slc6a-23

Overview
Nameslc6a-23 (AKN21443.1)
Smed IDSMED30004736
Length (bp)2270
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc6a-23 (SMED30004736) t-SNE clustered cells

Violin plots show distribution of expression levels for slc6a-23 (SMED30004736) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004736

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30004736SMESG000054972.1 SMESG000054971.1 Contig43198newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30004736SMESG000054972.1 SMESG000054971.1 Contig43198uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testis primordiumSMED30004736SMESG000054971.1 PL06022A1E03_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
testis primordiumSMED30004736SMESG000054972.1 PL08009A2C02_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc6a-23 vs. Ensembl Human
Match: SLC6A5 (solute carrier family 6 member 5 [Source:HGNC Symbol;Acc:HGNC:11051])

HSP 1 Score: 357.451 bits (916), Expect = 3.864e-111
Identity = 217/594 (36.53%), Postives = 334/594 (56.23%), Query Frame = 2
Query:  365 DEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEY--------------------VSSTSEYWDYYVTG---FIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKN 2077
             E E  D+    RG W ++++F+LS VG+AVGLGNVWRFP   +++GGGAFL+PY  +    G+P+  LE+ + QF+ +GP   +K +P L G G  M+ +++ I IYY+ II ++ FYLFAS  SVLPW  C++ +NT +C              ++                    V+ TS+    +V+G   + KY   +     EYPG  +W LALCL L W I    L  G+K SGK++YFT  +PY  L+ L+I G TLPG+  GI +++ P W K+ D  V + A  Q+FFS S A GG+IT SSYN FH+N YRD++IV   +  TS+ AGF +F ++G+MA      IEN+ + G  + F+ + EAL+ LP   FW I+  LM +TLG+D+ FA  ET+VT++ D +P  +  R  K V     C   FI G  +++ GG + F ++D   +S+ L +IA+ E + +  +YG ++F  D +MM GF  +++W +  AFV+P I+  IL  SF  ++ +       P W+  L ++ L   ++ I I  V  ++    R+ +      +K +  P   WGP+  ++
Sbjct:  180 QEDEQGDEN-KARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFP--KYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMHLAPGRFIER-----LKLVCSPQPDWGPFLAQH 765          
BLAST of slc6a-23 vs. Ensembl Human
Match: SLC6A7 (solute carrier family 6 member 7 [Source:HGNC Symbol;Acc:HGNC:11054])

HSP 1 Score: 344.739 bits (883), Expect = 1.027e-107
Identity = 223/608 (36.68%), Postives = 342/608 (56.25%), Query Frame = 2
Query:  401 RGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXX----XXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIE---PPVYWGPYYKKNWLLGSFYRKKLLENYENPQFLKYVSKIEDVKGIVELAKTLNS 2203
            RG W  +++F+LSC+G+ VGLGNVWRFP R Y +GGGAFLVPY  +    G+PL  LEL + QFS  GP   +K+ P+  G G  M+ +   + IYY+ IIA+  FYLFASLTS LPW  C + +NT  CL    +K    +   +    VS + EYW  YV         +       PG  +W+L LCLLL W I  L ++ GVK SGK++YFT  +PY  LL L++ G TLPG+  GI FYL P ++ +   KV   A  Q+F+S  +  GG++T++SYN FH N YRD+ IV   +  TS++AGFA+F +LGYM+Q  G  ++ +  +G  L F+ + +A++ LP   FW+ L   M +TLG+DSQFA  ET+VTA+ D +P+    +  KAV   ++C  +++ GL+L + GG +W  +LD   +SFGL ++ ++  + V  +YG ++F  D  MM GF   LY+     F+SP  +  +++ S + +   +      P WAE L  +  L+  L I  G++  + +        E  +  ++L +   P + WGP  ++N      Y   L  +      + ++ K    +G++    T+++
Sbjct:   37 RGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSDLPWEHCGNWWNTELCLEHRVSKDGNGALPLNLTCTVSPSEEYWSRYVLHI------QGSQGIGSPGEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLRPK--KAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRACWLFLSPATLLALMVYSIVKYQPSEYGSYRFPPWAELLGILMGLLSCLMIPAGMLVAVLR--------EEGSLWERLQQASRPAMDWGPSLEEN--RTGMYVATLAGSQSPKPLMVHMRKGTSARGLLYARMTVSA 626          
BLAST of slc6a-23 vs. Ensembl Human
Match: SLC6A7 (solute carrier family 6 member 7 [Source:HGNC Symbol;Acc:HGNC:11054])

HSP 1 Score: 343.584 bits (880), Expect = 1.064e-107
Identity = 218/566 (38.52%), Postives = 327/566 (57.77%), Query Frame = 2
Query:  401 RGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXX----XXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIE---PPVYWGPYYKKN 2077
            RG W  +++F+LSC+G+ VGLGNVWRFP R Y +GGGAFLVPY  +    G+PL  LEL + QFS  GP   +K+ P+  G G  M+ +   + IYY+ IIA+  FYLFASLTS LPW  C + +NT  CL    +K    +   +    VS + EYW  YV         +       PG  +W+L LCLLL W I  L ++ GVK SGK++YFT  +PY  LL L++ G TLPG+  GI FYL P ++ +   KV   A  Q+F+S  +  GG++T++SYN FH N YRD+ IV   +  TS++AGFA+F +LGYM+Q  G  ++ +  +G  L F+ + +A++ LP   FW+ L   M +TLG+DSQFA  ET+VTA+ D +P+    +  KAV   ++C  +++ GL+L + GG +W  +LD   +SFGL ++ ++  + V  +YG ++F  D  MM GF   LY+     F+SP  +  +++ S + +   +      P WAE L  +  L+  L I  G++  + +        E  +  ++L +   P + WGP  ++N
Sbjct:   37 RGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSDLPWEHCGNWWNTELCLEHRVSKDGNGALPLNLTCTVSPSEEYWSRYVLHI------QGSQGIGSPGEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLRPK--KAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRACWLFLSPATLLALMVYSIVKYQPSEYGSYRFPPWAELLGILMGLLSCLMIPAGMLVAVLR--------EEGSLWERLQQASRPAMDWGPSLEEN 586          
BLAST of slc6a-23 vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 312.383 bits (799), Expect = 6.660e-96
Identity = 210/573 (36.65%), Postives = 314/573 (54.80%), Query Frame = 2
Query:  401 RGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXX----------------XXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYP---FLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGP 2062
            RG W N+IEFVL+ VG+AVGLGNVWRFP   Y +GGGAF+ PY  + I  G+PL  +EL   QF+ +G    +++ P+  G+G+ M+ V+  I IYY+ +I  +++Y F+S+T VLPW+ C++ +NT+ C   L   +  N                 S++  S + EYW  YV       S +  N  E   P    L  CL ++W +  L L+ GVK SGK++YFT  +PY  L  L + G TL G+ +GI++YL P W+KI + KV   A  Q+F+S   A GG+IT +SYN FH+N YRDS+I+   +  TSV AGF +F ILG+MA   G  +  + + G  L F+ + EAL+ LP    W++L   M I LG+ +QF + ET+VTA++D       LQ     K      +    F+ G+ L S  G +W  ++D   +SF L +I+    + +  IYG + +  D +MM GF   L++ I   FVSP IIF IL+ + I +  I     + P WA  + F+  L  +L I +   + +++   R +       +K   +P   WGP
Sbjct:   27 RGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKL----SDDIGNFGEVRLP----LLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQK----KTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIPL---YAMFRL-CRTDGDTLLQRLKNATKPSRDWGP 583          
BLAST of slc6a-23 vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 312.383 bits (799), Expect = 6.660e-96
Identity = 210/573 (36.65%), Postives = 314/573 (54.80%), Query Frame = 2
Query:  401 RGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXX----------------XXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYP---FLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGP 2062
            RG W N+IEFVL+ VG+AVGLGNVWRFP   Y +GGGAF+ PY  + I  G+PL  +EL   QF+ +G    +++ P+  G+G+ M+ V+  I IYY+ +I  +++Y F+S+T VLPW+ C++ +NT+ C   L   +  N                 S++  S + EYW  YV       S +  N  E   P    L  CL ++W +  L L+ GVK SGK++YFT  +PY  L  L + G TL G+ +GI++YL P W+KI + KV   A  Q+F+S   A GG+IT +SYN FH+N YRDS+I+   +  TSV AGF +F ILG+MA   G  +  + + G  L F+ + EAL+ LP    W++L   M I LG+ +QF + ET+VTA++D       LQ     K      +    F+ G+ L S  G +W  ++D   +SF L +I+    + +  IYG + +  D +MM GF   L++ I   FVSP IIF IL+ + I +  I     + P WA  + F+  L  +L I +   + +++   R +       +K   +P   WGP
Sbjct:   27 RGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKL----SDDIGNFGEVRLP----LLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQK----KTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIPL---YAMFRL-CRTDGDTLLQRLKNATKPSRDWGP 583          
BLAST of slc6a-23 vs. Ensembl Celegans
Match: dat-1 (Sodium-dependent dopamine transporter [Source:UniProtKB/Swiss-Prot;Acc:Q03614])

HSP 1 Score: 296.59 bits (758), Expect = 1.996e-90
Identity = 187/556 (33.63%), Postives = 302/556 (54.32%), Query Frame = 2
Query:  401 RGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAF-KMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCX--------XXXXXXXXXXXXIEYVSSTSEYWDYYVTGFI-----KYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLL--IVLLPIAIGIVHTIYKF-KLRYNQLETK 2017
            R +W  +++F+LS VGFAV LGN+WRFP   +++GGG FL+PY+ + +  GVPL  +EL + Q+  +G    + ++ P+  GIG+C++  A  +  +Y+ I+AW   YL+ S +  LPW+ C++ +N+  C          ++   +  + S E +S+  EY   +  GF+       P+          G  +W +AL L + + I    +  G+  SGK+++FT L+PY  L  L I G TLPG  NGI +YL P++  +  P V + A  Q+FFS     G ++ YSSYNDFH+N Y D++   F++  TS ++GF +F +LGYM+ ++G  IE +   G  L F+ + EALST+P   FW++L  LM +TLG+DS F   E ++T L D +P L+ +R    V V  L     + G+ + + GG    + L    +++GL +    E + +  IYG +QF +D K M GF    YW    +  +P I+  ++ ++FIN+  +  +D   P  A  +  +F L     +P+       IYKF   R N +  K
Sbjct:   40 REQWSGKLDFLLSVVGFAVDLGNIWRFPYLCFKNGGGVFLIPYSIMVLLTGVPLFYMELCLGQYYRKGAITTWGRICPLFKGIGYCVILTAFYVDFFYNVILAWGLHYLYTSFSFNLPWASCNNSYNSPACYEPHWSEDGTAMCRSANQSVSAEKISAAEEY---FYKGFLGLHEANAPNSHVIRSVTDLGNVRWDIALSLFVVYLICYFSMWKGIHTSGKVVWFTALFPYVVLGILFIRGVTLPGWQNGIEYYLRPNFEMLKRPSVWQDAATQVFFSLGPGFGVLMAYSSYNDFHNNVYVDALFTSFINCATSFLSGFVIFSVLGYMSCKSGKPIEAVAQEGPGLVFVVYPEALSTMPYAPFWSVLFFLMLMTLGLDSSFGGSEAIITGLSDEFPILKKNR---EVFVGCLFAFYMVIGIAMCTEGGILIMEWLIIYGTTWGLLIAVFCEAMVIAYIYGLRQFVHDVKEMMGFRPGNYWKFCWSCAAPFILLSMITSNFINYQALTYQDYTYPTAANVIGIIFALSGASFIPLV-----GIYKFVNARGNTISEK 584          
BLAST of slc6a-23 vs. Ensembl Celegans
Match: snf-11 (Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43])

HSP 1 Score: 275.404 bits (703), Expect = 1.295e-82
Identity = 182/560 (32.50%), Postives = 281/560 (50.18%), Query Frame = 2
Query:  401 RGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLT-SVLPWSVCSHDFNTNKCXXXXXX--------------------------------------XXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILD-KRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFD--RIKVRDLEVPIWAETLAFVFLLIVLLPI 1954
            R +W +  +F++SC+G+A+GLGNVWRFP   Y++GGGAFL+PY    +  G PL +LE    Q    G    FK+ PI  G+G     +A  + IYY  +++W+  YL+ S T S +PW  C H +NT  C +                                               + +  VS   E+W++ V G          +  E PG  +W LAL LLL W I  L +  GVK +GK++Y T  +PY  L CL+I G TL G+  G+ FYL PD++K+ + KV   AV Q+FFS  +  G ++   SYN F++N Y+ ++ V FV+  TSV AGF +F  +G+MA +    +  +  +G  L F+ +   +  LP  QFW+ L  LM + LG+DSQF   E   TA+ID +P ++  ++ + + V ++C + ++ GL  V+ GG + F + D    S + L  +   E I +    G  ++    K M G+  S +W     F +P + FG+LL   I +   RI   + + P+W     +   L  +L I
Sbjct:   10 REQWSSWADFIMSCIGYAIGLGNVWRFPYLCYQNGGGAFLIPYCISLVFCGAPLFILETSWGQLMSVGGLGMFKICPIFKGVGIAAAVMAFWLNIYYIVVLSWAATYLYNSFTMSDVPWKNCDHAWNTPNCRSEYVKIPCDSNRTIAEFFNVKVLTHDHIHEYKKQFFVGEKMNWTVCSAADLSVVSPVKEFWNHRVLGI--------SSGLENPGGIRWDLALFLLLVWIICYLCIFKGVKWTGKVVYITASFPYMMLFCLLIRGLTLEGAGVGLEFYLKPDFSKLLESKVWVDAVTQVFFSYGLGLGALVALGSYNKFNNNVYKQALTVCFVNSGTSVFAGFVIFSFIGFMATQQEKSVAEVAQAGPGLLFLAYPSGILQLPYTQFWSCLFFLMVLFLGVDSQFCTMEGFFTAIIDEFPQIRRKKYGREIFVGVICVISYLIGLTTVTEGGFYVFQLFDFYAASGWALLWLLFFECIAISWSLGIDRWYEHMKSMIGYYPSAWWKFCWVFATPSVCFGVLLFGLIKYQPLRIDAYNYDYPVWGHIFGWFLSLSSMLCI 561          
BLAST of slc6a-23 vs. Ensembl Celegans
Match: mod-5 (Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7])

HSP 1 Score: 246.514 bits (628), Expect = 2.250e-71
Identity = 176/535 (32.90%), Postives = 279/535 (52.15%), Query Frame = 2
Query:  386 KTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMV-PILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSV----LPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINS-GSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASR--FLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFIN--FDRIKVRDLEVPIWAETLAFVFLLIVLLPIAI 1960
            +++ +R KW  ++EF+L+ VG+AV LGN+WRFP   Y+ GGGAFL+PY  + +  G+P+  +EL + QF   G    ++ V P+  GIG+ +  +   I I+Y+AIIA + ++   SL+ +    +PW+ C + +NT +C   L    + N +    + + EY+ Y V    K    +        G  +  +A+CLL  + +    L  G + SGKI++ T   PY  L  L+I G  LPG+ NG+ +Y+ PD+ K+ DP V   A  Q+FFS     G ++  SSYNDF++N YRD++    ++  TS  +G  VF  LGYM+  T   I  ++    +SL FI + +AL+T+    FW+ +  +M ITLG+DS FA  E  +T   D   FL  +R  F+  + +     + +      +S GG+F    LD+   S  +  I   E I V   YG  QF  D + M GF   +YW +     SP+ I  I + +  N  F  I++     P W+  L +   L+ +L I +
Sbjct:   95 RSSMVRDKWATKMEFLLAVVGYAVDLGNIWRFPSVCYKHGGGAFLIPYFIMLMIGGLPMFYMELVLGQFHRSGCVSIWRKVCPLFRGIGYGICCICTFIAIFYNAIIAQAVYFAIVSLSKIWDSEVPWASCGNPWNTPRCSDDLNVTISRNGT-PLTTPSEEYYLYKVLEVQKSTGFDDL------GGVKTSMAVCLLAVFIMVYFALWKGPQSSGKIVWVTATAPYIILSILLIRGLLLPGAKNGLYYYVTPDFEKLKDPAVWSAAATQIFFSLGPGFGVLLALSSYNDFNNNCYRDAVTTSIINCATSFFSGCVVFSTLGYMSLLTNKPINEVVGEHDASLIFIVYPQALATMDYSCFWSFIFFVMLITLGIDSTFAGIEAFITGFCDESRFLSKNRKWFVLVICI-----IYYFLSFPAISYGGQFVIPFLDEYGVSLSVLFIVTCEMIAVCWFYGVDQFSKDIRAMLGFYPGIYWRVCWT-CSPVFISVIFIMTVYNSSFKPIQMASYTFPWWSVILGWFLRLLSVLAIPV 616          
BLAST of slc6a-23 vs. Ensembl Celegans
Match: snf-3 (Sodium- and chloride-dependent betaine transporter [Source:UniProtKB/Swiss-Prot;Acc:G5EBN9])

HSP 1 Score: 236.113 bits (601), Expect = 4.061e-68
Identity = 186/593 (31.37%), Postives = 289/593 (48.74%), Query Frame = 2
Query:  401 RGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGF-IKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDK-RVSSFGLPLIALSETICVGLIYGF--KQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRD-LEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSF---YRKKLLENYENPQFLKYVSK 2155
            RG+W  + +F++S V +AVGLGNVWRFP   Y++GGG+FLV Y        VP+ L+E+ + Q+  +G  + + M P+  G+G   V +A   + Y+  I+AW+ FY+ +S+  V PW  C++ +N   C+    N + L      V+S   +    V  F  K    +  +++E+ G  QW L   +   W I    L  G+  + K +YF  L+PY  +  L+I G TL G+  GI FYL P+  ++ D  V + A  Q+F+S  +  G +I   S+N F+ N ++D+I + F++  TS+ AGFAVF ILGYM+      I  I+  G  L F+ + E  S LP  Q + +L  LM   LG+DSQ  M E + TAL D +P L   R  K  ++ I C   F  G+ +V+  G  W  + D    S + L  +   E   VGL YGF     R     M G +L      +  F +P     + +   + +  +K  D  + P WA    + FL    + +  G  + IY        L  K  ++K +              L GSF    +K L+ N E  +F++  S+
Sbjct:   30 RGQWTGKFDFLMSMVAYAVGLGNVWRFPYLCYKNGGGSFLVVYMIFFCLAAVPIFLMEVTVGQYLQKGAMEMWLMCPLFRGVGIGNVVIAFMCIAYFCVIVAWAMFYMISSIAWVFPWETCNNYWNDATCVTGKENFTELARIKALVASAGGHTQTSVEQFWEKRVLHDTGDISEFGGI-QWELFFIMAAAWLIVYFALWKGITQARKFVYFCALFPYVLIFILLIRGLTLEGAGTGIYFYLKPNATRLLDTAVWKDAGTQVFYSYGVGFGALIALGSHNKFNHNCFKDAITMCFINGCTSITAGFAVFSILGYMSHVAQKDISEIVKPGVGLAFLAYPEVASNLPMKQVFAVLFFLMITILGLDSQVCMMEGLFTALEDAFPIL---RKYKKQSLGIFCLFFFCIGIPMVTHSGSHWLTLFDAYGASGYALLFVVFFEV--VGLAYGFGAHNIRKALHEMIGVTLPKGIEYVWKFCAPATSLVLFVFCVVYYHPVKYPDGKDFPFWANAFGW-FLSSCSMVVIPG--YAIYYLFFTNKHLTLKERVRKGLN-------------LDGSFESPAKKNLVNNAEELKFIESSSQ 600          
BLAST of slc6a-23 vs. Ensembl Celegans
Match: snf-7 (Transporter [Source:UniProtKB/TrEMBL;Acc:G5EE39])

