PKD1L-2

Overview
NamePKD1L-2 (AKN21725.1)
Smed IDSMED30004732
Length (bp)984
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004732

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30004732h1SMcG0019650 SmedASXL_008800SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004732h1SMcG0019650 SmedASXL_014419SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004732h1SMcG0019650 SmedASXL_008798SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30004732h1SMcG0019650 dd_Smed_v4_13975_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004732h1SMcG0019650 dd_Smed_v4_13975_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30004732h1SMcG0019650 dd_Smed_v4_13975_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neuronSMED30004732h1SMcG0019650 dd_Smed_v4_13975_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30004732h1SMcG0019650 dd_Smed_v4_13975_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal-ventral axis of the whole animalSMED30004732h1SMcG0019650 dd_Smed_v4_13975_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
head regionSMED30004732h1SMcG0019650 dd_Smed_v6_13975_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30004732h1SMcG0019650 dd_Smed_v6_13975_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PKD1L-2 vs. Ensembl Human
Match: HMCN1 (hemicentin 1 [Source:HGNC Symbol;Acc:HGNC:19194])

HSP 1 Score: 98.9821 bits (245), Expect = 4.718e-22
Identity = 68/151 (45.03%), Postives = 85/151 (56.29%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            +CG GT  R R C NP PA GG  C+ + TQ Q C    CPI   W  W+SW+ACSV+C  G + R+R C D  P   G  C G+D  +  C  S  CP +GNWS WS W +CS +C     M+R R C+NP PSN G+ C G  +  Q C
Sbjct: 4658 SCGKGTQTRARLCNNPPPAFGGSYCDGAETQMQVCNERNCPIHGKWATWASWSACSVSCGGGARQRTRGCSDPVPQYGGRKCEGSDVQSDFC-NSDPCPTHGNWSPWSGWGTCSRTCNGGQ-MRRYRTCDNPPPSNGGRACGGPDSQIQRC 4806          

HSP 2 Score: 94.3597 bits (233), Expect = 1.541e-20
Identity = 68/160 (42.50%), Postives = 84/160 (52.50%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VTCG G   R R C  P PANGG  C  S  + + C N  CP+  SW EWS W  C+ +C  G Q+R+R C +PS  + G  C G   +   C     CP++G WS+W  W +CS SCG      R+RLCNNP P+  G  C G  T  Q C     NCP
Sbjct: 4543 VTCGKGIQKRSRLCNQPLPANGGKPCQGSDLEMRNCQNKPCPVDGSWSEWSLWEECTRSCGRGNQTRTRTCNNPSVQHGGRPCEGNAVEIIMCNIRP-CPVHGAWSAWQPWGTCSESCGKGT-QTRARLCNNPPPAFGGSYCDGAETQMQVCNE--RNCP 4698          

HSP 3 Score: 86.2705 bits (212), Expect = 9.173e-18
Identity = 63/152 (41.45%), Postives = 79/152 (51.97%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            V+CG G   R R C++P P  GG  C  S  Q   C +  CP   +W  WS W  CS TCN G   R R C +  PSN G  C G D   Q C  + +CP++G+W SW +WS CS SCG      R RLC++P P   G+ C G +T    C
Sbjct: 4714 VSCGGGARQRTRGCSDPVPQYGGRKCEGSDVQSDFCNSDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPPPSNGGRACGGPDSQIQRC-NTDMCPVDGSWGSWHSWSQCSASCGGGE-KTRKRLCDHPVPVKGGRPCPGDTTQVTRC 4863          

HSP 4 Score: 80.8777 bits (198), Expect = 5.142e-16
Identity = 60/159 (37.74%), Postives = 88/159 (55.35%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            +CG G   R RTC NP+  +GG  C  ++ +   C    CP+  +W  W  W  CS +C  GTQ+R+R+C +P  +  G  C G +   Q C +   CPI+G W++W++WS+CSVSCG     QR+R C++P P   G+ C G    +  C + P  CP
Sbjct: 4601 SCGRGNQTRTRTCNNPSVQHGGRPCEGNAVEIIMCNIRPCPVHGAWSAWQPWGTCSESCGKGTQTRARLCNNPPPAFGGSYCDGAETQMQVCNERN-CPIHGKWATWASWSACSVSCGGGA-RQRTRGCSDPVPQYGGRKCEGSDVQSDFCNSDP--CP 4755          

HSP 5 Score: 57.7658 bits (138), Expect = 1.828e-8
Identity = 47/114 (41.23%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            + +WS+W ACSVTC  G Q RSR+C    P+N G  C G+D + + C ++  CP++G+WS WS W  C+ SCG      R+R CNNP+  + G+ C G + +   C   P  CP
Sbjct: 4532 FSQWSAWRACSVTCGKGIQKRSRLCNQPLPANGGKPCQGSDLEMRNC-QNKPCPVDGSWSEWSLWEECTRSCGRGN-QTRTRTCNNPSVQHGGRPCEGNAVEIIMCNIRP--CP 4641          
BLAST of PKD1L-2 vs. Ensembl Human
Match: ADGRB2 (adhesion G protein-coupled receptor B2 [Source:HGNC Symbol;Acc:HGNC:944])

HSP 1 Score: 82.8037 bits (203), Expect = 1.060e-16
Identity = 60/159 (37.74%), Postives = 85/159 (53.46%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLA-CPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            +TCG G  +R R+C +   +  G  C+    + + C N A CP+   W EW SW+ CS +C  G++SR R C+ P + G  C G +  T+ C  +  CP+ G W  W  W  CS SC +    QRSR C+   P+ A   C+G  TDT+ C+N  L CP
Sbjct:  323 LTCGQGLQVRTRSCVS---SPYGTLCSGPLRETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGPELQTKLCSMAA-CPVEGQWLEWGPWGPCSTSCANGT-QQRSRKCSVAGPAWA--TCTGALTDTRECSN--LECP 472          

HSP 2 Score: 73.559 bits (179), Expect = 1.156e-13
Identity = 36/98 (36.73%), Postives = 50/98 (51.02%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII--SWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            +C NGT  R R C+   PA    +C  + T  + C NL CP     WG W++W+ CS TC+ G Q R R+C      G  C GT ++ + C +   CP
Sbjct:  434 SCANGTQQRSRKCSVAGPA--WATCTGALTDTRECSNLECPATDSKWGPWNAWSLCSKTCDTGWQRRFRMCQATGTQGYPCEGTGEEVKPCSEKR-CP 528          

HSP 3 Score: 55.4546 bits (132), Expect = 9.260e-8
Identity = 43/110 (39.09%), Postives = 58/110 (52.73%), Query Frame = 3
Query:  654 EWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            EWS W+ CS+TC  G Q R+R C+  S  G  C G  ++T+ C  S  CP++G W  W +WS CS SCG      RSR+     P + G+ C G    T+ C+     CP
Sbjct:  314 EWSPWSVCSLTCGQGLQVRTRSCVS-SPYGTLCSGPLRETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRG---SRSRMRTCVPPQHGGKACEGPELQTKLCSMAA--CP 417          
BLAST of PKD1L-2 vs. Ensembl Human
Match: ADGRB2 (adhesion G protein-coupled receptor B2 [Source:HGNC Symbol;Acc:HGNC:944])

