKTMIKEMEFVNEKFMAHYNSLINSSIVKD
YGTLNRARNCVIKSMTDNDQASLCFAMINIQFESPRKEIIREYEAYLLGN
LLSDFGGILGLWIGMSLITIIEIIYLACSLSKHKTERAASVFKKSIHKRS
LKRNSDKNKIIRIGIENEAYEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000133mechanoreceptor cell
PLANA:0000418head
PLANA:0002019chemosensory neuron
PLANA:0002055mechanosensory neuron
PLANA:0007561head margin
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 195..211
score: 32.71
coord: 86..102
score: 29.88
coord: 506..522
score: 49.65
coord: 181..192
score: 34.33
coord: 492..506
score: 46.67
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 26..526
e-value: 7.1E-55
score: 186.7
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 28..541
NoneNo IPR availableGENE3DG3DSA:1.10.287.770coord: 50..524
e-value: 1.6E-39
score: 138.0
NoneNo IPR availableGENE3DG3DSA:2.60.470.10coord: 77..494
e-value: 1.6E-39
score: 138.0
NoneNo IPR availableGENE3DG3DSA:1.10.3590.10coord: 99..249
e-value: 1.6E-39
score: 138.0
NoneNo IPR availableGENE3DG3DSA:1.10.287.820coord: 287..405
e-value: 1.6E-39
score: 138.0
NoneNo IPR availableTMHMMTMhelixcoord: 508..530
NoneNo IPR availableTMHMMTMhelixcoord: 48..70