HSP 1 Score: 218.394 bits (555), Expect = 7.785e-61
Identity = 174/550 (31.64%), Postives = 271/550 (49.27%), Query Frame = 2
Query:  371 VEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFK-MVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNK------------CXXXXXXXXXXXXXIEYVSSTSEYWDY-------------------YVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGI--IFYLAP------DWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIEN------IINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMM---AGFSLSLY-------WFIMMAFVSPIIIFGILLA 1852
            VE +D+    RG     IE  LS +G AVGLGN+WRFP   Y++GG +FL+ Y    I   VP + +E  + Q++ + P  AF+ M+PIL G+GW    V   I +YY  +I+W   YLF ++      S C++D+N N+            C   + N S + +++   +S      Y                   + T F+  PS    + N    P    +A+C    W IA + L+ G+K  GK+ Y+TVL PY  ++ L+I G TL G++ G+  +F+  P      D+  +YDP V   A+ Q+ FS SI QGG++   SYN    N+YRD+ +V+  D   S++ G AVF  LG++A++    I N      ++  G +L FI +TEA++ +P P  W  L  +M   LG+ ++  + ETV + L D + +L+  R++  VTV       F+ GL++ S  G +WFD+ D+  +     +      + V   YG   FR D + M       L  Y       W I+  FV+PI    I+ A
Sbjct:   61 VENVDRQA-FRG-----IESFLSSLGQAVGLGNIWRFPTTAYKNGGLSFLIAYVVCGILFAVPAIHMEFALGQYAAKSPPAAFRRMMPILEGVGWMTCLVGAIIGVYYMIVISWIVLYLF-NIIYATKISKCNNDWNKNRSTICYEGVKQKLCSGYMLNSSLVMTNLTRNASVHSKMMYIDGKCQNATNMKLAVGTEQFFTNFVVKPSTGFTDFNSINVPMLAAVAVC----WVIAIISLIRGMKAIGKLSYYTVLLPYAIIIALMIRGLTLEGASTGLHFLFWGKPNEYGHYDFAGLYDPDVWIAALMQMCFSLSIGQGGLMNIGSYNKKTYNWYRDAYLVVLCDTLMSLLGGTAVFSTLGFLAEQRNISISNPKGFNEVVQEGHALAFIVYTEAIAQMPYPFLWYALFFVMLFLLGISTEIVIIETVCSCLADRFHYLRQHRWITVVTV---STTFFLLGLVMTSDAGFYWFDLYDEYSAGVSATIGTAIMCLTVCWCYGLDNFRADIREMWEEPESRLDKYLGPGAYVWTIVWRFVTPICCLVIMFA 596          
BLAST of slc6a-23 vs. Ensembl Fly
Match: GlyT (gene:FBgn0034911 transcript:FBtr0301162)

HSP 1 Score: 328.561 bits (841), Expect = 1.075e-97
Identity = 207/575 (36.00%), Postives = 325/575 (56.52%), Query Frame = 2
Query:  401 RGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKM-VPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYV-----SSTSEYWDYYVT---GFIKYPSREPYNMN---------EYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSL---SLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGP 2062
            RG W  R +F+LS +G++VGLGNVWRFP   Y +GGGAFL+P+T + +  G+PL+ +EL   Q++  GP   ++   P+  G+G  M+ V+  +++YY+ IIAW+ FY+FAS   VLPW  C   ++T  C +         ++  Y      ++TS   +   T   G +K P  E Y  N         E  G  +  LA CL L W+I  L L  GV+ SGK++YFT L+PY  L+ L + G TLPG++ GI+FYL PDW ++ + +V   A  Q+FF+ S A GG+IT SSYN F +N Y+DS+IV F +  TS  AG  +F I+G++A      +E +++ G+ L FI + E ++ LP    W +L  +M +TLG+DSQFA+ ETV TA++D +P L   R  K   V  +    +I GL   +  G +W  ++DK  +++ + LIA+SE I +  IYG ++F  D + M G      + +W IM  +++P  +  IL  +++ +   K      P+WA+ + ++  L+ +L I +     I++  +    L  +  +K L++P   WGP
Sbjct:   57 RGTWTGRFDFLLSLLGYSVGLGNVWRFPYLCYNNGGGAFLIPFTIMLVIAGLPLMFMELSFGQYAALGPVAVYRRFCPLFRGLGTGMILVSAIVMLYYNLIIAWTIFYMFASFAPVLPWQNCEPAWSTKYCFSYAQADQCEATNGTYYLRTCHNATSAAENNITTLALGALKRPPAEEYFNNFVLGLSKGIEETGSIKLSLAACLFLAWTIVFLCLCKGVQSSGKVVYFTALFPYVVLVILFVRGVTLPGASTGILFYLTPDWKQLANAQVWGDAAVQIFFALSPAWGGLITLSSYNKFSNNCYKDSLIVAFCNIATSFFAGLVIFSIIGFLAHELNVDVEKVVDQGAGLAFIVYPEVVTRLPVSPVWAVLFFVMLLTLGLDSQFALMETVTTAILDRFPNL---RQYKIWVVLSVAIFGYIGGLGFTTNSGMYWLQLMDKYAANWSVLLIAISECILIAWIYGSQRFLNDIQGMIGKRSWFWNFFWGIMWRYITPATLLFILFFNWVEYKPAKYGHYVYPMWADAVGWIVGLLPVLVIFLVAFQEIWRAPM---SLSFRDRIKHLLQPTAEWGP 625          
BLAST of slc6a-23 vs. Ensembl Fly
Match: CG8850 (gene:FBgn0033708 transcript:FBtr0087973)

HSP 1 Score: 303.523 bits (776), Expect = 6.025e-93
Identity = 199/593 (33.56%), Postives = 327/593 (55.14%), Query Frame = 2
Query:  374 EVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYP-GPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTK-IENIINSGSSLFFITFTEALSTLP-APQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKL---IEPPVYWGPYYKKNWLLGSFYRKKLLENYENPQ 2134
            E   +++  R +W   +EF+ SC+  +VGLGNVWRFP    E+GGGAFL+PY  + + +G P+  LE+ I QFS RG  +AF M PI+ GI +  V+       YY+ I+A +  YL AS + VLPW+ C  ++    C+A+ A  +  +S ++ VSS   +       F +   REP ++++   G P W L LCLL TW I G  L  G++ SGK  YF  L+PY  ++ L+I   TLPG+  GI+++L P W+++ +P V   A+ Q+FFS +I  G ++ Y+S+NDF+ N ++D II+  +D  TS++AG  +F ILG +A  T TK I  ++  G+ L FI++ EA++     PQ + +L   M + LG+ S   M   VV  + D +  L    +L AV+      + F+ GL+ ++PGG+F  +++D    +F   ++A++E + VG IYG K+   D + M     S YW I  A V+P ++F +L+    +++ +  R ++ P       ++   + +L +    + TIY       Q   K F  K    ++P   WGP   + +     +RK+   ++++P+
Sbjct:   35 EAESESSGQRDQWSRGVEFLFSCIALSVGLGNVWRFPFIALENGGGAFLIPYVIVLLLIGRPVYYLEVIIGQFSSRGCIRAFDMAPIMRGIAYGQVYSTALATTYYACIMALTIRYLVASFSEVLPWTYCLVEWG-KSCVATGATAANDSSIVQGVSSAELF-------FTQTVLREPESLDDNGLGTPSWDLVLCLLATWVIIGTILSKGIRSSGKASYFLALFPYVIMIVLLIRAVTLPGAWQGIVYFLKPQWSQLLNPHVWYAAITQMFFSLAICFGTLVMYASFNDFNKNVHKDVIIITTIDSLTSILAGCIIFGILGNLAFETNTKDISQVVKGGAGLAFISYPEAIAKFKYLPQLFAVLFFFMLLVLGIGSNIGMASAVVNVVKDRFTHL--PHWLLAVSA---SIIGFLCGLVYMTPGGQFVLNLVDFYGCTFIALVLAIAELLAVGWIYGVKRICSDIEFMLNVKTSFYWRICWAIVAPGLMFLVLVYMLFSYEPLTYRGVQYPPVYYMAGWIIWGLGVLQLPFWALVTIY-------QQPGKTFGSKFGLAMQPTANWGPLQTQKFEAYIIHRKR-EADFKSPR 606          
BLAST of slc6a-23 vs. Ensembl Fly
Match: CG8850 (gene:FBgn0033708 transcript:FBtr0087972)

HSP 1 Score: 303.523 bits (776), Expect = 6.370e-93
Identity = 199/593 (33.56%), Postives = 327/593 (55.14%), Query Frame = 2
Query:  374 EVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYP-GPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTK-IENIINSGSSLFFITFTEALSTLP-APQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKL---IEPPVYWGPYYKKNWLLGSFYRKKLLENYENPQ 2134
            E   +++  R +W   +EF+ SC+  +VGLGNVWRFP    E+GGGAFL+PY  + + +G P+  LE+ I QFS RG  +AF M PI+ GI +  V+       YY+ I+A +  YL AS + VLPW+ C  ++    C+A+ A  +  +S ++ VSS   +       F +   REP ++++   G P W L LCLL TW I G  L  G++ SGK  YF  L+PY  ++ L+I   TLPG+  GI+++L P W+++ +P V   A+ Q+FFS +I  G ++ Y+S+NDF+ N ++D II+  +D  TS++AG  +F ILG +A  T TK I  ++  G+ L FI++ EA++     PQ + +L   M + LG+ S   M   VV  + D +  L    +L AV+      + F+ GL+ ++PGG+F  +++D    +F   ++A++E + VG IYG K+   D + M     S YW I  A V+P ++F +L+    +++ +  R ++ P       ++   + +L +    + TIY       Q   K F  K    ++P   WGP   + +     +RK+   ++++P+
Sbjct:   48 EAESESSGQRDQWSRGVEFLFSCIALSVGLGNVWRFPFIALENGGGAFLIPYVIVLLLIGRPVYYLEVIIGQFSSRGCIRAFDMAPIMRGIAYGQVYSTALATTYYACIMALTIRYLVASFSEVLPWTYCLVEWG-KSCVATGATAANDSSIVQGVSSAELF-------FTQTVLREPESLDDNGLGTPSWDLVLCLLATWVIIGTILSKGIRSSGKASYFLALFPYVIMIVLLIRAVTLPGAWQGIVYFLKPQWSQLLNPHVWYAAITQMFFSLAICFGTLVMYASFNDFNKNVHKDVIIITTIDSLTSILAGCIIFGILGNLAFETNTKDISQVVKGGAGLAFISYPEAIAKFKYLPQLFAVLFFFMLLVLGIGSNIGMASAVVNVVKDRFTHL--PHWLLAVSA---SIIGFLCGLVYMTPGGQFVLNLVDFYGCTFIALVLAIAELLAVGWIYGVKRICSDIEFMLNVKTSFYWRICWAIVAPGLMFLVLVYMLFSYEPLTYRGVQYPPVYYMAGWIIWGLGVLQLPFWALVTIY-------QQPGKTFGSKFGLAMQPTANWGPLQTQKFEAYIIHRKR-EADFKSPR 619          
BLAST of slc6a-23 vs. Ensembl Fly
Match: DAT (gene:FBgn0034136 transcript:FBtr0087125)

HSP 1 Score: 303.523 bits (776), Expect = 8.170e-93
Identity = 192/562 (34.16%), Postives = 304/562 (54.09%), Query Frame = 2
Query:  344 SKSAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAF-KMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIE-----------------------------------YVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLA 1921
            SKS          +  +D R  W  +++F+LS +GFAV L NVWRFP   Y++GGGAFLVPY  + +  G+PL  +EL + Q + +G    + ++VP+  GIG+ +V +A  +  YY+ IIAWS  + FAS T+ LPW+ C++ +NT  C    +  ++    I                                    + S+ SEY++ Y+    +  S   +++    G  +W +ALCLL+ + I    L  G+  SGK+++FT L+PY  LL L+I G TLPGS  GI +YL P+++ IY  +V   A  Q+FFS     G ++ Y+SYN +H+N Y+D+++  F++  TS IAGF +F +LGYMA   G +IE++   G  L F+ +  A++T+PA  FW ++  +M +TLG+DS F   E ++TAL D +P ++ +R L    ++    L F+ GL   + GG ++F +LD+  + + + +    E I V  IYG  +F  D + M GF    YW +   FV+PI +  I +   I ++ +   D   P WA  L 
Sbjct:    8 SKSKTPTPHDNDNNSISDERETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFESQNASRVPVIGNYSDLYAMGNQSLLYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNR--SEGIHDL----GAIKWDMALCLLIVYLICYFSLWKGISTSGKVVWFTALFPYAVLLILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFVIFSVLGYMAHTLGVRIEDVATEGPGLVFVVYPAAIATMPASTFWALIFFMMLLTLGLDSSFGGSEAIITALSDEFPKIKRNRELFVAGLF---SLYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFPPGRYWQVCWRFVAPIFLLFITVYGLIGYEPLTYADYVYPSWANALG 560          
BLAST of slc6a-23 vs. Ensembl Fly
Match: DAT (gene:FBgn0034136 transcript:FBtr0330002)

HSP 1 Score: 303.908 bits (777), Expect = 8.869e-93
Identity = 192/562 (34.16%), Postives = 304/562 (54.09%), Query Frame = 2
Query:  344 SKSAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAF-KMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIE-----------------------------------YVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLA 1921
            SKS          +  +D R  W  +++F+LS +GFAV L NVWRFP   Y++GGGAFLVPY  + +  G+PL  +EL + Q + +G    + ++VP+  GIG+ +V +A  +  YY+ IIAWS  + FAS T+ LPW+ C++ +NT  C    +  ++    I                                    + S+ SEY++ Y+    +  S   +++    G  +W +ALCLL+ + I    L  G+  SGK+++FT L+PY  LL L+I G TLPGS  GI +YL P+++ IY  +V   A  Q+FFS     G ++ Y+SYN +H+N Y+D+++  F++  TS IAGF +F +LGYMA   G +IE++   G  L F+ +  A++T+PA  FW ++  +M +TLG+DS F   E ++TAL D +P ++ +R L    ++    L F+ GL   + GG ++F +LD+  + + + +    E I V  IYG  +F  D + M GF    YW +   FV+PI +  I +   I ++ +   D   P WA  L 
Sbjct:    8 SKSKTPTPHDNDNNSISDERETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFESQNASRVPVIGNYSDLYAMGNQSLLYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNR--SEGIHDL----GAIKWDMALCLLIVYLICYFSLWKGISTSGKVVWFTALFPYAVLLILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFVIFSVLGYMAHTLGVRIEDVATEGPGLVFVVYPAAIATMPASTFWALIFFMMLLTLGLDSSFGGSEAIITALSDEFPKIKRNRELFVAGLF---SLYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFPPGRYWQVCWRFVAPIFLLFITVYGLIGYEPLTYADYVYPSWANALG 560          
BLAST of slc6a-23 vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 351.673 bits (901), Expect = 3.026e-109
Identity = 213/586 (36.35%), Postives = 330/586 (56.31%), Query Frame = 2
Query:  401 RGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXX----XXXIEYVSSTSEYWDYYVTGFIKY-------------PSREPYNMN--------EYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLL--IVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKN 2077
            RG W N+++F+LS VG+AVGLGNVWRFP   +++GGGAFL+PY  +    G+P+ LLE+ + QF+ +GP   +K +P L G G  M+ +++ I IYY+ I+ W+ +YLFASL   LPW+ C +++NT +C              + +I  + +T+      V G +               PS E +  N        EYPG  +W LA CL L W I    L  G+K SGK++YFT  +PY  L+ L+I G TLPG+ +GI++++ P W K+ D KV + A  Q+FFS S A GG+IT SSYN FH+N YRD++IV   +  TS+ AGF +F ++G+MA      IE++ + G  + F+ + EAL+ LP   FW I+  LM +TLG+D+ FA  ET+VT++ D +P  +  R  K     + C   F+ G  +++  G +   ++D   +S+ L +IA+ E + +  IYG ++F  D +MM GF  + +W +  AFV+P I+  IL  S   +  +   D   P W+  L ++ ++  ++ +PI   I     K  L    L  +  +K +  P   WGP+  K+
Sbjct:  177 RGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLGLAGIPIFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPWATCKNEWNTVECKDKDMLLLDTCILRDRNITSIKNTTFCLSANVVGNLSKLLNVTVDNKTYVSPSEEYFKYNVLHISKGIEYPGDIRWPLAACLFLAWLIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGSGILYFITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFP--KYLRKHKPQFTLVCCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIGFQPNKFWRVCWAFVTPTILTFILALSLYQWKVMTYEDYTYPNWSMVLGWLMVICSVIWIPIMFAI-----KMHLAPGSLIER--LKLVCSPQPDWGPFLMKH 753          
BLAST of slc6a-23 vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 351.288 bits (900), Expect = 3.396e-109
Identity = 213/586 (36.35%), Postives = 330/586 (56.31%), Query Frame = 2
Query:  401 RGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXX----XXXIEYVSSTSEYWDYYVTGFIKY-------------PSREPYNMN--------EYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLL--IVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKN 2077
            RG W N+++F+LS VG+AVGLGNVWRFP   +++GGGAFL+PY  +    G+P+ LLE+ + QF+ +GP   +K +P L G G  M+ +++ I IYY+ I+ W+ +YLFASL   LPW+ C +++NT +C              + +I  + +T+      V G +               PS E +  N        EYPG  +W LA CL L W I    L  G+K SGK++YFT  +PY  L+ L+I G TLPG+ +GI++++ P W K+ D KV + A  Q+FFS S A GG+IT SSYN FH+N YRD++IV   +  TS+ AGF +F ++G+MA      IE++ + G  + F+ + EAL+ LP   FW I+  LM +TLG+D+ FA  ET+VT++ D +P  +  R  K     + C   F+ G  +++  G +   ++D   +S+ L +IA+ E + +  IYG ++F  D +MM GF  + +W +  AFV+P I+  IL  S   +  +   D   P W+  L ++ ++  ++ +PI   I     K  L    L  +  +K +  P   WGP+  K+
Sbjct:  177 RGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLGLAGIPIFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPWATCKNEWNTVECKDKDMLLLDTCILRDRNITSIKNTTFCLSANVVGNLSKLLNVTVDNKTYVSPSEEYFKYNVLHISKGIEYPGDIRWPLAACLFLAWLIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGSGILYFITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFP--KYLRKHKPQFTLVCCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIGFQPNKFWRVCWAFVTPTILTFILALSLYQWKVMTYEDYTYPNWSMVLGWLMVICSVIWIPIMFAI-----KMHLAPGSLIER--LKLVCSPQPDWGPFLMKH 753          
BLAST of slc6a-23 vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 351.288 bits (900), Expect = 3.462e-109
Identity = 213/586 (36.35%), Postives = 330/586 (56.31%), Query Frame = 2
Query:  401 RGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXX----XXXIEYVSSTSEYWDYYVTGFIKY-------------PSREPYNMN--------EYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLL--IVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKN 2077
            RG W N+++F+LS VG+AVGLGNVWRFP   +++GGGAFL+PY  +    G+P+ LLE+ + QF+ +GP   +K +P L G G  M+ +++ I IYY+ I+ W+ +YLFASL   LPW+ C +++NT +C              + +I  + +T+      V G +               PS E +  N        EYPG  +W LA CL L W I    L  G+K SGK++YFT  +PY  L+ L+I G TLPG+ +GI++++ P W K+ D KV + A  Q+FFS S A GG+IT SSYN FH+N YRD++IV   +  TS+ AGF +F ++G+MA      IE++ + G  + F+ + EAL+ LP   FW I+  LM +TLG+D+ FA  ET+VT++ D +P  +  R  K     + C   F+ G  +++  G +   ++D   +S+ L +IA+ E + +  IYG ++F  D +MM GF  + +W +  AFV+P I+  IL  S   +  +   D   P W+  L ++ ++  ++ +PI   I     K  L    L  +  +K +  P   WGP+  K+
Sbjct:  169 RGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLGLAGIPIFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPWATCKNEWNTVECKDKDMLLLDTCILRDRNITSIKNTTFCLSANVVGNLSKLLNVTVDNKTYVSPSEEYFKYNVLHISKGIEYPGDIRWPLAACLFLAWLIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGSGILYFITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFP--KYLRKHKPQFTLVCCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIGFQPNKFWRVCWAFVTPTILTFILALSLYQWKVMTYEDYTYPNWSMVLGWLMVICSVIWIPIMFAI-----KMHLAPGSLIER--LKLVCSPQPDWGPFLMKH 745          
BLAST of slc6a-23 vs. Ensembl Zebrafish
Match: slc6a14 (solute carrier family 6 member 14 [Source:ZFIN;Acc:ZDB-GENE-130411-2])