HSP 1 Score: 82.4185 bits (202), Expect = 1.411e-16
Identity = 60/159 (37.74%), Postives = 85/159 (53.46%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLA-CPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            +TCG G  +R R+C +   +  G  C+    + + C N A CP+   W EW SW+ CS +C  G++SR R C+ P + G  C G +  T+ C  +  CP+ G W  W  W  CS SC +    QRSR C+   P+ A   C+G  TDT+ C+N  L CP
Sbjct:  311 LTCGQGLQVRTRSCVS---SPYGTLCSGPLRETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGPELQTKLCSMAA-CPVEGQWLEWGPWGPCSTSCANGT-QQRSRKCSVAGPAWA--TCTGALTDTRECSN--LECP 460          

HSP 2 Score: 73.1738 bits (178), Expect = 1.492e-13
Identity = 36/98 (36.73%), Postives = 50/98 (51.02%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII--SWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            +C NGT  R R C+   PA    +C  + T  + C NL CP     WG W++W+ CS TC+ G Q R R+C      G  C GT ++ + C +   CP
Sbjct:  422 SCANGTQQRSRKCSVAGPA--WATCTGALTDTRECSNLECPATDSKWGPWNAWSLCSKTCDTGWQRRFRMCQATGTQGYPCEGTGEEVKPCSEKR-CP 516          

HSP 3 Score: 55.0694 bits (131), Expect = 1.087e-7
Identity = 41/103 (39.81%), Postives = 56/103 (54.37%), Query Frame = 3
Query:  654 EWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 962
            EWS W+ CS+TC  G Q R+R C+  S  G  C G  ++T+ C  S  CP++G W  W +WS CS SCG      RSR+     P + G+ C G    T+ C+
Sbjct:  302 EWSPWSVCSLTCGQGLQVRTRSCVS-SPYGTLCSGPLRETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRG---SRSRMRTCVPPQHGGKACEGPELQTKLCS 400          
BLAST of PKD1L-2 vs. Ensembl Human
Match: ADGRB2 (adhesion G protein-coupled receptor B2 [Source:HGNC Symbol;Acc:HGNC:944])

HSP 1 Score: 82.4185 bits (202), Expect = 1.468e-16
Identity = 60/159 (37.74%), Postives = 85/159 (53.46%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLA-CPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            +TCG G  +R R+C +   +  G  C+    + + C N A CP+   W EW SW+ CS +C  G++SR R C+ P + G  C G +  T+ C  +  CP+ G W  W  W  CS SC +    QRSR C+   P+ A   C+G  TDT+ C+N  L CP
Sbjct:  323 LTCGQGLQVRTRSCVS---SPYGTLCSGPLRETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGPELQTKLCSMAA-CPVEGQWLEWGPWGPCSTSCANGT-QQRSRKCSVAGPAWA--TCTGALTDTRECSN--LECP 472          

HSP 2 Score: 73.1738 bits (178), Expect = 1.510e-13
Identity = 36/98 (36.73%), Postives = 50/98 (51.02%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII--SWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            +C NGT  R R C+   PA    +C  + T  + C NL CP     WG W++W+ CS TC+ G Q R R+C      G  C GT ++ + C +   CP
Sbjct:  434 SCANGTQQRSRKCSVAGPA--WATCTGALTDTRECSNLECPATDSKWGPWNAWSLCSKTCDTGWQRRFRMCQATGTQGYPCEGTGEEVKPCSEKR-CP 528          

HSP 3 Score: 55.0694 bits (131), Expect = 1.109e-7
Identity = 41/103 (39.81%), Postives = 56/103 (54.37%), Query Frame = 3
Query:  654 EWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 962
            EWS W+ CS+TC  G Q R+R C+  S  G  C G  ++T+ C  S  CP++G W  W +WS CS SCG      RSR+     P + G+ C G    T+ C+
Sbjct:  314 EWSPWSVCSLTCGQGLQVRTRSCVS-SPYGTLCSGPLRETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRG---SRSRMRTCVPPQHGGKACEGPELQTKLCS 412          
BLAST of PKD1L-2 vs. Ensembl Human
Match: ADGRB2 (adhesion G protein-coupled receptor B2 [Source:HGNC Symbol;Acc:HGNC:944])

HSP 1 Score: 82.4185 bits (202), Expect = 1.469e-16
Identity = 60/159 (37.74%), Postives = 85/159 (53.46%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLA-CPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            +TCG G  +R R+C +   +  G  C+    + + C N A CP+   W EW SW+ CS +C  G++SR R C+ P + G  C G +  T+ C  +  CP+ G W  W  W  CS SC +    QRSR C+   P+ A   C+G  TDT+ C+N  L CP
Sbjct:  323 LTCGQGLQVRTRSCVS---SPYGTLCSGPLRETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGPELQTKLCSMAA-CPVEGQWLEWGPWGPCSTSCANGT-QQRSRKCSVAGPAWA--TCTGALTDTRECSN--LECP 472          

HSP 2 Score: 73.1738 bits (178), Expect = 1.511e-13
Identity = 36/98 (36.73%), Postives = 50/98 (51.02%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII--SWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            +C NGT  R R C+   PA    +C  + T  + C NL CP     WG W++W+ CS TC+ G Q R R+C      G  C GT ++ + C +   CP
Sbjct:  434 SCANGTQQRSRKCSVAGPA--WATCTGALTDTRECSNLECPATDSKWGPWNAWSLCSKTCDTGWQRRFRMCQATGTQGYPCEGTGEEVKPCSEKR-CP 528          

HSP 3 Score: 55.0694 bits (131), Expect = 1.109e-7
Identity = 41/103 (39.81%), Postives = 56/103 (54.37%), Query Frame = 3
Query:  654 EWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 962
            EWS W+ CS+TC  G Q R+R C+  S  G  C G  ++T+ C  S  CP++G W  W +WS CS SCG      RSR+     P + G+ C G    T+ C+
Sbjct:  314 EWSPWSVCSLTCGQGLQVRTRSCVS-SPYGTLCSGPLRETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRG---SRSRMRTCVPPQHGGKACEGPELQTKLCS 412          
BLAST of PKD1L-2 vs. Ensembl Celegans
Match: adt-1 (A disintegrin and metalloproteinase with thrombospondin motifs adt-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECS8])

HSP 1 Score: 70.8626 bits (172), Expect = 3.837e-13
Identity = 50/155 (32.26%), Postives = 74/155 (47.74%), Query Frame = 3
Query:  519 CGN-GTTIRQRTCTNPAPANGGMSCNDSSTQWQTCV-NLACPIIS----WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            CG+ G  IR R C+ P P+N G  C+  S   + CV +  C        W +W++W+ C+  C NG +SR+R C +  PS  G  C G+D +   C     C +     S  +  +   +    G+  R R C++P P   GQ CSGL+  T  C
Sbjct: 1219 CGDTGHQIRNRMCSEPIPSNRGAYCSGYSFDQRPCVMDNVCSDEKVDGGWTDWTAWSECTDYCRNGHRSRTRFCANPKPSQGGAQCTGSDFELNPCFDPARCHLRDGGWSTWSDWTPCSASCGFGVQTRDRSCSSPEP-KGGQSCSGLAHQTSLC 1372          

HSP 2 Score: 64.3142 bits (155), Expect = 4.759e-11
Identity = 49/155 (31.61%), Postives = 62/155 (40.00%), Query Frame = 3
Query:  519 CGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLA-CPIIS--WGEWSSWAACSVTCNNGTQSRSRVCIDPS-NSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVP 971
            C NG   R R C NP P+ GG  C  S  +   C + A C +    W  WS W  CS +C  G Q+R R C  P    G +C G    T  C        +    S     S  +     G   R R C +P  S+ GQ C G S++   C   P
Sbjct: 1281 CRNGHRSRTRFCANPKPSQGGAQCTGSDFELNPCFDPARCHLRDGGWSTWSDWTPCSASCGFGVQTRDRSCSSPEPKGGQSCSGLAHQTSLCDLPACDHESDGEWSAWNEWSGCMGNCGIGTRTRVRACVSPPVSDGGQPCFGRSSEITECRQSP 1435          

HSP 3 Score: 56.6102 bits (135), Expect = 1.304e-8
Identity = 36/98 (36.73%), Postives = 50/98 (51.02%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSS---WAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKS 791
             +CG G   R R+C++P P  GG SC+  + Q   C   AC   S GEWS+   W+ C   C  GT++R R C+ P  S+ G  C G   +   C +S
Sbjct: 1338 ASCGFGVQTRDRSCSSPEP-KGGQSCSGLAHQTSLCDLPACDHESDGEWSAWNEWSGCMGNCGIGTRTRVRACVSPPVSDGGQPCFGRSSEITECRQS 1434          

HSP 4 Score: 51.6026 bits (122), Expect = 6.448e-7
Identity = 29/74 (39.19%), Postives = 35/74 (47.30%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACP----IISWGEWSSWAACSVTCNNGTQSRSRVC 722
            V+CG G  IR+R C        G  C  ++ Q +TC    CP    +  W EW  W  CS TC  G QSR R C
Sbjct:  864 VSCGIGFQIRERLCD-------GELCATANKQARTCNQQQCPSAFSLSVWSEWGEWTTCSATCGEGLQSRERSC 930          

HSP 5 Score: 50.0618 bits (118), Expect = 1.843e-6
Identity = 48/106 (45.28%), Postives = 59/106 (55.66%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVC--IDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            W EWSSW+ACS  C + T +R R C  +DP+  G  C G   +   C   +  P  G WS WS WSSCS  CG  G   R+R+C+ P PSN G  CSG S D + C
Sbjct: 1151 WSEWSSWSACS--CFSLTSTRRRFCQVVDPTVQGF-CAGAILEQIPCAPGSCSPSAGGWSLWSEWSSCSKDCGDTGHQIRNRMCSEPIPSNRGAYCSGYSFDQRPC 1253          
BLAST of PKD1L-2 vs. Ensembl Celegans
Match: C36B7.5 (pep chromosome:WBcel235:X:7089228:7096449:-1 gene:WBGene00016468.1 transcript:C36B7.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C36B7.5)

HSP 1 Score: 56.9954 bits (136), Expect = 9.006e-9
Identity = 50/148 (33.78%), Postives = 66/148 (44.59%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            +CG     R R C N      G+ C   +T+ +TC    CP   W  W  W  CS  C  G   R+R CID    G++C G  ++   C +   CP    WS W+ W+ C   CG   I  R+R C N   +NA   C G + D  SC
Sbjct:  412 SCGKSIERRSRICQN------GLLCPGPATEERTCDKRPCP--HWSNWGQWEKCSKECGAGHTYRNRECID----GVSCEGASEEKILCNQQP-CP---EWSQWTAWTVCDERCGEESIRLRNRKCMNAENNNA---CDGPAQDQMSC 540          

HSP 2 Score: 56.9954 bits (136), Expect = 1.029e-8
Identity = 33/97 (34.02%), Postives = 44/97 (45.36%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTC-VNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            TCG G   R R C        G +C+  S + + C   L CP  +W  W SW  C  +C    + RSR+C     +GL CPG   + + C K   CP
Sbjct:  363 TCGVGEIQRNRVCQT------GRNCDGPSVEVEACKALLPCP--TWSSWMSWTGCGNSCGKSIERRSRIC----QNGLLCPGPATEERTCDKRP-CP 446          

HSP 3 Score: 54.299 bits (129), Expect = 8.323e-8
Identity = 26/70 (37.14%), Postives = 36/70 (51.43%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCI 725
            TCG GT  R R C      + G  C+    + + C   +CP   WG+W+ W+ CSV+C  G   R+R CI
Sbjct:  560 TCGQGTQKRLRKC------DSGNECSGPGEEMRFCQIASCPY--WGDWTPWSGCSVSCGQGVCERTRKCI 621          

HSP 4 Score: 53.5286 bits (127), Expect = 1.241e-7
Identity = 45/152 (29.61%), Postives = 64/152 (42.11%), Query Frame = 3
Query:  528 GTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            G ++R R C       GG++C   ST    C    C +  W  WS W+ C+ TC  G   R+RVC     +G  C G   + +AC     CP      S     +   +     I +RSR+C N      G  C G +T+ ++C   P  CP
Sbjct:  321 GISLRTRQCL------GGITCIGPSTI--PCQVPECAV--WTLWSPWSLCTATCGVGEIQRNRVC----QTGRNCDGPSVEVEACKALLPCP----TWSSWMSWTGCGNSCGKSIERRSRICQN------GLLCPGPATEERTCDKRP--CP 446          

HSP 5 Score: 53.1434 bits (126), Expect = 1.769e-7
Identity = 33/96 (34.38%), Postives = 45/96 (46.88%), Query Frame = 3
Query:  519 CGNGTT-IRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            CG  +  +R R C N   A    +C+  +    +C    CP   W EW  WA CS TC  GTQ R R C    +SG  C G  ++ + C  ++ CP
Sbjct:  509 CGEESIRLRNRKCMN---AENNNACDGPAQDQMSCPYRDCP--KWEEWGEWADCSTTCGQGTQKRLRKC----DSGNECSGPGEEMRFCQIAS-CP 594          
BLAST of PKD1L-2 vs. Ensembl Celegans
Match: C36B7.5 (pep chromosome:WBcel235:X:7089228:7096449:-1 gene:WBGene00016468.1 transcript:C36B7.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C36B7.5)