HSP 1 Score: 335.88 bits (860), Expect = 3.561e-105
Identity = 223/578 (38.58%), Postives = 326/578 (56.40%), Query Frame = 2
Query:  365 DEVEVI---DKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWN--KIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYP-FLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMA---FVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYK 2071
            D+ E +   D+ +D RG W ++ E++LS +G+AVGLGNVWRFP   Y+ GGGAFL+PYT +    G+PL  +E    QF  +GP   +K VPIL G+G  M+ V+  + IYY+ IIA+S +YLFAS    LPWS+   + NT     S A  +     I   S + +YWD       +   +   +M+E  GP  WHLALCLLL+W + G  L  G+K SGK++YFT  +PY  LL L+I G TL G+ +GI FY+    N  K+ + +V + A  Q+FFS SIA GG++  SSYN F++N Y+DSI+V   +  TS+ AGFA+F +LG+MA      +  + ++G +L FI + +ALS LP    W+IL   M ITLG+DSQFA  E + T L+D YP  L++ R L    V   C +LF+ GL  V+  G +W +++D   + + L +  L E + + ++YG  +F  D +MM G   SL+W    A   F++P+++  IL+ S   F       +  P W  +L +      L+ I I  V  + K +    Q      +K    P   WGPY +
Sbjct:   28 DKAEHVVQNDENSD-RGNWSSKREYMLSMIGYAVGLGNVWRFPYLAYKHGGGAFLIPYTIMLAVSGLPLFFMESSFGQFCSQGPINVWKAVPILQGVGITMMLVSTFVAIYYNVIIAYSIYYLFASFQDPLPWSI--KNCNTTASNISTAAVNVSCGQISGQSLSEKYWD-------EVALQRSSSMDE-TGPVVWHLALCLLLSWILVGAALFKGIKSSGKVVYFTATFPYIVLLILLIRGATLEGAKDGIEFYIGSQSNLTKLAEAEVWKDAATQIFFSLSIAWGGLMALSSYNKFYNNCYQDSIVVCVTNCGTSIFAGFAIFSVLGHMAHVYQRPVSEVADAGFALAFIAYPDALSKLPISPLWSILFFFMLITLGLDSQFAGIEVISTCLLDAYPEVLKSKRGLVTTAV---CIILFLLGLPCVTRAGIYWVNLIDTFSAGWILLVAGLLEVLGLCILYGGNRFIKDIEMMIGTKSSLFWLWWRACWFFITPVVLSIILIWSLYTFTSPTYSSVAYPDWGISLGWCITAFSLMWIPIVAVWKVCKARGGLWQR-----IKSACSPTEDWGPYLE 586          
BLAST of slc6a-23 vs. Ensembl Zebrafish
Match: slc6a7 (solute carrier family 6 member 7 [Source:ZFIN;Acc:ZDB-GENE-070112-1492])

HSP 1 Score: 304.294 bits (778), Expect = 8.956e-93
Identity = 208/560 (37.14%), Postives = 301/560 (53.75%), Query Frame = 2
Query:  401 RGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMA------GFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVR--DLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYW 2056
            R +W  + EF+LSC+G+ VGLGNVWRFP   Y +GGG FL+PY  +    G+PL L+EL + Q+   GP   +K  P+L GIG  M+ V+  + +YY+ IIAW+++YL +S  S LPWS C    N   C     +           S +  +W+  V G +             PGP +W LALCLL  W I  L ++ G+  SGK++Y T  +PYF LL LII G TL GS +G+ FYL P W+++ D +V   A  Q+F+S  I  GG+++ +SYN F +N  RD+II+   +  TS  AGFA+F ILG+MA + G  ++ + +SG  L F+ + EAL+ LP   FW+IL  LM   LG+D+ F   E + TA++D +P L+++   K + + +LCF  ++ GLLL++ GG +WF ++D   +SFGL +I L   I +   YG  QF  D   M          + LY+       +P ++  IL   FI   R  +R      PIW + L      +  L I I  +  I K          K   KK I P   W
Sbjct:   71 RDQWGGKYEFLLSCIGYCVGLGNVWRFPYLCYRNGGGVFLIPYFIMLFFTGMPLFLMELSLGQYGAAGPITVWKCCPLLKGIGIGMLCVSTLVCLYYNVIIAWTFYYLGSSFQSPLPWS-CDALQNIALCANKTNSTQ---------SPSEVFWNEKVLGVVHSTGLSD------PGPVRWPLALCLLAAWIIIFLCMLKGIHSSGKVVYVTATFPYFVLLVLIIRGATLEGSLDGVAFYLTPKWDQLADAQVWNDAASQIFYSLGIGVGGLLSMASYNKFDNNVIRDTIIITIGNCSTSFFAGFAIFSILGHMAFKKGVPVDKVADSGPGLAFVAYPEALALLPGSVFWSILFFLMLFMLGVDTLFGNMEGICTAVLDEFPQLRSNLKHKTLFLAVLCFSFYLMGLLLITDGGIYWFTLIDSFSTSFGLIIITLFMCIGISFFYGVNQFCQDIVDMICRCPPWCTKMLLYFKACWVVFTPFLLTFILTYIFIEMYRTSLRYGSYVYPIWGKALGVCMGALCCLQILIWAIVAISK-----ESGTLKDRFKKSIRPLNSW 609          
BLAST of slc6a-23 vs. Ensembl Xenopus
Match: lrrc4c (leucine rich repeat containing 4C [Source:Xenbase;Acc:XB-GENE-5772259])

HSP 1 Score: 352.058 bits (902), Expect = 5.688e-111
Identity = 222/580 (38.28%), Postives = 341/580 (58.79%), Query Frame = 2
Query:  350 SAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSST----SEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKN 2077
            S    D+ E+  +  + RG W  +++F+LSC+G+ VGLGNVWRFP R Y +GGGAFL+PY  +    G+PL  +EL + QFS  GP   +K+ P+  G+G  M+ +   + IYY+ IIA+  FYLFASLTS LPW  C + +NT+ CL     +++ ++ +  +S+T     EYW  YV        +    + + PG  +W L LCLLL+W+I  L ++ GVK SGK++YFT  +PY  L+ L+I G TL G+  GI FYL P +  +   KV   A  Q+F+S  +  GG++T++SYN FH N YRD+ IV   + FTS++AGFA+F +LGYM+Q  G  ++ +  +G  L F+ + +A++ LP   FW+ L   M +TLG+DSQFA  ET+VTA+ D +P+    +  KAV   I+C  LF+ GL+L + GG +W  +LD   + FGL +I ++  + V  +YG K F  D +MM GF   LY+     F+SP+ +  +L  S + +   +    + P+W+E L  +  L+  + I IG++  I K      +      +++   P + WGP  ++N
Sbjct:   16 SPSDRDDTELDIEYPEDRGNWSGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLIPYFIMLAICGIPLFFMELSLGQFSSLGPLAVWKISPLFKGVGMGMLLIVALVAIYYNMIIAYVLFYLFASLTSSLPWEHCGNWWNTDLCLDHHVIRASNSALLVNISNTVSPSEEYWSRYVLHI-----QGSSGIGD-PGQLRWKLCLCLLLSWTIVYLCILKGVKSSGKVVYFTATFPYIILVMLLIRGVTLEGAWIGIKFYLTPQFEHLLTSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAFTSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFMETIVTAITDEFPYYLRPK--KAVFSAIICVALFLLGLILATDGGMYWLVLLDDYSAGFGLLVIVITFGLSVSRVYGIKNFCRDIQMMLGFKPGLYFKACWIFLSPVTLMCLLAYSILKYQPSQYGSYKFPLWSEALGILMGLLSCMMIPIGMLVAILK-----EEGSLWERIRQASRPAMDWGPSMEEN 582          
BLAST of slc6a-23 vs. Ensembl Xenopus
Match: lrrc4c (leucine rich repeat containing 4C [Source:Xenbase;Acc:XB-GENE-5772259])

HSP 1 Score: 351.673 bits (901), Expect = 6.940e-111
Identity = 222/580 (38.28%), Postives = 341/580 (58.79%), Query Frame = 2
Query:  350 SAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSST----SEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKN 2077
            S    D+ E+  +  + RG W  +++F+LSC+G+ VGLGNVWRFP R Y +GGGAFL+PY  +    G+PL  +EL + QFS  GP   +K+ P+  G+G  M+ +   + IYY+ IIA+  FYLFASLTS LPW  C + +NT+ CL     +++ ++ +  +S+T     EYW  YV        +    + + PG  +W L LCLLL+W+I  L ++ GVK SGK++YFT  +PY  L+ L+I G TL G+  GI FYL P +  +   KV   A  Q+F+S  +  GG++T++SYN FH N YRD+ IV   + FTS++AGFA+F +LGYM+Q  G  ++ +  +G  L F+ + +A++ LP   FW+ L   M +TLG+DSQFA  ET+VTA+ D +P+    +  KAV   I+C  LF+ GL+L + GG +W  +LD   + FGL +I ++  + V  +YG K F  D +MM GF   LY+     F+SP+ +  +L  S + +   +    + P+W+E L  +  L+  + I IG++  I K      +      +++   P + WGP  ++N
Sbjct:   19 SPSDRDDTELDIEYPEDRGNWSGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLIPYFIMLAICGIPLFFMELSLGQFSSLGPLAVWKISPLFKGVGMGMLLIVALVAIYYNMIIAYVLFYLFASLTSSLPWEHCGNWWNTDLCLDHHVIRASNSALLVNISNTVSPSEEYWSRYVLHI-----QGSSGIGD-PGQLRWKLCLCLLLSWTIVYLCILKGVKSSGKVVYFTATFPYIILVMLLIRGVTLEGAWIGIKFYLTPQFEHLLTSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAFTSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFMETIVTAITDEFPYYLRPK--KAVFSAIICVALFLLGLILATDGGMYWLVLLDDYSAGFGLLVIVITFGLSVSRVYGIKNFCRDIQMMLGFKPGLYFKACWIFLSPVTLMCLLAYSILKYQPSQYGSYKFPLWSEALGILMGLLSCMMIPIGMLVAILK-----EEGSLWERIRQASRPAMDWGPSMEEN 585          
BLAST of slc6a-23 vs. Ensembl Xenopus
Match: lrrc4c (leucine rich repeat containing 4C [Source:Xenbase;Acc:XB-GENE-5772259])

HSP 1 Score: 351.673 bits (901), Expect = 1.295e-110
Identity = 222/580 (38.28%), Postives = 341/580 (58.79%), Query Frame = 2
Query:  350 SAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSST----SEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKN 2077
            S    D+ E+  +  + RG W  +++F+LSC+G+ VGLGNVWRFP R Y +GGGAFL+PY  +    G+PL  +EL + QFS  GP   +K+ P+  G+G  M+ +   + IYY+ IIA+  FYLFASLTS LPW  C + +NT+ CL     +++ ++ +  +S+T     EYW  YV        +    + + PG  +W L LCLLL+W+I  L ++ GVK SGK++YFT  +PY  L+ L+I G TL G+  GI FYL P +  +   KV   A  Q+F+S  +  GG++T++SYN FH N YRD+ IV   + FTS++AGFA+F +LGYM+Q  G  ++ +  +G  L F+ + +A++ LP   FW+ L   M +TLG+DSQFA  ET+VTA+ D +P+    +  KAV   I+C  LF+ GL+L + GG +W  +LD   + FGL +I ++  + V  +YG K F  D +MM GF   LY+     F+SP+ +  +L  S + +   +    + P+W+E L  +  L+  + I IG++  I K      +      +++   P + WGP  ++N
Sbjct:   19 SPSDRDDTELDIEYPEDRGNWSGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLIPYFIMLAICGIPLFFMELSLGQFSSLGPLAVWKISPLFKGVGMGMLLIVALVAIYYNMIIAYVLFYLFASLTSSLPWEHCGNWWNTDLCLDHHVIRASNSALLVNISNTVSPSEEYWSRYVLHI-----QGSSGIGD-PGQLRWKLCLCLLLSWTIVYLCILKGVKSSGKVVYFTATFPYIILVMLLIRGVTLEGAWIGIKFYLTPQFEHLLTSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAFTSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFMETIVTAITDEFPYYLRPK--KAVFSAIICVALFLLGLILATDGGMYWLVLLDDYSAGFGLLVIVITFGLSVSRVYGIKNFCRDIQMMLGFKPGLYFKACWIFLSPVTLMCLLAYSILKYQPSQYGSYKFPLWSEALGILMGLLSCMMIPIGMLVAILK-----EEGSLWERIRQASRPAMDWGPSMEEN 585          
BLAST of slc6a-23 vs. Ensembl Xenopus
Match: ENSXETT00000050020.1 (solute carrier family 6 member 14, gene 2 [Source:NCBI gene;Acc:100485126])

HSP 1 Score: 337.806 bits (865), Expect = 1.974e-105
Identity = 223/617 (36.14%), Postives = 346/617 (56.08%), Query Frame = 2
Query:  368 EVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYW----DYYVTGF------IKYPSRE----PYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLA--PDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAG---FSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSFYRKKLLENYENPQFLKYVSKIE 2161
             VE  D+  + RG W ++ E++LS VG+AVGLGNVWRFP   ++ GGGAFL+PY  +    G+PL  LE  + QFS  GP   +K++PI  G+G  MV ++  + IYY+ IIA+S +YLFAS TS+LPWS C  ++   KC  +      +    E +   +  W    +Y            + PS++     +N + Y G   W+LALCLLL W I G  L  G+K SGK++YFT ++PY  LL L+I G TL G+ +GI FY+    D +K+ +  V + A  Q+FFS S A GG++  SSYN FH+N Y D+I+V   +  TSV AGFA+F ILG+MA +   +++++++SG +L FI + EALS LP    W+IL   M +TLG+DSQFA  ET+ T + D YP  +  + ++ +     C + F+ G+L V+  G +W D++D   + +G+ + A+ E + +  IYG  +F  D +MM G   +   L+W +   F++P+++  I + S + FD  K  ++  P W   L +  ++  ++ I I  V  I K K    ++  K     +  P   WGP  +++       R K+ +N    +    ++ IE
Sbjct:   20 HVESTDENKE-RGNWSSKSEYLLSMVGYAVGLGNVWRFPYLTFQHGGGAFLIPYAIMLALAGLPLFFLECSLGQFSSLGPVAMWKVLPIFEGVGITMVLISTLVTIYYNVIIAYSLYYLFASFTSILPWSEC-FEWADEKCSKTPKGLCNVTIGEEDIGMVNLTWVKANNYTCIANSTLYLETELPSKQYWEKKWNNDIYTGNVVWYLALCLLLAWIIIGAALFKGIKSSGKVVYFTAIFPYAVLLILLIRGATLEGAYDGISFYIGTQSDISKLSNADVWKDAATQIFFSLSTAWGGLVALSSYNKFHNNCYADAIMVCITNCLTSVFAGFAIFSILGHMAFKAEKEVKDVVDSGFALAFIAYPEALSQLPVAPLWSILFFFMLLTLGLDSQFASVETITTTIHDAYP--KVMKKMRGIITVGACIMFFLLGILCVTQSGIYWVDLIDYFCAGWGILIAAILELVGICWIYGGNRFIEDIEMMIGKKHWIFWLWWRLCWFFLTPLLLTVIFIWSLVTFDTPKHGNVAYPSWGVALGWCMIIFCIIWIPILAVVKIIKAKGTLWEVRIK---DMICAPTPEWGPALEQH----RLGRYKITDNLHKTRNALEIATIE 625          
BLAST of slc6a-23 vs. Ensembl Xenopus
Match: lrrc4c (leucine rich repeat containing 4C [Source:Xenbase;Acc:XB-GENE-5772259])

HSP 1 Score: 337.035 bits (863), Expect = 3.716e-105
Identity = 222/597 (37.19%), Postives = 339/597 (56.78%), Query Frame = 2
Query:  311 CTGRFDKRNLRSKSAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSST----SEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIY----GFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKN 2077
            C       N + +S    D+ E+  +  + RG W  +++F+LSC+G+ VGLGNVWRFP R Y +GGGAFL+PY  +    G+PL  +EL + QFS  GP   +K+ P+  G+G  M+ +   + IYY+ IIA+  FYLFASLTS LPW  C + +NT+ CL     +++ ++ +  +S+T     EYW  YV        +    + + PG  +W L LCLLL+W+I  L ++ GVK SGK++YFT  +PY  L+ L+I G TL G+  GI FYL P +  +   KV   A  Q+F+S  +  GG++T++SYN FH N YRD+ IV   + FTS++AGFA+F +LGYM+Q  G  ++ +  +G  L F+ + +A++ LP   FW+ L   M +TLG+DSQFA  ET+VTA+ D +P+    +  KAV   I+C  LF+ GL+L + GG +W  +LD   + F    I L   +   L      G K F  D +MM GF   LY+     F+SP+ +  +L  S + +   +    + P+W+E L  +  L+  + I IG++  I K      +      +++   P + WGP  ++N
Sbjct:    4 CCDLTQGWNRKKESPSDRDDTELDIEYPEDRGNWSGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLIPYFIMLAICGIPLFFMELSLGQFSSLGPLAVWKISPLFKGVGMGMLLIVALVAIYYNMIIAYVLFYLFASLTSSLPWEHCGNWWNTDLCLDHHVIRASNSALLVNISNTVSPSEEYWSRYVLHI-----QGSSGIGD-PGQLRWKLCLCLLLSWTIVYLCILKGVKSSGKVVYFTATFPYIILVMLLIRGVTLEGAWIGIKFYLTPQFEHLLTSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAFTSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFMETIVTAITDEFPYYLRPK--KAVFSAIICVALFLLGLILATDGGMYWLVLLDDYSAGFDRKQIFLFNLLLNLLARFTPPGIKNFCRDIQMMLGFKPGLYFKACWIFLSPVTLMCLLAYSILKYQPSQYGSYKFPLWSEALGILMGLLSCMMIPIGMLVAILK-----EEGSLWERIRQASRPAMDWGPSMEEN 587          
BLAST of slc6a-23 vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 357.066 bits (915), Expect = 3.574e-111
Identity = 219/601 (36.44%), Postives = 337/601 (56.07%), Query Frame = 2
Query:  344 SKSAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEY--------------------VSSTSEYWDYYVTG---FIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKN 2077
            S +  T+ E E  D+    RG W ++++F+LS VG+AVGLGNVWRFP   +++GGGAFL+PY  +    G+P+  LE+ + QF+ +GP   +K +P L G G  M+ +++ I IYY+ II ++ FYLFAS  SVLPW  C++ +NT +C              ++                    V+ TS+    +V+G   + KY   +     EYPG  +W LA CL L W I    L  G+K SGK++YFT  +PY  L+ L+I G TLPG+  GI +++ P W K+ D  V + A  Q+FFS S A GG+IT SSYN FH+N YRD++IV   +  TS+ AGF +F ++G+MA      IEN+ + G  + F+ + EAL+ LP   FW I+  LM +TLG+D+ FA  ET+VT++ D +P  +  R  K V     C   FI G  +++ GG + F ++D   +S+ L +IA+ E + +  +YG ++F  D +MM GF  +++W +  AFV+P I+  IL  SF  ++ +       P W+  L ++ L   ++ I I  V  +Y    R+ +      +K +  P   WGP+  ++
Sbjct:  167 SVATTTIPEDEQGDEN-KARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFP--KYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIER-----LKLVCSPQPDWGPFLAQH 759          
BLAST of slc6a-23 vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 357.066 bits (915), Expect = 3.574e-111
Identity = 219/601 (36.44%), Postives = 337/601 (56.07%), Query Frame = 2
Query:  344 SKSAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEY--------------------VSSTSEYWDYYVTG---FIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKN 2077
            S +  T+ E E  D+    RG W ++++F+LS VG+AVGLGNVWRFP   +++GGGAFL+PY  +    G+P+  LE+ + QF+ +GP   +K +P L G G  M+ +++ I IYY+ II ++ FYLFAS  SVLPW  C++ +NT +C              ++                    V+ TS+    +V+G   + KY   +     EYPG  +W LA CL L W I    L  G+K SGK++YFT  +PY  L+ L+I G TLPG+  GI +++ P W K+ D  V + A  Q+FFS S A GG+IT SSYN FH+N YRD++IV   +  TS+ AGF +F ++G+MA      IEN+ + G  + F+ + EAL+ LP   FW I+  LM +TLG+D+ FA  ET+VT++ D +P  +  R  K V     C   FI G  +++ GG + F ++D   +S+ L +IA+ E + +  +YG ++F  D +MM GF  +++W +  AFV+P I+  IL  SF  ++ +       P W+  L ++ L   ++ I I  V  +Y    R+ +      +K +  P   WGP+  ++
Sbjct:  167 SVATTTIPEDEQGDEN-KARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFP--KYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIER-----LKLVCSPQPDWGPFLAQH 759          
BLAST of slc6a-23 vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 357.066 bits (915), Expect = 3.574e-111
Identity = 219/601 (36.44%), Postives = 337/601 (56.07%), Query Frame = 2
Query:  344 SKSAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEY--------------------VSSTSEYWDYYVTG---FIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKN 2077
            S +  T+ E E  D+    RG W ++++F+LS VG+AVGLGNVWRFP   +++GGGAFL+PY  +    G+P+  LE+ + QF+ +GP   +K +P L G G  M+ +++ I IYY+ II ++ FYLFAS  SVLPW  C++ +NT +C              ++                    V+ TS+    +V+G   + KY   +     EYPG  +W LA CL L W I    L  G+K SGK++YFT  +PY  L+ L+I G TLPG+  GI +++ P W K+ D  V + A  Q+FFS S A GG+IT SSYN FH+N YRD++IV   +  TS+ AGF +F ++G+MA      IEN+ + G  + F+ + EAL+ LP   FW I+  LM +TLG+D+ FA  ET+VT++ D +P  +  R  K V     C   FI G  +++ GG + F ++D   +S+ L +IA+ E + +  +YG ++F  D +MM GF  +++W +  AFV+P I+  IL  SF  ++ +       P W+  L ++ L   ++ I I  V  +Y    R+ +      +K +  P   WGP+  ++
Sbjct:  167 SVATTTIPEDEQGDEN-KARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFP--KYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIER-----LKLVCSPQPDWGPFLAQH 759          
BLAST of slc6a-23 vs. Ensembl Mouse
Match: Slc6a7 (solute carrier family 6 (neurotransmitter transporter, L-proline), member 7 [Source:MGI Symbol;Acc:MGI:2147363])