HSP 1 Score: 56.9954 bits (136), Expect = 1.007e-8
Identity = 50/148 (33.78%), Postives = 66/148 (44.59%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            +CG     R R C N      G+ C   +T+ +TC    CP   W  W  W  CS  C  G   R+R CID    G++C G  ++   C +   CP    WS W+ W+ C   CG   I  R+R C N   +NA   C G + D  SC
Sbjct:  412 SCGKSIERRSRICQN------GLLCPGPATEERTCDKRPCP--HWSNWGQWEKCSKECGAGHTYRNRECID----GVSCEGASEEKILCNQQP-CP---EWSQWTAWTVCDERCGEESIRLRNRKCMNAENNNA---CDGPAQDQMSC 540          

HSP 2 Score: 56.9954 bits (136), Expect = 1.120e-8
Identity = 33/97 (34.02%), Postives = 44/97 (45.36%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTC-VNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            TCG G   R R C        G +C+  S + + C   L CP  +W  W SW  C  +C    + RSR+C     +GL CPG   + + C K   CP
Sbjct:  363 TCGVGEIQRNRVCQT------GRNCDGPSVEVEACKALLPCP--TWSSWMSWTGCGNSCGKSIERRSRIC----QNGLLCPGPATEERTCDKRP-CP 446          

HSP 3 Score: 53.9138 bits (128), Expect = 8.586e-8
Identity = 26/70 (37.14%), Postives = 36/70 (51.43%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCI 725
            TCG GT  R R C      + G  C+    + + C   +CP   WG+W+ W+ CSV+C  G   R+R CI
Sbjct:  560 TCGQGTQKRLRKC------DSGNECSGPGEEMRFCQIASCPY--WGDWTPWSGCSVSCGQGVCERTRKCI 621          

HSP 4 Score: 53.5286 bits (127), Expect = 1.314e-7
Identity = 45/152 (29.61%), Postives = 64/152 (42.11%), Query Frame = 3
Query:  528 GTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            G ++R R C       GG++C   ST    C    C +  W  WS W+ C+ TC  G   R+RVC     +G  C G   + +AC     CP      S     +   +     I +RSR+C N      G  C G +T+ ++C   P  CP
Sbjct:  321 GISLRTRQCL------GGITCIGPSTI--PCQVPECAV--WTLWSPWSLCTATCGVGEIQRNRVC----QTGRNCDGPSVEVEACKALLPCP----TWSSWMSWTGCGNSCGKSIERRSRICQN------GLLCPGPATEERTCDKRP--CP 446          

HSP 5 Score: 53.1434 bits (126), Expect = 1.857e-7
Identity = 33/96 (34.38%), Postives = 45/96 (46.88%), Query Frame = 3
Query:  519 CGNGTT-IRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            CG  +  +R R C N   A    +C+  +    +C    CP   W EW  WA CS TC  GTQ R R C    +SG  C G  ++ + C  ++ CP
Sbjct:  509 CGEESIRLRNRKCMN---AENNNACDGPAQDQMSCPYRDCP--KWEEWGEWADCSTTCGQGTQKRLRKC----DSGNECSGPGEEMRFCQIAS-CP 594          
BLAST of PKD1L-2 vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 56.225 bits (134), Expect = 1.459e-8
Identity = 33/84 (39.29%), Postives = 42/84 (50.00%), Query Frame = 3
Query:  540 RQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCI--DPSNSGLTCPGTDKDTQAC 782
            R RTC NPAP N G  C       ++C  + C +   W  WS W+ACS +C+   + R+R C    P N G  C G D  TQ C
Sbjct:   74 RTRTCNNPAPLNDGEYCKGEEEMTRSC-KVPCKLDGGWSSWSDWSACSSSCH---RYRTRACTVPPPMNGGQPCFGDDLMTQEC 153          
BLAST of PKD1L-2 vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 56.225 bits (134), Expect = 1.493e-8
Identity = 33/84 (39.29%), Postives = 42/84 (50.00%), Query Frame = 3
Query:  540 RQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCI--DPSNSGLTCPGTDKDTQAC 782
            R RTC NPAP N G  C       ++C  + C +   W  WS W+ACS +C+   + R+R C    P N G  C G D  TQ C
Sbjct:  133 RTRTCNNPAPLNDGEYCKGEEEMTRSC-KVPCKLDGGWSSWSDWSACSSSCH---RYRTRACTVPPPMNGGQPCFGDDLMTQEC 212          
BLAST of PKD1L-2 vs. Ensembl Fly
Match: Sema5c (gene:FBgn0284221 transcript:FBtr0076052)

HSP 1 Score: 77.7962 bits (190), Expect = 1.953e-15
Identity = 50/147 (34.01%), Postives = 66/147 (44.90%), Query Frame = 3
Query:  540 RQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNS--GLTCPGTDKDTQACGKSTLCPIXXXXXXXX-----XXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            RQR+C NP P +GG +C   STQ   C         W EWS+W+ CS TC    + R R C +P  +  G TC G+++    C     CP+    S           S   +    G   R R CN+PAP N G +C G   D + C
Sbjct:  578 RQRSCNNPQPQHGGATCEGISTQVTNCTQHG----GWTEWSAWSPCSQTCGIAVKIRRRTCGNPRPAFGGRTCVGSEQSEMYCRHLPPCPVAKPQSVDGGWGPWGEWSECSAQCGGGFRMRRRECNDPAPLNGGMECPGCRLDYEEC 720          

HSP 2 Score: 75.485 bits (184), Expect = 1.219e-14
Identity = 40/99 (40.40%), Postives = 49/99 (49.49%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLA-CPIIS-------WGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQAC 782
            TCG    IR+RTC NP PA GG +C  S      C +L  CP+         WG W  W+ CS  C  G + R R C DP+  N G+ CPG   D + C
Sbjct:  622 TCGIAVKIRRRTCGNPRPAFGGRTCVGSEQSEMYCRHLPPCPVAKPQSVDGGWGPWGEWSECSAQCGGGFRMRRRECNDPAPLNGGMECPGCRLDYEEC 720          
BLAST of PKD1L-2 vs. Ensembl Fly
Match: Sema5c (gene:FBgn0284221 transcript:FBtr0300339)

HSP 1 Score: 77.7962 bits (190), Expect = 2.006e-15
Identity = 50/147 (34.01%), Postives = 66/147 (44.90%), Query Frame = 3
Query:  540 RQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNS--GLTCPGTDKDTQACGKSTLCPIXXXXXXXX-----XXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            RQR+C NP P +GG +C   STQ   C         W EWS+W+ CS TC    + R R C +P  +  G TC G+++    C     CP+    S           S   +    G   R R CN+PAP N G +C G   D + C
Sbjct:  576 RQRSCNNPQPQHGGATCEGISTQVTNCTQHG----GWTEWSAWSPCSQTCGIAVKIRRRTCGNPRPAFGGRTCVGSEQSEMYCRHLPPCPVAKPQSVDGGWGPWGEWSECSAQCGGGFRMRRRECNDPAPLNGGMECPGCRLDYEEC 718          

HSP 2 Score: 75.485 bits (184), Expect = 1.196e-14
Identity = 40/99 (40.40%), Postives = 49/99 (49.49%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLA-CPIIS-------WGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQAC 782
            TCG    IR+RTC NP PA GG +C  S      C +L  CP+         WG W  W+ CS  C  G + R R C DP+  N G+ CPG   D + C
Sbjct:  620 TCGIAVKIRRRTCGNPRPAFGGRTCVGSEQSEMYCRHLPPCPVAKPQSVDGGWGPWGEWSECSAQCGGGFRMRRRECNDPAPLNGGMECPGCRLDYEEC 718          
BLAST of PKD1L-2 vs. Ensembl Fly
Match: gogo (gene:FBgn0052227 transcript:FBtr0074848)

HSP 1 Score: 48.9062 bits (115), Expect = 4.443e-6
Identity = 22/50 (44.00%), Postives = 25/50 (50.00%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKS 791
            WG WS W  CS  C  GT++R R C    P      C G   +TQ CGKS
Sbjct:  459 WGPWSEWTPCSTNCLGGTRNRYRFCDSPPPRYGAKFCEGPSVETQKCGKS 508          
BLAST of PKD1L-2 vs. Ensembl Zebrafish
Match: hmcn1 (hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322])

HSP 1 Score: 99.3673 bits (246), Expect = 2.009e-22
Identity = 72/160 (45.00%), Postives = 89/160 (55.62%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            V+CG GT  R R C NP P +GG  C  +      C N  CPI  +WG W+SW +CS TCN G   R R C +  P+N G  C G+D   Q C  +  CP++G WSSW +W  CS SCG      R RLCN+P+PSN+G+ C G ST    C   P  CP
Sbjct: 4690 VSCGGGTRQRTRICANPTPQHGGRQCEGNDIHIDFCNNEPCPIHGNWGPWNSWGSCSRTCNGGQMRRYRTCDNPRPANGGRACTGSDSQIQKCNTAN-CPVDGKWSSWESWGECSASCGGGE-RTRVRLCNSPSPSNSGRPCPGDSTQLSRCNLQP--CP 4845          

HSP 2 Score: 95.9005 bits (237), Expect = 3.148e-21
Identity = 67/159 (42.14%), Postives = 86/159 (54.09%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            TCG G   R R C NP P+  G SC    TQ Q C    CP+   W  W SW ACSV+C  GT+ R+R+C +P+  + G  C G D     C     CPI+GNW  W++W SCS +C     M+R R C+NP P+N G+ C+G  +  Q C     NCP
Sbjct: 4634 TCGKGMQTRLRLCNNPPPSFEGPSCEGPDTQTQVCNERNCPVDGKWSSWVSWGACSVSCGGGTRQRTRICANPTPQHGGRQCEGNDIHIDFCNNEP-CPIHGNWGPWNSWGSCSRTCNGGQ-MRRYRTCDNPRPANGGRACTGSDSQIQKCNTA--NCP 4788          

HSP 3 Score: 70.4774 bits (171), Expect = 7.344e-13
Identity = 61/160 (38.12%), Postives = 74/160 (46.25%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            V+CG G   R R C  P PANGG  C  S+++ + C    CP+  SW EWSSW  CS TC  G ++R R C +P   + G  C G   +   C     CP+           S        G+  R RLCNNP PS  G  C G  T TQ C     NCP
Sbjct: 4519 VSCGTGVQRRLRQCNKPFPANGGRHCVGSASETRRCQGKPCPVDGSWSEWSSWEECSRTCGQGNRTRVRTCSNPPAQHGGRACEGKAVEAIMCSIRP-CPV-AGNWGAWLPWSPCSETCGKGMQTRLRLCNNPPPSFEGPSCEGPDTQTQVCNE--RNCP 4674          

HSP 4 Score: 51.9878 bits (123), Expect = 7.214e-7
Identity = 44/114 (38.60%), Postives = 62/114 (54.39%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            + EW  W ACSV+C  G Q R R C    P+N G  C G+  +T+ C +   CP++G+WS WS+W  CS +CG      R R C+NP   + G+ C G + +   C+  P  CP
Sbjct: 4508 FSEWMEWGACSVSCGTGVQRRLRQCNKPFPANGGRHCVGSASETRRC-QGKPCPVDGSWSEWSSWEECSRTCGQGN-RTRVRTCSNPPAQHGGRACEGKAVEAIMCSIRP--CP 4617          
BLAST of PKD1L-2 vs. Ensembl Zebrafish
Match: hmcn1 (hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322])

HSP 1 Score: 99.3673 bits (246), Expect = 2.028e-22
Identity = 72/160 (45.00%), Postives = 89/160 (55.62%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            V+CG GT  R R C NP P +GG  C  +      C N  CPI  +WG W+SW +CS TCN G   R R C +  P+N G  C G+D   Q C  +  CP++G WSSW +W  CS SCG      R RLCN+P+PSN+G+ C G ST    C   P  CP
Sbjct: 4692 VSCGGGTRQRTRICANPTPQHGGRQCEGNDIHIDFCNNEPCPIHGNWGPWNSWGSCSRTCNGGQMRRYRTCDNPRPANGGRACTGSDSQIQKCNTAN-CPVDGKWSSWESWGECSASCGGGE-RTRVRLCNSPSPSNSGRPCPGDSTQLSRCNLQP--CP 4847          

HSP 2 Score: 95.9005 bits (237), Expect = 3.207e-21
Identity = 67/159 (42.14%), Postives = 86/159 (54.09%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            TCG G   R R C NP P+  G SC    TQ Q C    CP+   W  W SW ACSV+C  GT+ R+R+C +P+  + G  C G D     C     CPI+GNW  W++W SCS +C     M+R R C+NP P+N G+ C+G  +  Q C     NCP
Sbjct: 4636 TCGKGMQTRLRLCNNPPPSFEGPSCEGPDTQTQVCNERNCPVDGKWSSWVSWGACSVSCGGGTRQRTRICANPTPQHGGRQCEGNDIHIDFCNNEP-CPIHGNWGPWNSWGSCSRTCNGGQ-MRRYRTCDNPRPANGGRACTGSDSQIQKCNTA--NCP 4790          

HSP 3 Score: 70.4774 bits (171), Expect = 7.479e-13
Identity = 61/160 (38.12%), Postives = 74/160 (46.25%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            V+CG G   R R C  P PANGG  C  S+++ + C    CP+  SW EWSSW  CS TC  G ++R R C +P   + G  C G   +   C     CP+           S        G+  R RLCNNP PS  G  C G  T TQ C     NCP
Sbjct: 4521 VSCGTGVQRRLRQCNKPFPANGGRHCVGSASETRRCQGKPCPVDGSWSEWSSWEECSRTCGQGNRTRVRTCSNPPAQHGGRACEGKAVEAIMCSIRP-CPV-AGNWGAWLPWSPCSETCGKGMQTRLRLCNNPPPSFEGPSCEGPDTQTQVCNE--RNCP 4676          