HSP 1 Score: 346.28 bits (887), Expect = 7.972e-109
Identity = 223/573 (38.92%), Postives = 329/573 (57.42%), Query Frame = 2
Query:  380 IDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSST----SEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIE---PPVYWGPYYKKN 2077
            +D   D RG W  +++F+LSC+G+ VGLGNVWRFP R Y +GGGAFLVPY  +    G+PL  LEL + QFS  GP   +K+ P+  G G  M+ +   + IYY+ IIA+  FYLFASLTS LPW  C + +NT  CL     KS        +SST     EYW  YV         +       PG  +W+L LCLLL W I  L ++ GVK SGK++YFT  +PY  LL L++ G TLPG+  GI FYL P ++ +   KV   A  Q+F+S  +  GG++T++SYN FH N YRD+ IV   +  TS++AGFA+F +LGYM+Q  G  ++ +  +G  L F+ + +A++ LP   FW+ L   M +TLG+DSQFA  ET+VTA+ D +P+    +  KAV   ++C  +++ GL+L + GG +W  +LD   +SFGL ++ ++  + V  +YG ++F  D  MM GF   LY+     F+SP  +  +L+ S + +   +      P WAE L  +  L+  L I  G++  + +        E  +  ++L +   P + WGP  ++N
Sbjct:   31 VDFAAD-RGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSNLPWEHCGNWWNTELCLEHRGPKSGNGVLPLNLSSTVSPSEEYWSRYVLHI------QGSQGIGRPGEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLRPK--KAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRACWLFLSPATLLALLVYSIVKYQPSEYGSYRFPAWAELLGILMGLLSCLMIPAGMLVAVLR--------EEGSLWERLQQASRPAMDWGPSLEEN 586          
BLAST of slc6a-23 vs. Ensembl Mouse
Match: Slc6a2 (solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2 [Source:MGI Symbol;Acc:MGI:1270850])

HSP 1 Score: 310.071 bits (793), Expect = 2.423e-95
Identity = 196/542 (36.16%), Postives = 288/542 (53.14%), Query Frame = 2
Query:  383 DKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGP-----PQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLL--IVLLPIAIGIVHTIYKF 1987
            D     R  W  +I+F+LS VGFAV L NVWRFP   Y++GGGAFL+PYT   I  G+PL  +EL + Q++  G    +K+ P   G+G+ ++ +A+ +  YY+ IIAWS +YLFAS T  LPW+ C H +N+  C       +        +   ++Y  Y  T   ++  R   +++E  G      PQW L LCL++   +    L  GVK SGK+++ T   PYF L  L++ G TLPG++NGI  YL  D+ ++ +  V   A  Q+FFS     G +I ++SYN F +N YRD+++   ++  TS I+GFA+F ILGYMA      IE++   G+ L FI + EA+STL    FW +L  LM + LG+DS     E V+T L D +  L+  R L    V       F+  L  ++ GG +   +LD   +   +    L E I V   YG  +F  D + M GF   LYW +   FVSP  +  +++ S INF  +   D   P WA  + +   L  ++L+P      + IYKF
Sbjct:   50 DSDAQPRETWGKKIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQYNREGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFASFTLNLPWTNCGHSWNSPNCTDPKLLNA------SVLGDHTKYSKYKFTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVIVVLYFSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFYRLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSTINCVTSFISGFAIFSILGYMAHEHKVNIEDVATEGAGLVFILYPEAISTLSGSTFWAVLFFLMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLFTCVV---TISTFLLALFCITKGGIYVLTLLDTFAAGTSILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFKPGLYWRLCWKFVSPAFLLFVVVVSIINFKPLTYDDYTYPPWANWVGWGIALSSMILVP-----AYVIYKF 577          
BLAST of slc6a-23 vs. UniProt/SwissProt
Match: sp|P58295|SC6A5_RAT (Sodium- and chloride-dependent glycine transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc6a5 PE=1 SV=2)

HSP 1 Score: 357.836 bits (917), Expect = 1.512e-110
Identity = 219/601 (36.44%), Postives = 337/601 (56.07%), Query Frame = 2
Query:  344 SKSAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEY--------------------VSSTSEYWDYYVTG---FIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKN 2077
            S +  T+ E E  D+    RG W ++++F+LS VG+AVGLGNVWRFP   +++GGGAFL+PY  +    G+P+  LE+ + QF+ +GP   +K +P L G G  M+ +++ I IYY+ II ++ FYLFAS  SVLPW  C++ +NT +C              ++                    V+ TS+    +V+G   + KY   +     EYPG  +W LA CL L W I    L  G+K SGK++YFT  +PY  L+ L+I G TLPG+  GI +++ P W K+ D  V + A  Q+FFS S A GG+IT SSYN FH+N YRD++IV   +  TS+ AGF +F ++G+MA      IEN+ + G  + F+ + EAL+ LP   FW I+  LM +TLG+D+ FA  ET+VT++ D +P  +  R  K V     C   FI G  +++ GG + F ++D   +S+ L +IA+ E + +  +YG ++F  D +MM GF  +++W +  AFV+P I+  IL  SF  ++ +       P W+  L ++ L   ++ I I  V  +Y    R+ +      +K +  P   WGP+  ++
Sbjct:  175 SVATTTIPEDEQGDEN-KARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFP--KYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIER-----LKLVCSPQPDWGPFLAQH 767          
BLAST of slc6a-23 vs. UniProt/SwissProt
Match: sp|Q9Y345|SC6A5_HUMAN (Sodium- and chloride-dependent glycine transporter 2 OS=Homo sapiens OX=9606 GN=SLC6A5 PE=1 SV=3)

HSP 1 Score: 357.451 bits (916), Expect = 1.856e-110
Identity = 217/594 (36.53%), Postives = 334/594 (56.23%), Query Frame = 2
Query:  365 DEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEY--------------------VSSTSEYWDYYVTG---FIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKN 2077
             E E  D+    RG W ++++F+LS VG+AVGLGNVWRFP   +++GGGAFL+PY  +    G+P+  LE+ + QF+ +GP   +K +P L G G  M+ +++ I IYY+ II ++ FYLFAS  SVLPW  C++ +NT +C              ++                    V+ TS+    +V+G   + KY   +     EYPG  +W LALCL L W I    L  G+K SGK++YFT  +PY  L+ L+I G TLPG+  GI +++ P W K+ D  V + A  Q+FFS S A GG+IT SSYN FH+N YRD++IV   +  TS+ AGF +F ++G+MA      IEN+ + G  + F+ + EAL+ LP   FW I+  LM +TLG+D+ FA  ET+VT++ D +P  +  R  K V     C   FI G  +++ GG + F ++D   +S+ L +IA+ E + +  +YG ++F  D +MM GF  +++W +  AFV+P I+  IL  SF  ++ +       P W+  L ++ L   ++ I I  V  ++    R+ +      +K +  P   WGP+  ++
Sbjct:  180 QEDEQGDEN-KARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFP--KYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMHLAPGRFIER-----LKLVCSPQPDWGPFLAQH 765          
BLAST of slc6a-23 vs. UniProt/SwissProt
Match: sp|Q761V0|SC6A5_MOUSE (Sodium- and chloride-dependent glycine transporter 2 OS=Mus musculus OX=10090 GN=Slc6a5 PE=1 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 2.427e-110
Identity = 219/601 (36.44%), Postives = 337/601 (56.07%), Query Frame = 2
Query:  344 SKSAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEY--------------------VSSTSEYWDYYVTG---FIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKN 2077
            S +  T+ E E  D+    RG W ++++F+LS VG+AVGLGNVWRFP   +++GGGAFL+PY  +    G+P+  LE+ + QF+ +GP   +K +P L G G  M+ +++ I IYY+ II ++ FYLFAS  SVLPW  C++ +NT +C              ++                    V+ TS+    +V+G   + KY   +     EYPG  +W LA CL L W I    L  G+K SGK++YFT  +PY  L+ L+I G TLPG+  GI +++ P W K+ D  V + A  Q+FFS S A GG+IT SSYN FH+N YRD++IV   +  TS+ AGF +F ++G+MA      IEN+ + G  + F+ + EAL+ LP   FW I+  LM +TLG+D+ FA  ET+VT++ D +P  +  R  K V     C   FI G  +++ GG + F ++D   +S+ L +IA+ E + +  +YG ++F  D +MM GF  +++W +  AFV+P I+  IL  SF  ++ +       P W+  L ++ L   ++ I I  V  +Y    R+ +      +K +  P   WGP+  ++
Sbjct:  175 SVATTTIPEDEQGDEN-KARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFP--KYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIER-----LKLVCSPQPDWGPFLAQH 767          
BLAST of slc6a-23 vs. UniProt/SwissProt
Match: sp|P28573|SC6A7_RAT (Sodium-dependent proline transporter OS=Rattus norvegicus OX=10116 GN=Slc6a7 PE=1 SV=2)

HSP 1 Score: 348.206 bits (892), Expect = 1.105e-108
Identity = 222/573 (38.74%), Postives = 330/573 (57.59%), Query Frame = 2
Query:  380 IDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSST----SEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIE---PPVYWGPYYKKN 2077
            +D   D RG W  +++F+LSC+G+ VGLGNVWRFP R Y +GGGAFLVPY  +    G+PL  LEL + QFS  GP   +K+ P+  G G  M+ +   + IYY+ IIA+  FYLFASLTS LPW  C + +NT +CL     K    +    +SST     EYW  YV         +       PG  +W+L LCLLL W I  L ++ GVK SGK++YFT  +PY  LL L++ G TLPG+  GI FYL P ++ +   KV   A  Q+F+S  +  GG++T++SYN FH N YRD+ IV   +  TS++AGFA+F +LGYM+Q  G  ++ +  +G  L F+ + +A++ LP   FW+ L   M +TLG+DSQFA  ET+VTA+ D +P+    +  KAV   ++C  +++ GL+L + GG +W  +LD   +SFGL ++ ++  + V  +YG ++F  D  MM GF   LY+     F+SP  +  +L+ S + +   +      P WAE L  +  L+  L I  G++  + +        E  +  ++L +   P + WGP  ++N
Sbjct:   31 VDFAAD-RGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSNLPWEHCGNWWNTERCLEHRGPKDGNGALPLNLSSTVSPSEEYWSRYVLHI------QGSQGIGRPGEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVIYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLRPK--KAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRACWLFLSPATLLALLVYSIVKYQPSEYGSYRFPAWAELLGILMGLLSCLMIPAGMLVAVLR--------EEGSLWERLQQASRPAIDWGPSLEEN 586          
BLAST of slc6a-23 vs. UniProt/SwissProt
Match: sp|Q6PGE7|SC6A7_MOUSE (Sodium-dependent proline transporter OS=Mus musculus OX=10090 GN=Slc6a7 PE=1 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 5.577e-108
Identity = 223/573 (38.92%), Postives = 329/573 (57.42%), Query Frame = 2
Query:  380 IDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSST----SEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIE---PPVYWGPYYKKN 2077
            +D   D RG W  +++F+LSC+G+ VGLGNVWRFP R Y +GGGAFLVPY  +    G+PL  LEL + QFS  GP   +K+ P+  G G  M+ +   + IYY+ IIA+  FYLFASLTS LPW  C + +NT  CL     KS        +SST     EYW  YV         +       PG  +W+L LCLLL W I  L ++ GVK SGK++YFT  +PY  LL L++ G TLPG+  GI FYL P ++ +   KV   A  Q+F+S  +  GG++T++SYN FH N YRD+ IV   +  TS++AGFA+F +LGYM+Q  G  ++ +  +G  L F+ + +A++ LP   FW+ L   M +TLG+DSQFA  ET+VTA+ D +P+    +  KAV   ++C  +++ GL+L + GG +W  +LD   +SFGL ++ ++  + V  +YG ++F  D  MM GF   LY+     F+SP  +  +L+ S + +   +      P WAE L  +  L+  L I  G++  + +        E  +  ++L +   P + WGP  ++N
Sbjct:   31 VDFAAD-RGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSNLPWEHCGNWWNTELCLEHRGPKSGNGVLPLNLSSTVSPSEEYWSRYVLHI------QGSQGIGRPGEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLRPK--KAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRACWLFLSPATLLALLVYSIVKYQPSEYGSYRFPAWAELLGILMGLLSCLMIPAGMLVAVLR--------EEGSLWERLQQASRPAMDWGPSLEEN 586          
BLAST of slc6a-23 vs. TrEMBL
Match: A0A0H3YK23 (Slc6a-23 OS=Schmidtea mediterranea OX=79327 GN=slc6a-23 PE=2 SV=1)

HSP 1 Score: 1239.94 bits (3207), Expect = 0.000e+0
Identity = 660/660 (100.00%), Postives = 660/660 (100.00%), Query Frame = 2
Query:  239 MHRVGTAEYKEYQGSECYVCCARLCTGRFDKRNLRSKSAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSFYRKKLLENYENPQFLKYVSKIEDVKGIVELAKTLNSQKSSN 2218
            MHRVGTAEYKEYQGSECYVCCARLCTGRFDKRNLRSKSAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPLLLLELGIAQFSGRGPTKAFKMVPILYGIGWCMVFVAISILIYYSAIIAWSYFYLFASLTSVLPWSVCSHDFNTNKCLASLANKSALNSSIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWILCFLLFISGLLLVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSFYRKKLLENYENPQFLKYVSKIEDVKGIVELAKTLNSQKSSN
Sbjct:    1 MHRVGTAEYKEYQGSECYVCCARLCTGRFDKRNLRSKSAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPLLLLELGIAQFSGRGPTKAFKMVPILYGIGWCMVFVAISILIYYSAIIAWSYFYLFASLTSVLPWSVCSHDFNTNKCLASLANKSALNSSIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWILCFLLFISGLLLVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSFYRKKLLENYENPQFLKYVSKIEDVKGIVELAKTLNSQKSSN 660          
BLAST of slc6a-23 vs. TrEMBL
Match: A0A0H3YEX6 (Slc6a-10 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc6a-10 PE=2 SV=1)

HSP 1 Score: 777.704 bits (2007), Expect = 0.000e+0
Identity = 401/640 (62.66%), Postives = 505/640 (78.91%), Query Frame = 2
Query:  287 CYVCCARLCTGRFDKRNLRSKSA--GTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSFYRKKLLENYENPQFLKYVSKIEDVKGIVELAKTLN 2200
            C +   RL   +F++++LRS SA     D +E+ D  T +RG+W+ R EF+LSC+GFAVGLGNVWRFPI+VYE+GGGAFL+ YT +CI LGVPLL+LELG+ QF+GRGPTKAFK+VPI+YGIGW MV +++ I IYY+ IIA SYFYLF SL  V+PW+VC+H+FN+ KCL S      LN S +YVSS+SEYWDYYVTGF+KYP R  Y +NE+PGPPQWHL LCLL TW   G  LM G+KVSGKI+YF+VLYPYFAL+ +  +  +LPG+ NGI FYL P+W K+YDP VLR A+EQLFFSCSIA GGMITY+SYNDF DNFYRD+II+I +DYFTSV+AG A+FP+LGY++QRTG KIE +I+SGSSLFFIT TEAL+T+P  Q WTILLM+MAI+LG+DSQ AMFETV T ++D  P LQ  +  K + VW LC L F+ GLLL++PGG++WFDILDKRVSSFGLP++A+ ETIC+GLIYGFKQ RYD++MM GFSLS YWFI++AFV P+ IF I L S IN D I V  + +P+W E +A  FL IVL PI  GI++TI  +  +Y +++ KAF+KKLIEPP+YWGP+YKK W+  S YRKKLL+  ++P FLKYVS++ED+  IV + +  N
Sbjct:   14 CAIIFDRLMISKFNEKSLRSLSALRSEEDYIEIHD-VTALRGRWNTRFEFLLSCIGFAVGLGNVWRFPIKVYENGGGAFLITYTIICIILGVPLLMLELGLGQFTGRGPTKAFKVVPIMYGIGWSMVMISLIIEIYYAPIIAISYFYLFGSLNKVMPWTVCNHEFNSKKCLGSFQENMDLNIS-DYVSSSSEYWDYYVTGFVKYPERTIYTLNEFPGPPQWHLTLCLLFTWITGGFALMNGIKVSGKIMYFSVLYPYFALISIFCVASSLPGAMNGIKFYLTPNWKKLYDPTVLRVAIEQLFFSCSIAMGGMITYASYNDFRDNFYRDAIIIIIIDYFTSVLAGLAIFPVLGYLSQRTGAKIEKVISSGSSLFFITLTEALATIPGSQLWTILLMVMAISLGLDSQIAMFETVSTGIMDAIPILQTKKEYKFMMVWALCSLFFLCGLLLITPGGKYWFDILDKRVSSFGLPILAILETICLGLIYGFKQLRYDYRMMTGFSLSWYWFIVIAFVGPLAIFVIFLTSLINVDYIYVNGIPIPMWGEVIALTFLFIVLFPIFYGIIYTIVTYFKKYPEIKGKAFLKKLIEPPIYWGPHYKKYWISSSKYRKKLLQYKDDPLFLKYVSEVEDINIIVSIVEKEN 651          
BLAST of slc6a-23 vs. TrEMBL
Match: A0A0H3YIU9 (Slc6a-11 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc6a-11 PE=2 SV=1)

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 356/634 (56.15%), Postives = 474/634 (74.76%), Query Frame = 2
Query:  275 QGSECYVCCARLCTGRFDKRNLRSKSAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSFYRKKLLENYENPQFLKYVSKIEDVKGI 2176
            + S C      L T  F    +   S  +L + +V    + IRG+W+NR EF+L+C+G  +G GNVWRFPI+VYE GGG+FL+ YT LC+ +GVPLL++E+GI QFSGRGP+K FK+VPI+YG+GW M+  A+ + +YY+AIIAW  +Y FAS   V+PW+VC+H FN+  CL +L NK+  N +I YVSST EYWDYYVTGFIKYPSR+PY MNE+PG P WHL+LCLL+TW + G+ +M GV+++GKI+YFTVL+PYF ++ LI LG +LPG+  G++FYL P W KI+D  VL  A+ QLFFS  +A+GG++TY+S+NDF DNFYRDS I+I  D+ TSV+AGFA+FPILGYMA+R+G KIE +I SGSSLFF++FTEALSTLP  QFWTIL MLMAITLGMD QFA+FETV T L+D YP LQ +R  KAV VWI+CF  F+ GLL+++PGG++WF IL+ RV +F LP I   ETI +G +YGFK+ RYDF+MM GF L  YWF+M++FV P IIF IL+   +  +R+KV  L +P+W E +  + ++I+++P   GI  TI  ++ +Y +L  K F+KKL +PP+YWGPYYK  W+   FYR KLL+  ++P+FL+YVS  ED+  I
Sbjct:   30 KKSRCSQIWYELTTSTFTNEPIGFASDASLIKRDVF---STIRGRWNNRAEFLLACIGSVIGFGNVWRFPIQVYECGGGSFLITYTILCLLMGVPLLVMEMGIGQFSGRGPSKVFKLVPIMYGLGWSMILTAMFVGMYYAAIIAWCLYYFFASFKKVMPWTVCTHVFNSPNCLGTLNNKTNPNITI-YVSSTVEYWDYYVTGFIKYPSRKPYLMNEWPGTPMWHLSLCLLITWVLTGMAIMKGVRITGKIMYFTVLFPYFCIIVLIGLGFSLPGAMKGLLFYLTPHWYKIFDFNVLFVAIGQLFFSSGMARGGLMTYASFNDFRDNFYRDSFIIILSDFTTSVLAGFAIFPILGYMAERSGVKIEKLITSGSSLFFVSFTEALSTLPGAQFWTILFMLMAITLGMDCQFALFETVTTGLMDVYPLLQLTRVFKAVVVWIMCFFYFLIGLLIITPGGKYWFVILNGRVMAFALPFILCVETIVIGHLYGFKKLRYDFRMMMGFYLGWYWFVMISFVCPFIIFCILIGGLLKSERVKVYGLLIPVWGEAIGIILIIILIMPTIFGIFETIIHYRKKYKKLHGKIFLKKLFDPPIYWGPYYKHEWMKSQFYRNKLLKYKDDPRFLRYVSAFEDIHYI 659          
BLAST of slc6a-23 vs. TrEMBL
Match: A0A0H3YF56 (Slc6a-17 OS=Schmidtea mediterranea OX=79327 GN=slc6a-17 PE=2 SV=1)

HSP 1 Score: 641.728 bits (1654), Expect = 0.000e+0
Identity = 318/629 (50.56%), Postives = 448/629 (71.22%), Query Frame = 2
Query:  308 LCTGRFDKRNLRSKSAGTLDEVEVID-KTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSFYRKKLLENYENPQFLKYVSKIEDVKGIVELAK 2191
            L   +F K  L  +     D+    + ++  +RGKW +R EF+LSC+GFAVGLGNVWRFPIR YESGGGAFL  Y  LC+ LG PLL +ELGI QFS R PT AFK+VPI YGIGW M+F++  + +YY+ +I+W++ YLF S   ++PW+VC+  FN+  C++S  +   +N +  Y++ST EYWDYYVTGF KYP R  + M+E PG PQWH+ L L+LTW + GL LMFGVKVS K++YFTV++PY  + CLI+LGC+LPG++ GI FYL PDW K+ DPKV+ G +EQL FS +IA GGM+TY+SYN+F +N Y+D+ I++F+D+ TS ++G +VF ILGYMA+++G  I  +I SG  LF+IT+T+A++TLP   FW  + MLMAI LG+DSQFA  E +   + D YPF++ ++  KA+ +W +  + F++G++L SPGG++WF ILD RVS++GL ++A  E I VG+IYGF+Q  YDF +M    + + W I++AF+ P IIF IL+ +   + ++ V  + +P+W E +AF+FL +VLLPI  G++HT+ K+K++Y QL  K F KKL   P YWGPY+ +NWL G +YR KLL   +NP FLKY +  E++   VE+ K
Sbjct:   13 LHLSKFGKSKLTPEGPHRTDDSSYSEGESVFLRGKWTSRKEFILSCIGFAVGLGNVWRFPIRCYESGGGAFLFLYVILCVILGAPLLFVELGIGQFSSRSPTTAFKLVPIFYGIGWSMIFISSIVEVYYAVVISWAFIYLFGSFHYIMPWTVCNQVFNSKNCISSGLSVRRMNLTSAYITSTEEYWDYYVTGFFKYPERTFHTMDESPGYPQWHVTLSLMLTWILTGLSLMFGVKVSSKVLYFTVIFPYVVMTCLIVLGCSLPGASTGIYFYLVPDWKKVVDPKVILGVIEQLLFSSNIAMGGMLTYASYNNFRENIYQDTFIIVFIDFITSFLSGISVFAILGYMAEKSGVPINKVITSGEGLFYITYTDAIATLPGCNFWNFMFMLMAIALGLDSQFAPLECISAGIGDVYPFMRKTKLRKALLIWSIIGVHFLAGIMLCSPGGKYWFVILDSRVSTYGLTVVAFLEIIIVGIIYGFRQLHYDFSVMMALPIDIIWMILIAFICPTIIFLILITNIFTYKKLSVAGVNIPLWGEIVAFLFLALVLLPILTGMIHTVIKYKIKYPQLRGKEFYKKLFTAPNYWGPYHLRNWLYGKYYRDKLLAFKDNPVFLKYRAGSENINHYVEIIK 641          
BLAST of slc6a-23 vs. TrEMBL
Match: A0A0H3YIZ3 (Slc6a-14 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc6a-14 PE=2 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 4.332e-131
Identity = 245/615 (39.84%), Postives = 362/615 (58.86%), Query Frame = 2
Query:  380 IDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYP-FLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRD-LEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSFYRKKLLENYENPQFLKYVSKIEDVKGIVELAKTLNSQKSSN 2218
            I K+   RGKW++ +E++LSCVG+ VGLGNVWRFP +VY+ GGG+FL+PY   CI  G P+L+LE  + QFS +G  +AF++ PI  G+G+ +V V   I   YS IIAW   Y  +S   +LPWSVC++ FNT  C        +  +S  Y SST E+W+ YV    +        + +  G P     LCL     +A + +MFGVKVSGK++Y TV+ PY  +   I+LGC+LPG+ NGI FYL P  +++ DP     A+EQL FS S+  GG++T SSYN F  N  R+  I++ VD+ TS+I+GFA FP+LGYM+ RTG  IE +I + SSLFF+ F E LSTL +   W+IL M MA TLG+DS F M E ++T++ D +P F Q +   K V   I+   LF+  L+  +PGG  W DILD+   +F LP++   E   + ++YG +QF++D  +M G +L +YW     F  P+I   ++    I   +I VR  ++ P W   L +   ++ L PI +  +  + +  +++  L     +K   +PP +WGP  K+ W+   FY KKL+   +N  FL  + K +++  ++ LA+    Q+ S 
Sbjct:   61 IYKSEIERGKWNSELEYLLSCVGYTVGLGNVWRFPGKVYQGGGGSFLLPYIFFCIVFGCPMLMLETALGQFSSKGIIEAFQICPIFSGLGYTIVIVVFLIATSYSVIIAWCVLYFVSSFNYILPWSVCTNKFNTPLCFGVSETNYSKYNS-SYRSSTFEFWNRYVLADERLDGTF-VKVTDSIGFPNVPSLLCLFAVLCLASIIIMFGVKVSGKVVYLTVILPYIVIFQFIVLGCSLPGALNGIKFYLYPRLSRLLDPHTYVLAMEQLMFSLSVGAGGLVTMSSYNKFQQNIQRNVFILMSVDFSTSLISGFATFPVLGYMSYRTGKDIEELIVADSSLFFLIFPEVLSTLTSSNAWSILFMFMAFTLGIDSLFVMLEVIITSISDLFPAFRQKNS--KIVLTLIVSSSLFLIALIYTTPGGLNWLDILDENCPNFILPVVIFLEVFMLIVVYGHRQFQHDIWLMNGENLGIYWISSYLFFIPLISI-VMWVEVIRQTKIVVRHGVDFPRWTYILNWFLNILFLSPIFVKAIKVVLQNIIKHPNLGIIQILKLCFKPPPFWGPRSKRFWIRSVFYSKKLIRYKDNKTFLNSLEKEDNIIKLIILARLKIDQELSK 670          
BLAST of slc6a-23 vs. Ensembl Cavefish
Match: slc6a14 (solute carrier family 6 member 14 [Source:NCBI gene;Acc:103047067])

HSP 1 Score: 319.701 bits (818), Expect = 8.574e-99
Identity = 233/616 (37.82%), Postives = 325/616 (52.76%), Query Frame = 2
Query:  329 KRNLRSKS--AGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCS--HDFNTNKCXXXXXXXXXXXXXI-----------------EYVSST------SEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWN--KIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYP-FLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMA---FVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKN 2077
            K  ++S+    GT DE          RG W ++ E++LS +G+AVGLGNVWRFP   Y+ GGGAFL+PY  +    G+PL  LE    QF  +GP   +K VPIL G+G  M+ V+  + IYY+ I+A+S +YLFAS    LPWS CS   D   N       N ++ N S+                 E + ST       +YWD           +   +M+E  GP  WHLALCLLL W + G  L  G+K SGK++YFT  +PY  LL L+I G TL G+ NGI +Y+    N  K+ + +V + A  Q+FFS SIA GG+   +SYN FH+N Y+DSIIV   +  TS+ AGFA+F ILG+MA   G  +  +  +G  L FI + +ALS LP    W+IL   M ITLG+DSQFA  E + T L D YP FL++ R L  V +   C +LF+ GL  V+  G +W +++D  V+ + L +  L E   +  IYG  +F  D +MM G   +++W    +   F++P ++  IL  S   F       +E P W   L +      L+ I I  V  I K      Q      +K    P   WGPY +++
Sbjct:   24 KNAVKSQDPHVGTEDE-------NAERGNWSSKREYMLSMIGYAVGLGNVWRFPYLAYKHGGGAFLIPYVIMLSIAGLPLFFLESSFGQFCSQGPINVWKAVPILQGVGITMMLVSTFVAIYYNVILAYSIYYLFASFQYPLPWSNCSGWSDMGCNINATEYCNTTSYNGSLVALNRSAGADGNQSCPEELIVSTPLQTISEQYWDVVAL-------QRTSSMDE-TGPVVWHLALCLLLGWIMIGAALFKGIKSSGKVVYFTATFPYAVLLILLIRGVTLEGARNGIEYYIGSQSNLTKLSEAEVWKDAATQIFFSLSIAWGGLTALASYNKFHNNCYKDSIIVCVTNCGTSIFAGFAIFSILGHMAHVYGKPVSEVAQAGFGLAFIAYPDALSKLPISPLWSILFFFMLITLGLDSQFAGIEVITTCLQDAYPKFLKSKRGLITVII---CVVLFLLGLPCVTGAGIYWVNLIDTFVAGWILLVAGLLEVFGLSCIYGGNRFIKDIEMMIGNKSAIFWIWWRSCWFFITPFVLLVILGWSVYTFTAPTYGTVEYPEWGIALGWCMTAFCLMWIPIVAVWRIAKASGGLWQR-----IKSTCVPTEDWGPYLERH 616          
BLAST of slc6a-23 vs. Ensembl Cavefish
Match: slc6a11b (solute carrier family 6 member 11 [Source:NCBI gene;Acc:103035223])

HSP 1 Score: 303.908 bits (777), Expect = 4.034e-93
Identity = 189/552 (34.24%), Postives = 301/552 (54.53%), Query Frame = 2
Query:  386 KTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMV-PILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSS-FGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDL-EVPIWAETLAFVFLLIVLLPIAIGIVHTIYK----FKLRYNQLETKA 2020
            K  + RG+W+N+IEFVLS  G  +GLGNVWRFP   Y++GGGAF VPY    +  G+P+  LE  + QF+  G    ++ V P+  GIG+    +   + +YY  I++W+ FYL    T+ LPW+ C H +NT  C+          ++    S   E+W+  V            +  E+ G  +W LALCLL+ W I    +  G K +GK++Y T  +PYF L+ L+I G TLPG+A+GI FYL PD +++ DP+V   A  Q+FFS +I  G +    SYN +++N YRD I++  ++  TS +AGFA+F +LG+MA      IE +  SG  L FI + +A++ +P    W     +M I LG+DSQF   E++VTA++D YP      + + + +  +  + ++ GL +++ GG + F + D   +S   L  +A+ E+IC+G +YG  +F  + + M G+    +       ++P I  GI L   I +  +K  ++   P W   + +   +  ++ I +GI+  I+K    F  R  +L T A
Sbjct:   34 KVVNERGQWNNKIEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFVPYVIFFVCCGIPVFFLETALGQFTSEGGITCWRKVCPLFEGIGYATQVIEAHLNVYYVVILSWAIFYLLNCFTTELPWANCGHYWNTENCVDFNNASIENLTNPYATSPVMEFWERRVLSI--------SDGIEHVGKLRWELALCLLVAWIICYFCIWKGPKSTGKVVYVTATFPYFMLVILLIRGITLPGAADGIKFYLYPDISRLSDPQVWVDAGTQIFFSYAICLGCLTALGSYNSYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMAYEQNVPIEAVAESGPGLAFIAYPKAVTMMPWAPLWAFFFFVMLIFLGLDSQFVCVESLVTAVVDMYPKTFRVGYRRELLILGMSVVSYLLGLTMLTEGGMYVFQLFDSYAASGMCLLFVAIFESICIGWVYGSDRFYMNIEDMIGYKPIFFIKWCWKILTPGICSGIFLFFLIKYKPLKYNNVYTYPDWGYGIGWTMAMSSMVCIPLGIIIQIWKTEGTFMERIKKLTTPA 577          
BLAST of slc6a-23 vs. Ensembl Cavefish
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:103034591])

HSP 1 Score: 303.138 bits (775), Expect = 1.763e-92
Identity = 210/598 (35.12%), Postives = 324/598 (54.18%), Query Frame = 2
Query:  341 RSKSAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCX----------------XXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKL---IEPPVYWGPYYKKN 2077
            R+   G +   +V       RG W N+IEFVL+ VG+AVGLGNVWRFP   Y +GGGAF+ PY  + +  G+PL  LEL   QF+  G    +K+ P+  G+G+ M+ V+  I IYY+ +I  +++Y F S+T++LPW+ C++ +NT  C                 A ++  + + +  +  S + EYW  YV       S    N  E   P    +  CL ++W +  L L+ GVK SGK++YFT  +PY  L  L I G TL G+ +GI +YL P W KI D KV   A  Q+F+S   A GG+IT +SYN FH+N +RDSII+   +  TSV AGF +F ILG+MA   G  +  + + G  L F+ + EAL+ LP    W++L   M I LG+ +QF + ET+VTA++D        R  K +  + +  + F+ G+ L +  G +W  ++D   +SF L +I+    IC+  +YG + +  D +MM GF   +++ I   F+SP+II  IL+ + I +  I   D   P W+  + F   L  ++ I    V+ ++K        E   F+++L   ++P   WGP  +++
Sbjct:   11 RADQNGAVPGEQVKKDENSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSQRLNASIANISAVVSGVTEVVNRTKRTSPSEEYWRNYVLNI----SDGIGNFGEVRLP----ILGCLAISWVVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLEGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISVTNCATSVYAGFVIFSILGFMAHHLGVDVSQVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRN-KTIITFGVAVVGFLLGVPLTTRAGIYWLLLMDNYAASFSLVIISCIMCICIMYVYGHRNYFKDVEMMLGFPPPIFFRICWRFISPLIISFILIFTVIQYKPITYNDYVYPRWSLVIGFCMALSSVICIP---VYALFKIATS----EGSTFLERLKYSLKPHPSWGPALQEH 592          
BLAST of slc6a-23 vs. Ensembl Cavefish
Match: slc6a4b (sodium-dependent serotonin transporter-like [Source:NCBI gene;Acc:103043957])

HSP 1 Score: 299.671 bits (766), Expect = 5.989e-92
Identity = 188/541 (34.75%), Postives = 294/541 (54.34%), Query Frame = 2
Query:  392 TDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMV-PILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYP----------GPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENII-NSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTI 1978
            TD R KW  +I+F+LS +GFAV LGNVWRFP   Y++GGGAFL+PY  + +  GVPL  +EL + QF   G    +K + PI  GIG+ +  +A+ +  YY+ IIAW+ FY ++S +S LPW+ C + +NT  C               Y    +  W    T + + P+ E Y  N             G  +W L LCL L ++I    L  GVK SGK+++ T   PY  L  L+I G TLPG+  G++FYL P W K+ +  V   A  Q+FFS     G ++  SSYN F +N YRD+I+   V+  TS ++GF +F +LGYMA++    +E++  N G SL FIT+ EA++ +    F+ I+  +M ITLG+DS F   E ++TA++D YP   + R  + + V  L  + F+  L  ++ GG +   +L++      +  +   E   V   YG  +F  D K M G++  L+W +    +SP  +  I+++S +N   + + D + P W+ T+ ++  +   + I I +V+ +
Sbjct:   23 TDARDKWSKKIDFLLSVIGFAVDLGNVWRFPYICYQNGGGAFLIPYVLMAVFGGVPLFYMELALGQFHRTGAISIWKHICPIFKGIGFAICIIALYVSFYYNTIIAWALFYFYSSFSSTLPWTSCDNAWNTENCT-------------NYFGKDNVTW----TNYSRSPAEEFYTRNVLELHESEGLGNVGIIRWQLMLCLFLIFTIVYFSLWKGVKTSGKVVWVTATLPYVVLFILLIRGATLPGAWRGVVFYLQPKWEKLKETSVWVDAAAQIFFSLGPGFGVLLALSSYNPFTNNCYRDAIVTSLVNCLTSFVSGFVIFTVLGYMAEQRHVNVEDVAKNKGPSLLFITYPEAIANMMGSTFFAIIFFVMMITLGLDSTFGGLEAIITAVMDEYPDFLSHR--RELFVLGLVVVCFLGSLSTLTKGGAYVVKLLEEFGVGSSIIAVVFLEATAVSWFYGINRFSNDIKSMLGYTPGLFWKVCWVAISPAFLAYIIISSLLNPSPLTLFDYKFPDWSITVGYIIGMSSFMWIPIYMVYKL 544          
BLAST of slc6a-23 vs. Ensembl Cavefish
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:103034591])

HSP 1 Score: 301.212 bits (770), Expect = 1.026e-91
Identity = 209/603 (34.66%), Postives = 325/603 (53.90%), Query Frame = 2
Query:  326 DKRNLRSKSAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCX----------------XXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKL---IEPPVYWGPYYKKN 2077
            +++       G +   +V       RG W N+IEFVL+ VG+AVGLGNVWRFP   Y +GGGAF+ PY  + +  G+PL  LEL   QF+  G    +K+ P+  G+G+ M+ V+  I IYY+ +I  +++Y F S+T++LPW+ C++ +NT  C                 A ++  + + +  +  S + EYW  YV       S    N  E   P    +  CL ++W +  L L+ GVK SGK++YFT  +PY  L  L I G TL G+ +GI +YL P W KI D KV   A  Q+F+S   A GG+IT +SYN FH+N +RDSII+   +  TSV AGF +F ILG+MA   G  +  + + G  L F+ + EAL+ LP    W++L   M I LG+ +QF + ET+VTA++D        R  K +  + +  + F+ G+ L +  G +W  ++D   +SF L +I+    IC+  +YG + +  D +MM GF   +++ I   F+SP+II  IL+ + I +  I   D   P W+  + F   L  ++ I    V+ ++K        E   F+++L   ++P   WGP  +++
Sbjct:    2 EEKQFSGILNGAVPGEQVKKDENSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSQRLNASIANISAVVSGVTEVVNRTKRTSPSEEYWRNYVLNI----SDGIGNFGEVRLP----ILGCLAISWVVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLEGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISVTNCATSVYAGFVIFSILGFMAHHLGVDVSQVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRN-KTIITFGVAVVGFLLGVPLTTRAGIYWLLLMDNYAASFSLVIISCIMCICIMYVYGHRNYFKDVEMMLGFPPPIFFRICWRFISPLIISFILIFTVIQYKPITYNDYVYPRWSLVIGFCMALSSVICIP---VYALFKIATS----EGSTFLERLKYSLKPHPSWGPALQEH 588          
BLAST of slc6a-23 vs. Ensembl Sea Lamprey
Match: slc6a1a (solute carrier family 6 member 1a [Source:ZFIN;Acc:ZDB-GENE-060519-23])

HSP 1 Score: 289.271 bits (739), Expect = 3.141e-89
Identity = 181/529 (34.22%), Postives = 290/529 (54.82%), Query Frame = 2
Query:  374 EVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFY-RDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILD-KRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPI 1954
            E   K   +RG W  R +F++SCVG+A+GLGNVWRFP    ++GGGAFL+PY    +  G+PL LLE  + Q++  G    +K+ P+  G+G   V ++  + IYY  II+W+ +YL+ S TS+LPW  C++ +NT+KC ++ +            S+  E+W+       +   +    ++E PG  +  LA+ L ++W +    +  GV  +GK++YF+  +PY  L  L   G TLPG+  GI+FY+ PD+ ++ D  V   A  Q+FFS  +  G ++   SYN FH+N Y RDSIIV  ++  TSV AGF +F I+G+M+  T   ++ +  SG  L F+ + +A++ LP    W+IL   M + LG+DSQF   E  VTAL D YP  Q  R  K + + ++C + +I GL  ++ GG + F + D    S   L  +   ETI +   YG  +F  +   M G  +  +W I   F +P+++ G+ + S +    + +     P+W + + +   L  +L I
Sbjct:    1 EAKKKELPVRGAWKGRFDFLMSCVGYAIGLGNVWRFPYLCGKNGGGAFLIPYFLTLVFAGIPLFLLETSLGQYTSVGGLGVWKLAPMFKGVGLASVVISFYLNIYYIVIISWAIYYLYNSFTSMLPWQDCNNPWNTDKCFSNYSILDTT----NLTSTVVEFWE-------RNMHQLSSGLDE-PGQVRGPLAITLAISWVMVYFCIWKGVAWTGKVVYFSATFPYVMLFVLFFRGITLPGAKEGILFYITPDFRRLTDSAVWLDAATQIFFSYGLGLGSLVALGSYNPFHNNVYNRDSIIVCCINSVTSVFAGFVIFSIVGFMSHITKKPVKELAASGPGLAFLAYPQAVTQLPISPLWSILFFSMLLMLGLDSQFCTVEGFVTALSDEYP--QYLRGHKEIFIAVICVISYIIGLANITQGGLYVFKMFDYYSASGMSLLFLVFFETIAISWCYGVDRFNDNICEMIGHKVHKWWNICWVFFTPLVVVGVFMFSVVEMTPLTLGSYTYPMWGQGMGWFMALSSMLLI 515          
BLAST of slc6a-23 vs. Ensembl Sea Lamprey
Match: slc6a4b (solute carrier family 6 member 4b [Source:ZFIN;Acc:ZDB-GENE-060314-2])