HSP 4 Score: 51.9878 bits (123), Expect = 7.278e-7
Identity = 44/114 (38.60%), Postives = 62/114 (54.39%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            + EW  W ACSV+C  G Q R R C    P+N G  C G+  +T+ C +   CP++G+WS WS+W  CS +CG      R R C+NP   + G+ C G + +   C+  P  CP
Sbjct: 4510 FSEWMEWGACSVSCGTGVQRRLRQCNKPFPANGGRHCVGSASETRRC-QGKPCPVDGSWSEWSSWEECSRTCGQGN-RTRVRTCSNPPAQHGGRACEGKAVEAIMCSIRP--CP 4619          
BLAST of PKD1L-2 vs. Ensembl Zebrafish
Match: thbs2a (thrombospondin 2a [Source:ZFIN;Acc:ZDB-GENE-020708-2])

HSP 1 Score: 89.7373 bits (221), Expect = 2.799e-19
Identity = 48/101 (47.52%), Postives = 55/101 (54.46%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVC--IDPSNSGLTCPGTDKDTQACGKSTLCPI 806
            VTCG G   R R C +P P  GG  C  S  + Q C    CPI  +WG WS WA CSVTC  GT++R+RVC    P   G  CPG   DT AC K   CP+
Sbjct:  448 VTCGEGQITRIRHCNSPVPQLGGKDCEGSGRETQKCEAKPCPIDGAWGPWSPWAVCSVTCGGGTRTRTRVCNSPRPQYGGKKCPGDSVDTNACNKQD-CPV 547          

HSP 2 Score: 65.855 bits (159), Expect = 2.282e-11
Identity = 60/159 (37.74%), Postives = 80/159 (50.31%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VTCG GT  R R+C   +    G S          C +       W  WS W++CSVTC  G  +R R C  P     G  C G+ ++TQ C ++  CPI+G W  WS W+ CSV+CG      R+R+CN+P P   G+ C G S DT +C     +CP
Sbjct:  392 VTCGTGTQQRGRSCDATSNPCSGPSIQTRRCSLGKCDSRVRQDGGWSLWSPWSSCSVTCGEGQITRIRHCNSPVPQLGGKDCEGSGRETQKC-EAKPCPIDGAWGPWSPWAVCSVTCGGG-TRTRTRVCNSPRPQYGGKKCPGDSVDTNACNK--QDCP 546          

HSP 3 Score: 52.7582 bits (125), Expect = 4.460e-7
Identity = 41/114 (35.96%), Postives = 48/114 (42.11%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQAC--GKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            W  WS W  C+VTC  GTQ R R C   SN    C G    T+ C  GK           S  +  S        G + R R CN+P P   G+DC G   +TQ C   P  CP
Sbjct:  381 WSPWSEWTECTVTCGTGTQQRGRSCDATSNP---CSGPSIQTRRCSLGKCDSRVRQDGGWSLWSPWSSCSVTCGEGQITRIRHCNSPVPQLGGKDCEGSGRETQKCEAKP--CP 489          
BLAST of PKD1L-2 vs. Ensembl Zebrafish
Match: thbs2a (thrombospondin 2a [Source:ZFIN;Acc:ZDB-GENE-020708-2])

HSP 1 Score: 89.7373 bits (221), Expect = 3.127e-19
Identity = 48/101 (47.52%), Postives = 55/101 (54.46%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVC--IDPSNSGLTCPGTDKDTQACGKSTLCPI 806
            VTCG G   R R C +P P  GG  C  S  + Q C    CPI  +WG WS WA CSVTC  GT++R+RVC    P   G  CPG   DT AC K   CP+
Sbjct:  454 VTCGEGQITRIRHCNSPVPQLGGKDCEGSGRETQKCEAKPCPIDGAWGPWSPWAVCSVTCGGGTRTRTRVCNSPRPQYGGKKCPGDSVDTNACNKQD-CPV 553          

HSP 2 Score: 65.855 bits (159), Expect = 2.660e-11
Identity = 60/159 (37.74%), Postives = 80/159 (50.31%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VTCG GT  R R+C   +    G S          C +       W  WS W++CSVTC  G  +R R C  P     G  C G+ ++TQ C ++  CPI+G W  WS W+ CSV+CG      R+R+CN+P P   G+ C G S DT +C     +CP
Sbjct:  398 VTCGTGTQQRGRSCDATSNPCSGPSIQTRRCSLGKCDSRVRQDGGWSLWSPWSSCSVTCGEGQITRIRHCNSPVPQLGGKDCEGSGRETQKC-EAKPCPIDGAWGPWSPWAVCSVTCGGG-TRTRTRVCNSPRPQYGGKKCPGDSVDTNACNK--QDCP 552          

HSP 3 Score: 52.373 bits (124), Expect = 5.183e-7
Identity = 41/114 (35.96%), Postives = 48/114 (42.11%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQAC--GKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            W  WS W  C+VTC  GTQ R R C   SN    C G    T+ C  GK           S  +  S        G + R R CN+P P   G+DC G   +TQ C   P  CP
Sbjct:  387 WSPWSEWTECTVTCGTGTQQRGRSCDATSNP---CSGPSIQTRRCSLGKCDSRVRQDGGWSLWSPWSSCSVTCGEGQITRIRHCNSPVPQLGGKDCEGSGRETQKCEAKP--CP 495          
BLAST of PKD1L-2 vs. Ensembl Zebrafish
Match: thbs2a (thrombospondin 2a [Source:ZFIN;Acc:ZDB-GENE-020708-2])

HSP 1 Score: 89.7373 bits (221), Expect = 3.300e-19
Identity = 48/101 (47.52%), Postives = 55/101 (54.46%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVC--IDPSNSGLTCPGTDKDTQACGKSTLCPI 806
            VTCG G   R R C +P P  GG  C  S  + Q C    CPI  +WG WS WA CSVTC  GT++R+RVC    P   G  CPG   DT AC K   CP+
Sbjct:  433 VTCGEGQITRIRHCNSPVPQLGGKDCEGSGRETQKCEAKPCPIDGAWGPWSPWAVCSVTCGGGTRTRTRVCNSPRPQYGGKKCPGDSVDTNACNKQD-CPV 532          

HSP 2 Score: 65.855 bits (159), Expect = 2.217e-11
Identity = 60/159 (37.74%), Postives = 80/159 (50.31%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VTCG GT  R R+C   +    G S          C +       W  WS W++CSVTC  G  +R R C  P     G  C G+ ++TQ C ++  CPI+G W  WS W+ CSV+CG      R+R+CN+P P   G+ C G S DT +C     +CP
Sbjct:  377 VTCGTGTQQRGRSCDATSNPCSGPSIQTRRCSLGKCDSRVRQDGGWSLWSPWSSCSVTCGEGQITRIRHCNSPVPQLGGKDCEGSGRETQKC-EAKPCPIDGAWGPWSPWAVCSVTCGGG-TRTRTRVCNSPRPQYGGKKCPGDSVDTNACNK--QDCP 531          

HSP 3 Score: 52.373 bits (124), Expect = 4.532e-7
Identity = 41/114 (35.96%), Postives = 48/114 (42.11%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQAC--GKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            W  WS W  C+VTC  GTQ R R C   SN    C G    T+ C  GK           S  +  S        G + R R CN+P P   G+DC G   +TQ C   P  CP
Sbjct:  366 WSPWSEWTECTVTCGTGTQQRGRSCDATSNP---CSGPSIQTRRCSLGKCDSRVRQDGGWSLWSPWSSCSVTCGEGQITRIRHCNSPVPQLGGKDCEGSGRETQKCEAKP--CP 474          
BLAST of PKD1L-2 vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 98.5969 bits (244), Expect = 5.867e-22
Identity = 62/151 (41.06%), Postives = 88/151 (58.28%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            TC  GT +R R C NP P+  G+ C    TQ Q C +  CP+   W  W SW +CS++C  G + R+R C +P+    G  C G + + + C  + LCP++GNW  WS W SCS +C     M+R R C+NPAPS++G+ C+G  T+T  C
Sbjct: 4540 TCWKGTKMRVRLCNNPTPSPDGLPCEGQDTQMQICGDRQCPVDGKWSAWGSWTSCSLSCGGGLRQRTRACSNPAPQYGGHKCEGNEHENEMC-NADLCPVHGNWGPWSHWGSCSRTCNGGQ-MRRYRACDNPAPSHSGRACTGTDTETNKC 4688          

HSP 2 Score: 96.2857 bits (238), Expect = 3.684e-21
Identity = 64/152 (42.11%), Postives = 81/152 (53.29%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            VTCG G   R R C NP PANGG  C  + T+ ++C N  CP+  +W EWS+W  CS +C +G ++R R C DP     G  C G   D   C     CP++G W  W +W +C+ +C     M R RLCNNP PS  G  C G  T  Q C
Sbjct: 4425 VTCGQGIQRRIRLCDNPLPANGGNYCQGAETETRSCQNKLCPVDGNWSEWSTWEECSRSCGSGKRTRVRTCSDPPAQEGGKPCIGKAVDVAVCNVKP-CPVHGMWGPWQSWGACTKTCWKGTKM-RVRLCNNPTPSPDGLPCEGQDTQMQIC 4574          

HSP 3 Score: 92.0485 bits (227), Expect = 7.718e-20
Identity = 67/152 (44.08%), Postives = 87/152 (57.24%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            ++CG G   R R C+NPAP  GG  C  +  + + C    CP+  +WG WS W +CS TCN G   R R C +  PS+SG  C GTD +T  C  + LCP +GNW  W  WS CSVSCG    + R+R+C++PA S  G+ C G ST    C
Sbjct: 4596 LSCGGGLRQRTRACSNPAPQYGGHKCEGNEHENEMCNADLCPVHGNWGPWSHWGSCSRTCNGGQMRRYRACDNPAPSHSGRACTGTDTETNKC-NTDLCPAHGNWGQWEAWSKCSVSCGGGEQI-RTRVCHHPARSYTGRPCPGDSTQLLRC 4745          

HSP 4 Score: 55.0694 bits (131), Expect = 1.178e-7
Identity = 49/114 (42.98%), Postives = 66/114 (57.89%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            + EW  W +CSVTC  G Q R R+C +  P+N G  C G + +T++C ++ LCP++GNWS WSTW  CS SCGS     R R C++P     G+ C G + D   C   P  CP
Sbjct: 4414 FSEWLPWQSCSVTCGQGIQRRIRLCDNPLPANGGNYCQGAETETRSC-QNKLCPVDGNWSEWSTWEECSRSCGSGK-RTRVRTCSDPPAQEGGKPCIGKAVDVAVCNVKP--CP 4523          
BLAST of PKD1L-2 vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 98.5969 bits (244), Expect = 5.867e-22
Identity = 62/151 (41.06%), Postives = 88/151 (58.28%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            TC  GT +R R C NP P+  G+ C    TQ Q C +  CP+   W  W SW +CS++C  G + R+R C +P+    G  C G + + + C  + LCP++GNW  WS W SCS +C     M+R R C+NPAPS++G+ C+G  T+T  C
Sbjct: 4539 TCWKGTKMRVRLCNNPTPSPDGLPCEGQDTQMQICGDRQCPVDGKWSAWGSWTSCSLSCGGGLRQRTRACSNPAPQYGGHKCEGNEHENEMC-NADLCPVHGNWGPWSHWGSCSRTCNGGQ-MRRYRACDNPAPSHSGRACTGTDTETNKC 4687          

HSP 2 Score: 96.2857 bits (238), Expect = 3.451e-21
Identity = 64/152 (42.11%), Postives = 81/152 (53.29%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            VTCG G   R R C NP PANGG  C  + T+ ++C N  CP+  +W EWS+W  CS +C +G ++R R C DP     G  C G   D   C     CP++G W  W +W +C+ +C     M R RLCNNP PS  G  C G  T  Q C
Sbjct: 4424 VTCGQGIQRRIRLCDNPLPANGGNYCQGAETETRSCQNKLCPVDGNWSEWSTWEECSRSCGSGKRTRVRTCSDPPAQEGGKPCIGKAVDVAVCNVKP-CPVHGMWGPWQSWGACTKTCWKGTKM-RVRLCNNPTPSPDGLPCEGQDTQMQIC 4573          

HSP 3 Score: 92.0485 bits (227), Expect = 7.647e-20
Identity = 67/152 (44.08%), Postives = 87/152 (57.24%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            ++CG G   R R C+NPAP  GG  C  +  + + C    CP+  +WG WS W +CS TCN G   R R C +  PS+SG  C GTD +T  C  + LCP +GNW  W  WS CSVSCG    + R+R+C++PA S  G+ C G ST    C
Sbjct: 4595 LSCGGGLRQRTRACSNPAPQYGGHKCEGNEHENEMCNADLCPVHGNWGPWSHWGSCSRTCNGGQMRRYRACDNPAPSHSGRACTGTDTETNKC-NTDLCPAHGNWGQWEAWSKCSVSCGGGEQI-RTRVCHHPARSYTGRPCPGDSTQLLRC 4744          