HSP 1 Score: 247.669 bits (631), Expect = 1.019e-73
Identity = 164/484 (33.88%), Postives = 260/484 (53.72%), Query Frame = 2
Query:  509 GAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMV-PILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMN----EYP------GPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENII-NSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAF 1924
            GAFL+PY  + +  G+PL  +EL + QF   G    ++ + PI  G+G+ +  +   +  YY+ IIAW+ +YL++S TS LPW+ C + +NT  C               Y  +T   W  +     + P+ E Y  N    +Y       G  +W L LCL L ++I    L  GVK SGK+++ T  +PY  L  L+I G TLPG+  G++FYL P+W K+   +V   A  Q+FFS     G ++  +SYN F++N YRD+++   V+ FTS ++GF +F +LGYMA+    ++E++  + G SL FIT+ EA++ +    FW IL  +M ITLG+DS F   E ++TA++D YP L + R  +   V  L  + F+  L  ++ GG +   +L++  S   +  I L E I V   YG K+F  D   M GFS   +W +    +SP+ +  I+++       +K+ D + P W+  L +
Sbjct:    1 GAFLIPYCLMAVFGGIPLFYMELALGQFHRNGAISIWRRICPIFKGVGFAICIINFYVAFYYNTIIAWALYYLYSSFTSTLPWTKCDNPWNTVNCT-------------SYFDTTGVAWGKHS----RSPAEEFYTRNVLEIQYSKGLGGVGGLRWQLLLCLFLIFTIVYFSLWKGVKTSGKVVWVTATFPYVVLFILLIRGATLPGAWRGVLFYLKPNWKKLLTTEVWVDAAAQIFFSLGPGFGVLLALASYNKFNNNCYRDALVTSSVNCFTSFMSGFVIFTVLGYMAEMRNVEVEDVAKDMGPSLLFITYPEAIANMMGSTFWAILFFMMMITLGLDSTFGGLEAIITAVMDEYPSLFSKR--REYFVLGLVTICFMGALSTLTYGGAYIVKLLEEFGSGCSIIGIVLLEAIAVSWFYGVKRFCADIHSMLGFSPGYFWRLCWVAISPLFLSFIVVSFLTGSKPLKLFDYDFPDWSMILGY 465          
BLAST of slc6a-23 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008631.1 (pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 gene:ENSPMAG00000007785.1 transcript:ENSPMAT00000008631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.904 bits (507), Expect = 2.358e-56
Identity = 164/486 (33.74%), Postives = 257/486 (52.88%), Query Frame = 2
Query:  509 GAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSV-LPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALS--ETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRD-LEVPIWAETLAFVFLLIVLLPI 1954
            GAFLVPY    + +G+PL  LE+ + Q + +G    +K+VP+  G+G   + V     +YY  ++AWS +YL  SLT+  LPW+ C   + T  C  +L    A +++ E  S+  +     V  + +   R    M++  G   W + LCLL  W +    +  G+K SGK++Y T   PY  LL L++ G  LPG+ +GI +YL PDW K+  P+V   A  Q+F+   +  G +    SYN FH+N YRDSII+  ++  TS  +GF VF  LG+MAQ  G  I ++  +G  L F+ +  A+S LP P  W  LL +M + LG+DS+FA  E  VT L D +P   + +  +     + C + F+  + +V+ GG + F + D   +S G+ ++ L   E I V  +YG  +F  D   M GF    + +   + VSP +  GI +   ++++R+      E P WAE L ++  L  +L I
Sbjct:    1 GAFLVPYGLTVVCVGIPLFFLEVALGQLTQQGTIGVWKIVPLFTGVGVASMVVVFLSDLYYIVVLAWSLYYLLHSLTTAQLPWTHCQGWWATAACSDTLGTSRAASNASEGASACQDTTSPAVEFWERNVLRVSSGMHDL-GSVNWEMLLCLLAVWLLVYFSVWKGIKFSGKVVYVTGSVPYVLLLVLLVQGVMLPGALDGITYYLQPDWAKLATPQVWVEASTQVFYCYGVGFGVLPALGSYNKFHNNCYRDSIILTIINSATSFFSGFVVFSFLGFMAQEQGVDISHVAETGPGLVFVVYPRAISLLPVPALWATLLFIMLLLLGVDSEFAGMEGFVTGLTDLFPSQLSGKRRREAFTGLCCLVSFLLSVTMVTQGGIYVFQLFDSYAAS-GISMLWLMGWECIAVAWVYGANRFMQDLTAMLGFRPHAWVWWCWSVVSPAVCLGIFVFHLVHYERLVYNGRYEYPGWAEALGWLLALSSMLCI 484          
BLAST of slc6a-23 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001684.1 (pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 gene:ENSPMAG00000001516.1 transcript:ENSPMAT00000001684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.252 bits (443), Expect = 4.180e-50
Identity = 109/253 (43.08%), Postives = 157/253 (62.06%), Query Frame = 2
Query:  401 RGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVC-------SHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWN 1138
            RG W ++ E++LS +G AVGLGN+WRFP   Y++GGGAFL+PY  +   +G+PL  LE  I QF+  GP   +K+VP+L G+GW MV  +  I +YY++IIA+  FYLFAS TS LPWS C        + F+ + C +SLA  +  + +    + + +YW+       KY  R   +M+E  G   WHLAL LLL+W +    L+ G+K SGK++YFT ++PY  L+ L+I G TLPG+  GI +Y+    N
Sbjct:    6 RGNWASKSEYMLSMIGNAVGLGNLWRFPYLAYKNGGGAFLIPYIIMLAFVGLPLFFLECSIGQFASLGPITIWKVVPLLKGLGWMMVITSSLIALYYNSIIAYGLFYLFASFTSELPWSSCKKWWGADENCFDRSVCNSSLAEGNCSSVNSSKQTPSEQYWN-------KYALRRSESMDE-TGDVVWHLALTLLLSWIVTCAALVKGIKSSGKVVYFTAIFPYVVLIILLIRGATLPGAILGIEYYIGRQSN 250          
BLAST of slc6a-23 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004857.1 (pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 gene:ENSPMAG00000004412.1 transcript:ENSPMAT00000004857.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.178 bits (448), Expect = 2.200e-49
Identity = 130/401 (32.42%), Postives = 200/401 (49.88%), Query Frame = 2
Query: 1019 KIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLI--ALSETICVGLIY-GFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEV-PIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSFYRKKLLENYENPQFLKYVSKIEDVKGIVELAKTLNSQK 2209
            +++YFT  +PY  L+ L I G TLPGS +GI++YL PDW+K+  P+V   A  Q+FFS +I  G +    SYN F++N YRD+ I+  V+  TS  AGF VF  LG+MA   G  I  +  SG  L FI + +A+S +P    W  L   M I LG+DSQF   E  VT + D +P      + + V V + CF  F+  + +V+ GG + F + D   +S G+ L+  A  E I V  +Y G  +F  +  +M G+    +     AFV+P +  GI L + +N+  +      V P W E L +   L  +L I +  ++ + + K   N LE      +++  PV+           G  + + +      PQ       I+DV+    +A T   +K
Sbjct:    1 QVVYFTATFPYLVLIILFINGMTLPGSYDGIMYYLKPDWSKLGQPQVWIDAGTQIFFSYAIGLGALSALGSYNRFNNNCYRDTFILALVNSGTSFFAGFVVFSTLGFMAAEQGVDISQVAESGPGLAFIAYPKAVSLMPMAPLWAALFFFMLILLGLDSQFVGVEGFVTGISDLFPAALTGGYRREVFVGVCCFTSFLIAISMVTEGGMYVFQLFDYYSAS-GMTLLWQAGWECIVVAWVYAGGDRFMDNIALMIGYRPFPWMRWCWAFVTPCVCTGIFLFNLLNYKPLTYNKGYVYPWWGEALGWCMALSSMLCIPVVAIYRLARTK--GNLLER----WRILTTPVW-----------GCHHMEYMSPTEPAPQ------SIQDVETTPPIALTPTDEK 377          
BLAST of slc6a-23 vs. Ensembl Nematostella
Match: EDO39707 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977])

HSP 1 Score: 322.013 bits (824), Expect = 1.887e-100
Identity = 199/562 (35.41%), Postives = 318/562 (56.58%), Query Frame = 2
Query:  329 KRNLRSKSAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMV-PILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXX---------XXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYK 1984
            K+ L   ++ + D  ++  +    R KW ++ EF+LS +G+ VG GNVWRFP   Y++GG  FL+PY  + I  G+PL  LEL I Q+   G    +K + P+L GIG+ +  ++    IYY  I+AW+++YLF S  +V+PW  C + +NT  C A  +              N + +  S + E+W   V    +       +++++ G  +W L    +L+W +    L  G+K SGK++YFT  +P+  L  L+I G TL GS +G+I+YL PDW ++ DP+V   A  Q+++S  +  G +IT+ SYN F++N ++D++++   +  TS  AGF VF +LG+MA    T +  +  SG  L F+ + EA+S +P    W +L   M ITLG+DSQFA  E V+TA++D YP+++ +++ K V V ILC  L I GL  V  GG + F+++D +V+   L ++AL E I +G IYG  +F  D + M G     ++ I   +VSP+    I+LA+ I +  +K      P WAE + ++ +L  +L I    +H IYK
Sbjct:   15 KKPLFGSTSSSEDSPQIDVEEEQTRDKWSSKAEFMLSSLGYCVGFGNVWRFPYLCYKNGGATFLIPYFIMLIVNGIPLFFLELAIGQWFSSGVIGVWKSICPLLKGIGYAICMISYLCCIYYIVILAWTFYYLFMSFQAVVPWKTCDNPWNTKFCRAKRSGDLLLNCTELDLPQNCTAKPTSPSGEFWSNNVLEMTE-------DISDF-GDMRWPLFGTFILSWIVVYFCLFKGIKSSGKVVYFTATFPFIVLFILMIRGATLEGSLDGVIYYLNPDWERLADPQVWIYAATQIYWSLGVGFGALITFGSYNKFNNNVHKDALVISIANCSTSFFAGFVVFSVLGFMALTLDTTVAKVATSGPGLAFVAYPEAISQMPVSTLWAVLFFFMLITLGLDSQFATIEAVITAIVDEYPWVRGTKWRKPVFVLILCISLCILGLPCVFQGGMWIFNLMDYQVAGLSLLIVALLEIITIGWIYGVDRFSDDVEYMTGRRPMRWFRICWKYVSPLCTLAIILANLIQWKGVKYNGKPYPGWAELIGWMLMLSSVLMIPAFAIHEIYK 568          
BLAST of slc6a-23 vs. Ensembl Nematostella
Match: EDO40151 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S7X6])

HSP 1 Score: 310.071 bits (793), Expect = 2.188e-96
Identity = 190/541 (35.12%), Postives = 301/541 (55.64%), Query Frame = 2
Query:  389 TTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAF-KMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPF-LQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQ 2005
            T + R +WD +IEF+ +C+GFAVG GN WRFP   +++GGGAFL+PY       G+PL  +EL + Q    GP KA+ K+ P+  GIG+  + ++  + IYY+ I+AWS ++L+ S  + +PW  C H +NT  C    A+ +A       VSS+ E        F+     E     E PG    HL LCLL+ W +    +  G++ +GK++Y T   PY  L+   I G TLPG+ +G+++++ P W+++ DPKV   A  Q+ +S +I  G +I ++SYN   +N + D++++  ++  TSV AGF +F I+GYMA      +  + + G  L FI +  A+S LP PQ W ++  LM I LG+DSQF   E V  ALI+ +P  L   R L  + +   CF++F+ GL  VS GG F F++ D       L  +   E + +G IYG +++  +   M G  +  +W I   ++SPI++ GI + S   + RI   ++  P WAE + ++  L  +L I + + + IYK +  + Q
Sbjct:   19 TVESRERWDRKIEFLFACIGFAVGYGNFWRFPYMCFKNGGGAFLIPYVLFLCLGGIPLFFMELSLGQLLQEGPIKAWQKICPLFSGIGFASIVISFIVSIYYNVILAWSLYFLYNSFFADIPWVGCHHSWNTPDCYVYNASANASG-----VSSSRE--------FLVKNVLEITKSIEEPGGLSVHLTLCLLVAWILVYFSIWRGIRTTGKVVYVTATLPYIILVIFFIKGVTLPGAIDGVLYFITPQWDRLQDPKVWIDAASQILYSLTIGFGVLIGFASYNPRKNNVFSDALLISVINCATSVFAGFVIFAIVGYMAHVQEKSVPEVASQGPGLVFIVYPAAISQLPFPQIWAVIFFLMLIALGLDSQFGQVEVVAAALIEQWPRQLHKHRELVVLVI---CFVMFLLGLSCVSKGGMFVFNLFDSFSCGLSLLFVVCFELLVIGWIYGARRYADNISQMIGRPVLQWWVICWKYISPIMVLGIFVFSLAKYKRITYENVPYPAWAEGVGWLLALSSMLCIPVTMCYKIYKAEGTFLQ 543          
BLAST of slc6a-23 vs. Ensembl Nematostella
Match: EDO39708 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S978])

HSP 1 Score: 306.99 bits (785), Expect = 1.235e-95
Identity = 193/525 (36.76%), Postives = 305/525 (58.10%), Query Frame = 2
Query:  401 RGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMV-PILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMN---EYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFV--FLLIVLLPIA 1957
            R +W N+I+F+LSC+G+AVGLGNVWRFP   Y++GG +FL+PY    +  G+P+  LE+ + Q++ +G   A+ +V PI+ GIG+ M  +     +YY+ I+AWS++Y+F +  +V+PW+ C++++NT  C  + A           +S T                R+   ++     PG  ++ LA+CLLL W +    +  G+K +GK++YFT  +PY  L  L+I G TLPG+ANG +FY+ PD+ K+ DP+V   A  Q+FFS S+  GG+ITY SYN F++N  RD++IV  ++  TSV AGF +F ++G+MA   G ++E+++ SG  L FI + + +  +P   FW  L   M   LG+DSQF   ETV T L D Y   + +R  KA    + C + +I G+  V+ GG + F + D +     L LIAL E I +G  YG ++F  + + M G   ++Y+ +   ++SP+II  I + + +++  I   D   P WAE   ++  F  IV +PI 
Sbjct:    4 REQWSNKIDFLLSCIGYAVGLGNVWRFPYLCYKNGGASFLIPYLVCLVFCGIPIFYLEVALGQYTAQGVVNAWAVVSPIMTGIGFAMTVITFLCSVYYNVIMAWSFYYMFDAWRAVVPWNDCNNEWNTQFCSCTHAMNIPSFHENTIISVT-------------LSRRKVLQLSGDVGKPGEVRFELAMCLLLAWIVVYFCVWKGIKSAGKVVYFTATFPYLVLFILLIRGATLPGAANGALFYVKPDFTKLGDPRVWVDAAGQIFFSLSVGFGGLITYGSYNKFNNNCQRDTLIVSVINCLTSVFAGFVIFTMMGFMAHELGVEVEDVVKSGPGLAFIAYPQGIKKIPGSPFWAFLFFFMLFNLGLDSQFVGVETVTTVLSDSY---KGARRYKAHLTLLFCVVSYILGISNVTQGGVYIFTMFDYQGGGISLILIALLEVIAIGWFYGVERFARNIESMIGHRPNIYFLLCWKYISPLIIGVIFIWNCVDWSGISYGDYVFPAWAEFCGWLLCFSSIVCVPIC 512          
BLAST of slc6a-23 vs. Ensembl Nematostella
Match: EDO49218 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4])

HSP 1 Score: 308.531 bits (789), Expect = 1.503e-95
Identity = 202/561 (36.01%), Postives = 312/561 (55.61%), Query Frame = 2
Query:  314 TGRFDKRNLRSKSAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMV-PILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNT-NKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFK 1990
             G  D   L S     +D VE+I +    R KW  ++EF L+CVG+AVGLGNVWRFP   +++GGGAFL+PY  + +  G+PL  +EL + QF   GP  ++  + PI  G+G+ M+ V+    +YY+ IIAW  +YLF S    +PW  C + +NT   C ++L + +      EY S + E+++ YV        R   +++ + G  +W L +CL+L W +    L  G+K SGK++YFT  +PY  L+ L+I G TLPG+  G+ FYL P+++K+ D  V   A  Q+F+S  I  G +I   SYN FH+N +RD++ V  ++  TSV AG  +F +LG+MA+  G ++  +  SG  L F+ + E ++ +P   FW+I    M +TLG+D+QFAMFE V T L D Y  L  +R  K +    LCF  F+ GL +VS  G F  ++   +     L  +A  E I V   YG  +F  D + M G  +  +W I   +++P +I GI + S + +  +   D + P WAE + +V  L  +L I    ++ + + K
Sbjct:   13 NGDADGEGLTSDENCKID-VEIIGEE---REKWGRKVEFFLACVGYAVGLGNVWRFPYLCFKNGGGAFLIPYLCMLLICGMPLFFMELSLGQFVSLGPVTSWAAICPISKGVGFAMLVVSFLCCVYYNVIIAWCLYYLFESFAKDVPWKTCDNWWNTATNCTSNLTDTALK----EYSSPSKEFYENYVL-------RITPDIDTF-GVMRWQLVVCLILAWVLVYFCLWKGIKSSGKVVYFTATFPYLVLVILLIRGLTLPGAMKGLSFYLKPNFSKLGDAIVWVDAATQIFYSLGIGFGSLIAMGSYNKFHNNCFRDAMTVSVINCSTSVFAGLVIFSVLGFMAEVLGKEVSEVATSGPGLAFVVYPEGIAQMPISPFWSICFFFMLLTLGLDTQFAMFEAVTTGLGDEYVRLLRNR--KELFTAFLCFCCFLLGLPIVSQSGAFIMNLYVWQAGGVSLVFLAFFEVIVVAWGYGADRFALDIETMTGNKVWPWWPIAWKYITPAVITGIFIFSLVQWQGVSYDDYQYPPWAEFVGWVMALSSMLWIPGVAIYKMSRAK 555          
BLAST of slc6a-23 vs. Ensembl Nematostella
Match: EDO32356 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7SVA2])

HSP 1 Score: 304.294 bits (778), Expect = 4.983e-94
Identity = 189/537 (35.20%), Postives = 296/537 (55.12%), Query Frame = 2
Query:  374 EVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGF-IKYPSREPYNMNEYPGPPQ-----WHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDK-RVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVR-DLEVPIWAETLAFVFLL--IVLLPI 1954
            EV+++ T     W  +++F+L+ +GF+VGLGN+WRFP   Y++GGG FL+PY    +  GVPLL+LE+ + QF  +G   A+K+ P+  GIG+  V +   + IYY  I+ W+++Y+F S  +VLPWS C +D+NT KC             I   +S S+    ++  F   +     Y +N   G  Q     W +ALCLL  W +  L +  GVK +G+++YFT  +PY  L  + +   TLPG+  GI FYL PDW+++ D  V   A  Q+FFS SI  G +I   SYN F +N YRD II   V+  TS   GF +F +LG+MA++ G  I+ +  SG  L FI +  A++ +P    W+IL   M I LG+DS+F   E  VTA++D +P      + K + +       F  GL++V+ GG + F + D    S   L  I+L E+I +G +YG ++F  +   M GF ++ Y  +   F +PI    + + S +N++ +      + P+W + + ++  L  IV +P+
Sbjct:    5 EVVERET-----WVGKLDFILALIGFSVGLGNIWRFPYLCYKNGGGCFLIPYLICLLLAGVPLLILEVCLGQFMSQGGITAWKICPLFQGIGYASVVIVQYLNIYYIVILGWAFYYMFHSFQAVLPWSHCDNDWNTEKCHVGRKM-------ITTFNSGSKCCQLFIKSFKCLWKDAADYVLNISGGLDQIGTINWQMALCLLFAWIVCYLCVFKGVKSTGRVVYFTATFPYVLLTIICVRAVTLPGAREGIRFYLEPDWSRLQDGSVWLQAATQVFFSYSIGLGTLIALGSYNKFKNNCYRDCIIFACVNSGTSFYGGFVIFSVLGFMAEKQGVPIQEVAESGPGLAFIAYPAAVAEMPISPLWSILFFFMVILLGLDSEFVGVEGFVTAIVDMFPGYLRRGYRKEIFIAACSTFWFFIGLVMVTEGGMYVFQLFDNYSASGICLLWISLFESIGIGWVYGAERFYQNMTDMIGFRINPYLKVCWIFCTPIFCLAVFIFSLVNYEPLTYNLTYKYPVWGDAIGWLLALSSIVCIPL 529          
BLAST of slc6a-23 vs. Ensembl Medaka
Match: slc6a5 (solute carrier family 6 member 5 [Source:NCBI gene;Acc:101158004])

HSP 1 Score: 349.747 bits (896), Expect = 1.062e-108
Identity = 216/603 (35.82%), Postives = 334/603 (55.39%), Query Frame = 2
Query:  401 RGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCX----------------XXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKY--PSREPYNMN--------EYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSFYRKKLLENYENP 2131
            RG W N+++F+LS VG+AVGLGNVWRFP   +++GGGAFL+PY  +    G+P+ LLE+ + QF+ +GP   +K +P L G G  M+ +++ I IYY+ I+ W+ +YLFASL   LPW+ C +++NT +C                 A     S    S   V + ++  +  +     Y  PS E +  N        EYPG  +W LA CL L W I    L  G+K SGK++YFT  +PY  L+ L+I G TLPG+ +GI++++ P W K+ D KV + A  Q+FFS S A GG+IT SSYN FH+N YRD++IV   +  TS+ AGF +F ++G+MA      IE + + G  + F+ + EAL+ LP   FW I+  LM +TLG+D+ FA  ET+VT++ D +P  +  R  K V   I C   FI G  +++  G +   ++D   +S+ L +IA+ E + +  +YG ++F  D +MM GF  + +W +  AFV+P I+ GIL  S   +  +   D   P W+  + ++ ++  ++ I I     ++  K+          +K +  P   WGP+  K       +R    +N  +P
Sbjct:  169 RGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIFLLEVSLGQFASQGPVSVWKCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGSLPWANCRNEWNTVECKDKDMLLLDSCILRDRNAISVKNSTFCLSANAVGNLTKLLNVSIDANKTYVSPSEEYFKYNVLHISKGIEYPGDIRWPLAGCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLIILLIRGVTLPGAGDGILYFITPKWEKLSDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIEKVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFP--KYLRKHKPVFTLICCASFFILGFPMITENGMYMLQLVDTFAASYSLVIIAIFELLGISYLYGLQRFCADIEMMIGFQPNRFWRLCWAFVTPTILTGILGLSLYQWKVMTYEDYTYPTWSMIMGWLMVICSVIWIPI-----MFLIKMYLAPGTIGERLKLVCSPQPDWGPFLMK-------HRGDRYKNMTDP 757          
BLAST of slc6a-23 vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 311.612 bits (797), Expect = 1.463e-95
Identity = 211/584 (36.13%), Postives = 319/584 (54.62%), Query Frame = 2
Query:  374 EVIDKTTDIR-GKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXI------------------EYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLL--IVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGP 2062
            E + K  ++R G W N+IEFVL+ VG+AVGLGNVWRFP   Y +GGGAF++PY  + +  G+PL  LEL   QF+ +G    +K+ P+  G+G+ M+ V+  I IYY+ +I  +++Y F S+T++LPW+ C++ +NT  C   + +   +N+S+                  +  S + EYW +YV       S +  N  E   P    +  CL ++W +  L L+ GVK SGK++YFT  +PY  L  L I G TL G+ NGI +YL P W K+ D KV   A  Q+F+S   A GG+IT +SYN FH+N +RDSII+   +  TSV AGF +F ILG+MA      +  + + G  L F+ + EAL+ LP    W++L   M I LG+ +QF + ET+VTA++D        R  K V    +  + F+ G+ L +  G +W  ++D   +SF L +I+    IC+  IYG + +  D +MM GF   L++ +   F+SP+II  IL+ + I +  I   D   P W+  + F   L  +V +P     V+ +YK   R      +  +K        WGP
Sbjct:   17 EPVKKDENLRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMLPYFIMLVFCGIPLFFLELSFGQFASQGCLGVWKISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSGYQINNSLANATTSLVAGVSEVVNRTKRTSPSEEYWKHYVLNI----SDDIGNFGEVRLP----ILGCLAVSWCVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGIKYYLTPQWQKVLDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISITNCATSVYAGFVIFSILGFMAHNLNVPVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRN-KTVVTLSVAVVGFLLGVPLTTQAGIYWLLLMDNYAASFSLVVISCIMCICIMYIYGHRNYFRDVEMMLGFPPPLFFKVCWRFISPLIISFILIFTVIQYKPITYNDYVYPGWSLAIGFAMALSSVVCIP-----VYALYKIS-RSPGATFRERLKAACRAHPKWGP 585          
BLAST of slc6a-23 vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 311.612 bits (797), Expect = 1.463e-95
Identity = 211/584 (36.13%), Postives = 319/584 (54.62%), Query Frame = 2
Query:  374 EVIDKTTDIR-GKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXI------------------EYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLL--IVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGP 2062
            E + K  ++R G W N+IEFVL+ VG+AVGLGNVWRFP   Y +GGGAF++PY  + +  G+PL  LEL   QF+ +G    +K+ P+  G+G+ M+ V+  I IYY+ +I  +++Y F S+T++LPW+ C++ +NT  C   + +   +N+S+                  +  S + EYW +YV       S +  N  E   P    +  CL ++W +  L L+ GVK SGK++YFT  +PY  L  L I G TL G+ NGI +YL P W K+ D KV   A  Q+F+S   A GG+IT +SYN FH+N +RDSII+   +  TSV AGF +F ILG+MA      +  + + G  L F+ + EAL+ LP    W++L   M I LG+ +QF + ET+VTA++D        R  K V    +  + F+ G+ L +  G +W  ++D   +SF L +I+    IC+  IYG + +  D +MM GF   L++ +   F+SP+II  IL+ + I +  I   D   P W+  + F   L  +V +P     V+ +YK   R      +  +K        WGP
Sbjct:   17 EPVKKDENLRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMLPYFIMLVFCGIPLFFLELSFGQFASQGCLGVWKISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSGYQINNSLANATTSLVAGVSEVVNRTKRTSPSEEYWKHYVLNI----SDDIGNFGEVRLP----ILGCLAVSWCVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGIKYYLTPQWQKVLDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISITNCATSVYAGFVIFSILGFMAHNLNVPVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRN-KTVVTLSVAVVGFLLGVPLTTQAGIYWLLLMDNYAASFSLVVISCIMCICIMYIYGHRNYFRDVEMMLGFPPPLFFKVCWRFISPLIISFILIFTVIQYKPITYNDYVYPGWSLAIGFAMALSSVVCIP-----VYALYKIS-RSPGATFRERLKAACRAHPKWGP 585          
BLAST of slc6a-23 vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 311.227 bits (796), Expect = 1.739e-95
Identity = 211/584 (36.13%), Postives = 318/584 (54.45%), Query Frame = 2
Query:  374 EVIDKTTDIR-GKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKC------------------XXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLL--IVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGP 2062
            E + K  ++R G W N+IEFVL+ VG+AVGLGNVWRFP   Y +GGGAF++PY  + +  G+PL  LEL   QF+ +G    +K+ P+  G+G+ M+ V+  I IYY+ +I  +++Y F S+T++LPW+ C++ +NT  C                   + +A  S + +  +  S + EYW +YV       S +  N  E   P    +  CL ++W +  L L+ GVK SGK++YFT  +PY  L  L I G TL G+ NGI +YL P W K+ D KV   A  Q+F+S   A GG+IT +SYN FH+N +RDSII+   +  TSV AGF +F ILG+MA      +  + + G  L F+ + EAL+ LP    W++L   M I LG+ +QF + ET+VTA++D        R  K V    +  + F+ G+ L +  G +W  ++D   +SF L +I+    IC+  IYG + +  D +MM GF   L++ +   F+SP+II  IL+ + I +  I   D   P W+  + F   L  +V +P     V+ +YK   R      +  +K        WGP
Sbjct:   21 EPVKKDENLRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMLPYFIMLVFCGIPLFFLELSFGQFASQGCLGVWKISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSGYQINNSLANATTSLVAGVSEVVNRTKRTSPSEEYWKHYVLNI----SDDIGNFGEVRLP----ILGCLAVSWCVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGIKYYLTPQWQKVLDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISITNCATSVYAGFVIFSILGFMAHNLNVPVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRN-KTVVTLSVAVVGFLLGVPLTTQAGIYWLLLMDNYAASFSLVVISCIMCICIMYIYGHRNYFRDVEMMLGFPPPLFFKVCWRFISPLIISFILIFTVIQYKPITYNDYVYPGWSLAIGFAMALSSVVCIP-----VYALYKIS-RSPGATFRERLKAACRAHPKWGP 589          
BLAST of slc6a-23 vs. Ensembl Medaka
Match: slc6a14 (solute carrier family 6 member 14 [Source:NCBI gene;Acc:101166790])

HSP 1 Score: 304.294 bits (778), Expect = 2.913e-93
Identity = 222/620 (35.81%), Postives = 338/620 (54.52%), Query Frame = 2
Query:  356 GTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVC----------------SHD---FNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWN--KIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAG---FSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSFYRKKLLEN---YENPQ 2134
            G    V+  D+  + RG W N+ +++LS +G+AVGLGN+WRFP   Y++GGGAFL+PY  + + +G+PL  LE  + QF  +GP  A+K VPIL G+G   V V + + IYY+ II +S +Y+FAS+ S LPWS C                SH    F      +     ++ N S+   S + +YWD       +   +   +++E  GP  WHLALCLLL+  +    L+ G+K SGK++YFT  +PY  +L L++ G TL G+ +GI FY+    N  K+ + +V + A  Q F+S SI  GG++T SSYN+F +N ++D+  V   +  TSV+AGFA+F ILG+MA      +EN++  G  L FI + +ALS LP    W+IL  +M +T+G+DSQFA  E + T L+D +P    S+  +A+     C +L++ GL  V+  G +W  ++D+ V+++ L  + L E I V  IYG  +F  D +MM G   F+  L+W      +SP II  IL  S   F      +++ P W   L +  +  V++ I    V+ +   K R +  E    +K L  P   W PY   +   G  Y ++  +N   Y N Q
Sbjct:    4 GQDAHVDPGDENPE-RGNWANKSDYILSMIGYAVGLGNIWRFPYLAYKNGGGAFLIPYFTMLVVVGIPLFFLESALGQFCSQGPINAWKAVPILQGVGIAAVVVTLVVSIYYNVIICYSLYYMFASMQSPLPWSDCFSWADSSCSNISAGDSSHTNILFLEKLMHSGNNTCASSNMSVLVQSPSEQYWD-------RVALQRSSSLDE-TGPVVWHLALCLLLSSLLVAAALIRGIKSSGKVVYFTATFPYVVILILLVRGLTLEGARDGIEFYIGSQSNLTKLTEAEVWKDAATQTFYSLSIGWGGLVTLSSYNNFQNNVFKDTFAVTLTNAGTSVLAGFAIFSILGHMAHVYNIPVENVVKQGFGLAFIAYPDALSKLPISPLWSILFFVMLLTVGLDSQFAGIEVLTTCLVDAFPRYFKSK--RAIVTVATCSILYLLGLPCVTRAGIYWVTLIDQFVATWVLLFLVLLEIIGVAFIYGGNRFIKDIEMMLGKKSFAFWLWWRACWFCISPCIILVILGWSIATFSPPTYGEVQYPGWGLALGWAMVAFVVIWIPFVAVYNLT--KARGSPWER---LKSLCSPSEEWHPYLDIH--RGERYSEERCQNNKDYRNHQ 605          
BLAST of slc6a-23 vs. Planmine SMEST
Match: SMESG000054904.1 (SMESG000054904.1)

HSP 1 Score: 779.245 bits (2011), Expect = 0.000e+0
Identity = 402/641 (62.71%), Postives = 506/641 (78.94%), Query Frame = 2
Query:  287 CYVCCARLCTGRFDKRNLRSKSA--GTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSFYRKKLLENYENPQFLKYVSKIEDVKGIVELAKTLNS 2203
            C +   RL   +F++++LRS SA     D +E+ D  T +RG+W+ R EF+LSC+GFAVGLGNVWRFPI+VYE+GGGAFL+ YT +CI LGVPLL+LELG+ QF+GRGPTKAFK+VPI+YGIGW MV +++ I IYY+ IIA SYFYLF SL  V+PW+VC+H+FN+ KCL S      LN S +YVSS+SEYWDYYVTGF+KYP R  Y +NE+PGPPQWHL LCLL TW   G  LM G+KVSGKI+YF+VLYPYFAL+ +  +  +LPG+ NGI FYL P+W K+YDP VLR A+EQLFFSCSIA GGMITY+SYNDF DNFYRD+II+I +DYFTSV+AG A+FP+LGY++QRTG KIE +I+SGSSLFFIT TEAL+T+P  Q WTILLM+MAI+LG+DSQ AMFETV T ++D  P LQ  +  K + VW LC L F+ GLLL++PGG++WFDILDKRVSSFGLP++A+ ETIC+GLIYGFKQ RYD++MM GFSLS YWFI++AFV P+ IF I L S IN D I V  + +P+W E +A  FL IVL PI  GI++TI  +  +Y +++ KAF+KKLIEPP+YWGP+YKK W+  S YRKKLL+  ++P FLKYVS++ED+  IV + +  NS
Sbjct:   14 CAIIFDRLMISKFNEKSLRSLSALRSEEDYIEIHD-VTALRGRWNTRFEFLLSCIGFAVGLGNVWRFPIKVYENGGGAFLITYTIICIILGVPLLMLELGLGQFTGRGPTKAFKVVPIMYGIGWSMVMISLIIEIYYAPIIAISYFYLFGSLNKVMPWTVCNHEFNSKKCLGSFQENMDLNIS-DYVSSSSEYWDYYVTGFVKYPERTIYTLNEFPGPPQWHLTLCLLFTWITGGFALMNGIKVSGKIMYFSVLYPYFALISIFCVASSLPGAMNGIKFYLTPNWKKLYDPTVLRVAIEQLFFSCSIAMGGMITYASYNDFRDNFYRDAIIIIIIDYFTSVLAGLAIFPVLGYLSQRTGAKIEKVISSGSSLFFITLTEALATIPGSQLWTILLMVMAISLGLDSQIAMFETVSTGIMDAIPILQTKKEYKFMMVWALCSLFFLCGLLLITPGGKYWFDILDKRVSSFGLPILAILETICLGLIYGFKQLRYDYRMMTGFSLSWYWFIVIAFVGPLAIFVIFLTSLINVDYIYVNGIPIPMWGEVIALTFLFIVLFPIFYGIIYTIVTYFKKYPEIKGKAFLKKLIEPPIYWGPHYKKYWISSSKYRKKLLQYKDDPLFLKYVSEVEDINIIVSIVEKENS 652          
BLAST of slc6a-23 vs. Planmine SMEST
Match: SMESG000054935.1 (SMESG000054935.1)

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 353/632 (55.85%), Postives = 468/632 (74.05%), Query Frame = 2
Query:  275 QGSECYVCCARLCTGRFDKRNLRSKSAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSFYRKKLLENYENPQFLKYVSKIEDVK 2170
            + S C      L T  F    +   S  +L + +V    + IRG+W+NR EF+L+C+G  +G GNVWRFPI+VYE GGG+FL+ YT LC+ +GVPLL++E+GI QFSGRGP+K FK+VPI+YG+GW M+  ++ I IYY+ II+W  +Y FAS   V+PW+VC+H FN+  CL +L NK+  N +I YVSST EYWDYYVTGFIKYPSR+PY MNE PG P WHL+LCLL+TW + G+ +M GV+++GKI+YFTVL+PYF ++ LI LG +LPG+  G++FYL P W KI+D  VL  A+ QLFFS  +A GG++TY+S+NDF DNFYRDS I+I  D+ TSV+AGFAVFPILGYMA+R+G KIE +I SGSSLFF++FTEALSTLP  QFWTIL MLMAITLGMD QFA FETV T L+D YP LQ +R  KAV VWI+CF  F+ GL +++PGG++WF IL+ RV +F LP I   ETI +G +YGFK+ RYDF+MM GF L  YWF+M++FV P IIF IL+   +  +R+KV    +P+W E +  + ++I+++P   GI  TI+ ++ +Y +L  K F+KKL +PP+YWGPYYK  W+   FYR KLL+  ++P+FL+YVS  ED+ 
Sbjct:   31 KKSRCSQIWYELTTSTFTNEPIGFASDASLIKRDVF---STIRGRWNNRAEFLLACIGSVIGYGNVWRFPIQVYECGGGSFLITYTILCLLMGVPLLVMEMGIGQFSGRGPSKVFKLVPIMYGLGWSMILTSMFIGIYYAPIISWCLYYFFASFKKVMPWTVCTHVFNSLNCLGTLDNKTNPNITI-YVSSTVEYWDYYVTGFIKYPSRKPYLMNELPGTPMWHLSLCLLITWVLTGMAIMKGVRITGKIMYFTVLFPYFCIIVLIGLGFSLPGAMKGLLFYLTPHWYKIFDLNVLFVAIGQLFFSSGMATGGLMTYASFNDFRDNFYRDSFIIILSDFTTSVLAGFAVFPILGYMAERSGVKIEKLITSGSSLFFVSFTEALSTLPGAQFWTILFMLMAITLGMDCQFACFETVTTGLMDVYPLLQLTRVFKAVVVWIMCFFYFLIGLFIITPGGKYWFVILNGRVMAFTLPFILCVETIVIGHLYGFKKLRYDFRMMMGFYLGWYWFVMISFVCPFIIFCILIGGLLKSERVKVHKQLIPVWGEAIGIILIIILIMPTIFGIFETIFHYRKKYKKLHGKIFLKKLFDPPIYWGPYYKHEWMKSQFYRNKLLKYKDDPRFLRYVSAFEDIH 658          
BLAST of slc6a-23 vs. Planmine SMEST
Match: SMESG000054919.1 (SMESG000054919.1)

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 361/640 (56.41%), Postives = 472/640 (73.75%), Query Frame = 2
Query:  281 SECYVCCARLCTG------RFDKRNLRSKSAGTLDEVEVI--DKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSFYRKKLLENYENPQFLKYVSKIEDVKGI 2176
            S+C   C    TG      +       ++ AG      +I  DK + IRG+W+NR EF+L+C+G  +G GNVWRFPI+VYE GGG+FL+ YT LC+ +GVPLL++E+GI QFSGRGP+K FK+VPI+YG+GW M+  A+ + +YY+AIIAW  +Y FAS   V+PW+VC+H FN+  CL +L NK+  N +I YVSST EYWDYYVTGFIKYPSR+PY MNE+PG P WHL+LCLL+ W I GL +M GVK+SGKI+YFTVL+PYF L+ LI LG TLPG+  G++FYL P W KI+D  VL  A+ QL FS  +A GG++TY+S+NDF DNFYRDS I+I  D+ TSV+AGFA+FPILGYMA+R+G KIE +I SGSSLFF++FTEALSTLP  QFWTIL MLMAITLGMD QFA+FETV T L+D YP LQ +R  KAV VWI+CF  F+ GL +++PGG++WF IL+ RV +F LP I   ETI +G +YGFK+ RYDF+MM GF L  YWF+M++FV P IIF IL+   +  +R+KV  L +P+W E +  + ++I+++P   GI  TI  ++ +Y +L  K F+KKL +PP+YWGPYYK  W+   FYR KLL+  ++P+FL+YVS  ED+  I
Sbjct:   24 SKCENQCIVKKTGCSLIFYQLTTSTFTNEPAGFASNTSLINRDKLSTIRGRWNNRAEFLLACIGSVIGFGNVWRFPIQVYECGGGSFLITYTILCLLMGVPLLVMEMGIGQFSGRGPSKVFKLVPIMYGLGWSMILTAMFVGMYYAAIIAWCLYYFFASFKKVMPWTVCTHVFNSPNCLGTLNNKTNPNITI-YVSSTVEYWDYYVTGFIKYPSRKPYLMNEWPGTPMWHLSLCLLILWLITGLSIMNGVKISGKIMYFTVLFPYFGLILLISLGFTLPGAMKGLLFYLTPHWYKIFDFNVLYLAIGQLLFSTGMALGGLVTYASFNDFRDNFYRDSFIIILSDFTTSVLAGFAIFPILGYMAERSGVKIEKLITSGSSLFFVSFTEALSTLPGAQFWTILFMLMAITLGMDCQFALFETVTTGLMDVYPLLQLTRVFKAVVVWIMCFFYFLIGLFIITPGGKYWFVILNGRVMAFALPFILCVETIVIGHLYGFKKLRYDFRMMMGFYLGWYWFVMISFVCPFIIFCILIGGLLKSERVKVYGLLIPVWGEAIGIILIIILIMPTIFGIFETIIHYRKKYKKLHGKIFLKKLFDPPIYWGPYYKHEWMKSQFYRNKLLKYKDDPRFLRYVSAFEDIHYI 662          
BLAST of slc6a-23 vs. Planmine SMEST
Match: SMESG000054909.1 (SMESG000054909.1)

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 345/652 (52.91%), Postives = 472/652 (72.39%), Query Frame = 2
Query:  224 NNLRKMHRVGTAEYKEYQGSECYVCCARLCTGRFDKRNLRSKSAGTLDEVEVIDKTTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTALCIALGVPXXXXXXGIAQFSGRGPTKAFKMVPILYGIGWCMVFVXXXXXXXXXXXXXXXXFYLFASLTSVLPWSVCSHDFNTNKCXXXXXXXXXXXXXIEYVSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGLGLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWNKIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSFYRKKLLENYENPQFLKYVSKIEDVKGIV 2179
            N    M    T   +    + C  CC  +   +F   +  ++    L E ++  K   IRG+W+NRIEF++SCVGF VG+GNVWRFP RVYE+GGG FL+ YT +CI  G PLL++ELG+ QFSG  P K FK+VP++ G+GW M+ +++ I IYY+AI+++ YFY F S   V+PW+VCSH+FN+N+CL +  +K++ N + E+VSSTSEYWDYYVTGFIKYPSR+PY +NE+PG P WHL +CL++ W   G  +M G++VSGKI+YFTV+YPYFAL  +  LGCTLPG+ +GI FY+ PD+     P + R A+EQ+F+S  IA GG+I ++SYN+F DNF+RDSI++I VDY TS+ AGFA+FPILGYM+QR G +I+ ++ SG  LFFIT TEAL+TLPA QFWT++LMLM I+LG+DSQF +FE + T+++D  P L  ++  KAV VWILCF+ F+SGLL V+PGG +WF+ILDKRV+SFGLP++AL ET  +G +YG+KQ RYDFK++ G  L+   FI +++V PI +  I+ ASF  F+R+KV +  +PIW E +A + L+ V  PI I  + TIY +  RY  +   +F+KKL EPPVYWGPYYKK+W+   FYR KLL N ++ +FL Y+S  ED+  IV
Sbjct:   16 NQKSSMTPEITLNTESESDANCSTCCDIMLKNKFADPSGDTEWDMMLRERDLYSK---IRGRWNNRIEFLMSCVGFVVGIGNVWRFPARVYENGGGTFLIVYTIMCIIFGAPLLIMELGLGQFSGFSPPKLFKLVPVMSGLGWSMIVMSMFIDIYYAAIVSYGYFYFFGSFRRVMPWTVCSHEFNSNRCLGTSDDKASFNIT-EFVSSTSEYWDYYVTGFIKYPSRQPYKLNEFPGSPIWHLTICLVIAWFTTGFIVMRGIRVSGKIVYFTVIYPYFALAAIFFLGCTLPGAMDGISFYVVPDFKFFARPALYRNALEQIFYSIGIAMGGLICFASYNNFRDNFFRDSILLILVDYLTSIFAGFAIFPILGYMSQRVGVRIDKLLTSGVGLFFITLTEALATLPAAQFWTLMLMLMLISLGLDSQFGIFECIATSIMDINPVLHETKVFKAVIVWILCFIFFLSGLLFVTPGGRYWFEILDKRVTSFGLPILALIETTLIGFVYGYKQLRYDFKVITGTLLNWSPFIFLSYVCPIGMVMIIGASFYKFERVKVNNEPIPIWGEIIALIVLITVFTPIIISAIITIYNYNHRYKDIHGWSFVKKLFEPPVYWGPYYKKDWIHSRFYRNKLLANKDDKRFLLYLSPYEDINDIV 663          
BLAST of slc6a-23 vs. Planmine SMEST
Match: SMESG000054972.1 (SMESG000054972.1)

HSP 1 Score: 644.425 bits (1661), Expect = 0.000e+0
Identity = 335/335 (100.00%), Postives = 335/335 (100.00%), Query Frame = 2
Query: 1214 MITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWXXXXXXXXXXXXXVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSFYRKKLLENYENPQFLKYVSKIEDVKGIVELAKTLNSQKSSN 2218
            MITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWILCFLLFISGLLLVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSFYRKKLLENYENPQFLKYVSKIEDVKGIVELAKTLNSQKSSN
Sbjct:    1 MITYSSYNDFHDNFYRDSIIVIFVDYFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPAPQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVWILCFLLFISGLLLVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYGFKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRDLEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLIEPPVYWGPYYKKNWLLGSFYRKKLLENYENPQFLKYVSKIEDVKGIVELAKTLNSQKSSN 335          
The following BLAST results are available for this feature:
BLAST of slc6a-23 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC6A53.864e-11136.53solute carrier family 6 member 5 [Source:HGNC Symb... [more]
SLC6A71.027e-10736.68solute carrier family 6 member 7 [Source:HGNC Symb... [more]
SLC6A71.064e-10738.52solute carrier family 6 member 7 [Source:HGNC Symb... [more]
SLC6A96.660e-9636.65solute carrier family 6 member 9 [Source:HGNC Symb... [more]
SLC6A96.660e-9636.65solute carrier family 6 member 9 [Source:HGNC Symb... [more]
back to top
BLAST of slc6a-23 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dat-11.996e-9033.63Sodium-dependent dopamine transporter [Source:Uni... [more]
snf-111.295e-8232.50Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43][more]
mod-52.250e-7132.90Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7][more]
snf-34.061e-6831.37Sodium- and chloride-dependent betaine transporter... [more]
snf-77.785e-6131.64Transporter [Source:UniProtKB/TrEMBL;Acc:G5EE39][more]
back to top
BLAST of slc6a-23 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GlyT1.075e-9736.00gene:FBgn0034911 transcript:FBtr0301162[more]
CG88506.025e-9333.56gene:FBgn0033708 transcript:FBtr0087973[more]
CG88506.370e-9333.56gene:FBgn0033708 transcript:FBtr0087972[more]
DAT8.170e-9334.16gene:FBgn0034136 transcript:FBtr0087125[more]
DAT8.869e-9334.16gene:FBgn0034136 transcript:FBtr0330002[more]
back to top
BLAST of slc6a-23 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a53.026e-10936.35solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a53.396e-10936.35solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a53.462e-10936.35solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a143.561e-10538.58solute carrier family 6 member 14 [Source:ZFIN;Acc... [more]
slc6a78.956e-9337.14solute carrier family 6 member 7 [Source:ZFIN;Acc:... [more]
back to top
BLAST of slc6a-23 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc4c5.688e-11138.28leucine rich repeat containing 4C [Source:Xenbase;... [more]
lrrc4c6.940e-11138.28leucine rich repeat containing 4C [Source:Xenbase;... [more]
lrrc4c1.295e-11038.28leucine rich repeat containing 4C [Source:Xenbase;... [more]
ENSXETT00000050020.11.974e-10536.14solute carrier family 6 member 14, gene 2 [Source:... [more]
lrrc4c3.716e-10537.19leucine rich repeat containing 4C [Source:Xenbase;... [more]
back to top
BLAST of slc6a-23 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc6a53.574e-11136.44solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a53.574e-11136.44solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a53.574e-11136.44solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a77.972e-10938.92solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a22.423e-9536.16solute carrier family 6 (neurotransmitter transpor... [more]
back to top
BLAST of slc6a-23 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P58295|SC6A5_RAT1.512e-11036.44Sodium- and chloride-dependent glycine transporter... [more]
sp|Q9Y345|SC6A5_HUMAN1.856e-11036.53Sodium- and chloride-dependent glycine transporter... [more]
sp|Q761V0|SC6A5_MOUSE2.427e-11036.44Sodium- and chloride-dependent glycine transporter... [more]
sp|P28573|SC6A7_RAT1.105e-10838.74Sodium-dependent proline transporter OS=Rattus nor... [more]
sp|Q6PGE7|SC6A7_MOUSE5.577e-10838.92Sodium-dependent proline transporter OS=Mus muscul... [more]
back to top
BLAST of slc6a-23 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YK230.000e+0100.00Slc6a-23 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YEX60.000e+062.66Slc6a-10 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A0H3YIU90.000e+056.15Slc6a-11 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A0H3YF560.000e+050.56Slc6a-17 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YIZ34.332e-13139.84Slc6a-14 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
back to top
BLAST of slc6a-23 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a148.574e-9937.82solute carrier family 6 member 14 [Source:NCBI gen... [more]
slc6a11b4.034e-9334.24solute carrier family 6 member 11 [Source:NCBI gen... [more]
slc6a91.763e-9235.12solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a4b5.989e-9234.75sodium-dependent serotonin transporter-like [Sourc... [more]
slc6a91.026e-9134.66solute carrier family 6 member 9 [Source:NCBI gene... [more]
back to top
BLAST of slc6a-23 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a1a3.141e-8934.22solute carrier family 6 member 1a [Source:ZFIN;Acc... [more]
slc6a4b1.019e-7333.88solute carrier family 6 member 4b [Source:ZFIN;Acc... [more]
ENSPMAT00000008631.12.358e-5633.74pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 ... [more]
ENSPMAT00000001684.14.180e-5043.08pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 ge... [more]
ENSPMAT00000004857.12.200e-4932.42pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 ... [more]
back to top
BLAST of slc6a-23 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc6a-23 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO397071.887e-10035.41Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977][more]
EDO401512.188e-9635.12Transporter [Source:UniProtKB/TrEMBL;Acc:A7S7X6][more]
EDO397081.235e-9536.76Transporter [Source:UniProtKB/TrEMBL;Acc:A7S978][more]
EDO492181.503e-9536.01Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4][more]
EDO323564.983e-9435.20Transporter [Source:UniProtKB/TrEMBL;Acc:A7SVA2][more]
back to top
BLAST of slc6a-23 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a51.062e-10835.82solute carrier family 6 member 5 [Source:NCBI gene... [more]
slc6a91.463e-9536.13solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a91.463e-9536.13solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a91.739e-9536.13solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a142.913e-9335.81solute carrier family 6 member 14 [Source:NCBI gen... [more]
back to top
BLAST of slc6a-23 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054904.10.000e+062.71SMESG000054904.1[more]
SMESG000054935.10.000e+055.85SMESG000054935.1[more]
SMESG000054919.10.000e+056.41SMESG000054919.1[more]
SMESG000054909.10.000e+052.91SMESG000054909.1[more]
SMESG000054972.10.000e+0100.00SMESG000054972.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30004736
GenBankAKN21443.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004736 ID=SMED30004736|Name=slc6a-23|organism=Schmidtea mediterranea sexual|type=transcript|length=2270bp
CCGATCTATTGCTTATAAGAATAAGTCGTAAATAAATACATGAATTCGCT
TATCACTGCATTCAACTTATACTAGCGTCGTGGTGACGCACAGATAAGAT
TTGTGTAGCAAAATTCATGTACATATCCGTTAAATCTCTGCCAAAGTATC
CATAGATATTTAAAATTCTAATATATTGATACGAATGTTTTGCAATCTTT
AAATGCTATCTTAATATTAATAAAATAATCTAAGGAAAATGCATAGAGTT
GGTACAGCAGAGTACAAGGAATATCAAGGGAGTGAATGCTATGTATGCTG
TGCTAGACTATGTACAGGTCGGTTTGATAAAAGAAATTTGAGGTCCAAAT
CAGCTGGAACGCTTGATGAGGTCGAGGTGATTGATAAAACAACTGATATT
CGAGGGAAATGGGATAATCGCATAGAATTCGTTCTATCATGCGTTGGATT
TGCCGTTGGGCTTGGAAATGTATGGAGATTTCCAATTCGGGTCTATGAAA
GTGGAGGTGGAGCATTTTTAGTTCCATATACCGCTCTTTGCATAGCTTTA
GGTGTACCTCTATTATTATTGGAACTTGGTATTGCTCAATTTTCGGGTAG
AGGCCCAACAAAAGCTTTTAAAATGGTTCCTATCTTGTACGGTATTGGCT
GGTGCATGGTTTTTGTTGCCATATCAATTCTCATTTATTATTCAGCCATT
ATTGCTTGGAGTTATTTTTATTTATTTGCTTCTCTAACTTCTGTACTTCC
ATGGTCAGTTTGCAGTCATGATTTCAATACGAATAAATGTTTAGCATCTT
TAGCTAATAAGTCGGCATTAAATTCATCTATTGAATATGTTTCTTCTACA
AGTGAATATTGGGATTACTATGTAACAGGATTCATAAAATATCCATCCAG
AGAGCCATATAATATGAATGAATACCCAGGACCTCCTCAGTGGCATCTCG
CTCTCTGCTTACTTCTGACTTGGTCAATAGCAGGACTAGGTCTAATGTTT
GGAGTTAAGGTTAGTGGGAAAATCATATACTTCACTGTTTTGTATCCATA
TTTTGCATTGCTATGTCTAATAATTTTAGGATGTACACTTCCAGGCTCAG
CAAACGGAATAATATTTTACCTAGCTCCCGATTGGAATAAGATTTATGAT
CCAAAGGTTTTACGAGGTGCTGTTGAACAACTCTTTTTCTCGTGTAGCAT
TGCTCAGGGTGGCATGATAACATATTCTAGTTACAATGATTTCCATGATA
ACTTTTACAGAGACTCCATAATTGTTATATTTGTCGACTATTTTACTAGT
GTAATTGCAGGATTCGCTGTCTTCCCTATACTAGGTTACATGGCTCAAAG
AACTGGGACTAAAATAGAGAATATTATAAATTCTGGATCCAGTTTATTTT
TTATCACTTTTACAGAAGCTTTATCAACACTACCTGCTCCACAATTTTGG
ACAATACTTCTGATGTTAATGGCCATTACTTTGGGTATGGATAGTCAATT
CGCAATGTTCGAAACCGTAGTCACTGCCTTGATTGACCATTATCCATTTT
TACAAGCCAGTCGATTTTTAAAGGCTGTAACGGTTTGGATTTTATGTTTT
CTACTCTTTATTTCTGGGTTGTTACTTGTTTCACCGGGAGGGGAATTTTG
GTTTGATATCCTTGATAAAAGAGTATCTTCATTTGGTCTACCGCTAATTG
CACTAAGTGAAACGATCTGTGTTGGGCTTATATATGGATTTAAACAATTT
AGATATGACTTTAAAATGATGGCAGGGTTTTCCTTAAGCTTGTACTGGTT
CATAATGATGGCATTTGTTTCTCCTATCATAATATTTGGTATTCTTTTGG
CTAGTTTCATAAATTTTGATCGCATTAAAGTAAGAGATTTGGAGGTCCCT
ATTTGGGCAGAAACTTTAGCATTCGTTTTTTTACTAATTGTCCTACTTCC
TATTGCGATCGGGATAGTCCATACAATTTACAAGTTTAAATTACGATATA
ATCAATTAGAAACCAAAGCGTTTATGAAAAAATTAATAGAACCTCCTGTT
TATTGGGGTCCTTACTACAAGAAAAATTGGCTATTAGGATCCTTCTATAG
AAAAAAACTTTTAGAGAATTATGAAAATCCGCAATTCTTGAAATATGTTT
CAAAAATTGAGGACGTCAAAGGGATTGTAGAGTTGGCTAAAACTCTTAAC
AGTCAAAAATCCTCTAATTGACAAATTTGTTTTGTTGAATTAATTTTAAT
AAAACTTTGGTCTTATGAAA
back to top

protein sequence of SMED30004736-orf-1

>SMED30004736-orf-1 ID=SMED30004736-orf-1|Name=SMED30004736-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=112bp
MRSKFMKLAKRIPNIMIGETNAIIMNQYKLKENPAIILKSYLNCLNPYIS
PTQIVSLSAISGRPNEDTLLSRISNQNSPPGETSNNPEIKSRKHKIQTVT
AFKNRLACKNG*
back to top

protein sequence of SMED30004736-orf-2

>SMED30004736-orf-2 ID=SMED30004736-orf-2|Name=SMED30004736-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=661bp
MHRVGTAEYKEYQGSECYVCCARLCTGRFDKRNLRSKSAGTLDEVEVIDK
TTDIRGKWDNRIEFVLSCVGFAVGLGNVWRFPIRVYESGGGAFLVPYTAL
CIALGVPLLLLELGIAQFSGRGPTKAFKMVPILYGIGWCMVFVAISILIY
YSAIIAWSYFYLFASLTSVLPWSVCSHDFNTNKCLASLANKSALNSSIEY
VSSTSEYWDYYVTGFIKYPSREPYNMNEYPGPPQWHLALCLLLTWSIAGL
GLMFGVKVSGKIIYFTVLYPYFALLCLIILGCTLPGSANGIIFYLAPDWN
KIYDPKVLRGAVEQLFFSCSIAQGGMITYSSYNDFHDNFYRDSIIVIFVD
YFTSVIAGFAVFPILGYMAQRTGTKIENIINSGSSLFFITFTEALSTLPA
PQFWTILLMLMAITLGMDSQFAMFETVVTALIDHYPFLQASRFLKAVTVW
ILCFLLFISGLLLVSPGGEFWFDILDKRVSSFGLPLIALSETICVGLIYG
FKQFRYDFKMMAGFSLSLYWFIMMAFVSPIIIFGILLASFINFDRIKVRD
LEVPIWAETLAFVFLLIVLLPIAIGIVHTIYKFKLRYNQLETKAFMKKLI
EPPVYWGPYYKKNWLLGSFYRKKLLENYENPQFLKYVSKIEDVKGIVELA
KTLNSQKSSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015293symporter activity
GO:0005328neurotransmitter:sodium symporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006836neurotransmitter transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR037272SNS_sf
IPR000175Na/ntran_symport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000175Sodium:neurotransmitter symporterPRINTSPR00176NANEUSMPORTcoord: 135..161
score: 35.52
coord: 92..111
score: 43.77
coord: 63..84
score: 68.03
coord: 344..364
score: 39.03
coord: 398..417
score: 39.02
coord: 521..541
score: 26.23
coord: 481..501
score: 29.04
coord: 262..279
score: 39.44
IPR000175Sodium:neurotransmitter symporterPFAMPF00209SNFcoord: 55..579
e-value: 5.2E-156
score: 520.4
IPR000175Sodium:neurotransmitter symporterPANTHERPTHR11616SODIUM/CHLORIDE DEPENDENT TRANSPORTERcoord: 47..591
IPR000175Sodium:neurotransmitter symporterPROSITEPS00754NA_NEUROTRAN_SYMP_2coord: 161..181
IPR000175Sodium:neurotransmitter symporterPROSITEPS50267NA_NEUROTRAN_SYMP_3coord: 54..585
score: 80.899
NoneNo IPR availablePANTHERPTHR11616:SF231SODIUM-DEPENDENT PROLINE TRANSPORTERcoord: 47..591
NoneNo IPR availableTMHMMTMhelixcoord: 64..83
NoneNo IPR availableTMHMMTMhelixcoord: 234..256
NoneNo IPR availableTMHMMTMhelixcoord: 403..425
NoneNo IPR availableTMHMMTMhelixcoord: 263..285
NoneNo IPR availableTMHMMTMhelixcoord: 135..157
NoneNo IPR availableTMHMMTMhelixcoord: 446..464
NoneNo IPR availableTMHMMTMhelixcoord: 518..540
NoneNo IPR availableTMHMMTMhelixcoord: 379..398
NoneNo IPR availableTMHMMTMhelixcoord: 555..577
NoneNo IPR availableTMHMMTMhelixcoord: 344..366
NoneNo IPR availableTMHMMTMhelixcoord: 93..115
NoneNo IPR availableTMHMMTMhelixcoord: 479..501
IPR037272Sodium:neurotransmitter symporter superfamilySUPERFAMILYSSF161070SNF-likecoord: 55..581