HSP 4 Score: 55.0694 bits (131), Expect = 1.167e-7
Identity = 49/114 (42.98%), Postives = 66/114 (57.89%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            + EW  W +CSVTC  G Q R R+C +  P+N G  C G + +T++C ++ LCP++GNWS WSTW  CS SCGS     R R C++P     G+ C G + D   C   P  CP
Sbjct: 4413 FSEWLPWQSCSVTCGQGIQRRIRLCDNPLPANGGNYCQGAETETRSC-QNKLCPVDGNWSEWSTWEECSRSCGSGK-RTRVRTCSDPPAQEGGKPCIGKAVDVAVCNVKP--CP 4522          
BLAST of PKD1L-2 vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 98.2117 bits (243), Expect = 6.563e-22
Identity = 62/151 (41.06%), Postives = 88/151 (58.28%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            TC  GT +R R C NP P+  G+ C    TQ Q C +  CP+   W  W SW +CS++C  G + R+R C +P+    G  C G + + + C  + LCP++GNW  WS W SCS +C     M+R R C+NPAPS++G+ C+G  T+T  C
Sbjct: 4579 TCWKGTKMRVRLCNNPTPSPDGLPCEGQDTQMQICGDRQCPVDGKWSAWGSWTSCSLSCGGGLRQRTRACSNPAPQYGGHKCEGNEHENEMC-NADLCPVHGNWGPWSHWGSCSRTCNGGQ-MRRYRACDNPAPSHSGRACTGTDTETNKC 4727          

HSP 2 Score: 96.2857 bits (238), Expect = 3.719e-21
Identity = 64/152 (42.11%), Postives = 81/152 (53.29%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            VTCG G   R R C NP PANGG  C  + T+ ++C N  CP+  +W EWS+W  CS +C +G ++R R C DP     G  C G   D   C     CP++G W  W +W +C+ +C     M R RLCNNP PS  G  C G  T  Q C
Sbjct: 4464 VTCGQGIQRRIRLCDNPLPANGGNYCQGAETETRSCQNKLCPVDGNWSEWSTWEECSRSCGSGKRTRVRTCSDPPAQEGGKPCIGKAVDVAVCNVKP-CPVHGMWGPWQSWGACTKTCWKGTKM-RVRLCNNPTPSPDGLPCEGQDTQMQIC 4613          

HSP 3 Score: 92.0485 bits (227), Expect = 8.629e-20
Identity = 67/152 (44.08%), Postives = 87/152 (57.24%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            ++CG G   R R C+NPAP  GG  C  +  + + C    CP+  +WG WS W +CS TCN G   R R C +  PS+SG  C GTD +T  C  + LCP +GNW  W  WS CSVSCG    + R+R+C++PA S  G+ C G ST    C
Sbjct: 4635 LSCGGGLRQRTRACSNPAPQYGGHKCEGNEHENEMCNADLCPVHGNWGPWSHWGSCSRTCNGGQMRRYRACDNPAPSHSGRACTGTDTETNKC-NTDLCPAHGNWGQWEAWSKCSVSCGGGEQI-RTRVCHHPARSYTGRPCPGDSTQLLRC 4784          

HSP 4 Score: 55.0694 bits (131), Expect = 1.220e-7
Identity = 49/114 (42.98%), Postives = 66/114 (57.89%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            + EW  W +CSVTC  G Q R R+C +  P+N G  C G + +T++C ++ LCP++GNWS WSTW  CS SCGS     R R C++P     G+ C G + D   C   P  CP
Sbjct: 4453 FSEWLPWQSCSVTCGQGIQRRIRLCDNPLPANGGNYCQGAETETRSC-QNKLCPVDGNWSEWSTWEECSRSCGSGK-RTRVRTCSDPPAQEGGKPCIGKAVDVAVCNVKP--CP 4562          
BLAST of PKD1L-2 vs. Ensembl Xenopus
Match: galnt4 (polypeptide N-acetylgalactosaminyltransferase 4 [Source:Xenbase;Acc:XB-GENE-5803663])

HSP 1 Score: 76.6406 bits (187), Expect = 9.348e-15
Identity = 61/153 (39.87%), Postives = 84/153 (54.90%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLA-CPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTN 965
            VTCG G+ +R RTC  P     G  C+    + + C N A CP+   W EWS W+ CS TC  G ++R+R C  P   G  C G +   + C  + LCP++G W  WS WS CSV+C +    +R R C +PA S+ G DC G  ++T+ C N
Sbjct:  274 VTCGQGSQVRTRTCVPPY----GTHCSSPLRETRVCNNTALCPVHGVWEEWSPWSLCSFTCGRGQRTRTRSCTPPQYGGRHCEGLEMQHKPCNIA-LCPVDGLWQEWSAWSQCSVTCSNGT-QKRQREC-SPA-SHGGSDCKGPYSETRECHN 418          

HSP 2 Score: 63.5438 bits (153), Expect = 1.724e-10
Identity = 35/98 (35.71%), Postives = 52/98 (53.06%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPI-ISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            VTC NGT  RQR C+ PA ++GG  C    ++ + C N  C     W  W  W+ CS +C+ G + R+R C   S +G  C G+ ++ + C +   CP
Sbjct:  383 VTCSNGTQKRQRECS-PA-SHGGSDCKGPYSETRECHNQECTANGQWNPWGHWSGCSRSCDGGWEKRTRSCQGASITGHQCEGSGEEVRRCNEQR-CP 477          

HSP 3 Score: 56.225 bits (134), Expect = 4.920e-8
Identity = 45/110 (40.91%), Postives = 61/110 (55.45%), Query Frame = 3
Query:  654 EWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            EWS W+ CSVTC  G+Q R+R C+ P   G  C    ++T+ C  + LCP++G W  WS WS CS +CG     QR+R  +   P   G+ C GL    + C N+ L CP
Sbjct:  265 EWSQWSTCSVTCGQGSQVRTRTCVPP--YGTHCSSPLRETRVCNNTALCPVHGVWEEWSPWSLCSFTCGRG---QRTRTRSCTPPQYGGRHCEGLEMQHKPC-NIAL-CP 367          
BLAST of PKD1L-2 vs. Ensembl Xenopus
Match: galnt4 (polypeptide N-acetylgalactosaminyltransferase 4 [Source:Xenbase;Acc:XB-GENE-5803663])

HSP 1 Score: 76.6406 bits (187), Expect = 1.089e-14
Identity = 61/153 (39.87%), Postives = 84/153 (54.90%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLA-CPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTN 965
            VTCG G+ +R RTC  P     G  C+    + + C N A CP+   W EWS W+ CS TC  G ++R+R C  P   G  C G +   + C  + LCP++G W  WS WS CSV+C +    +R R C +PA S+ G DC G  ++T+ C N
Sbjct:  281 VTCGQGSQVRTRTCVPPY----GTHCSSPLRETRVCNNTALCPVHGVWEEWSPWSLCSFTCGRGQRTRTRSCTPPQYGGRHCEGLEMQHKPCNIA-LCPVDGLWQEWSAWSQCSVTCSNGT-QKRQREC-SPA-SHGGSDCKGPYSETRECHN 425          

HSP 2 Score: 63.929 bits (154), Expect = 1.658e-10
Identity = 35/98 (35.71%), Postives = 52/98 (53.06%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPI-ISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            VTC NGT  RQR C+ PA ++GG  C    ++ + C N  C     W  W  W+ CS +C+ G + R+R C   S +G  C G+ ++ + C +   CP
Sbjct:  390 VTCSNGTQKRQRECS-PA-SHGGSDCKGPYSETRECHNQECTANGQWNPWGHWSGCSRSCDGGWEKRTRSCQGASITGHQCEGSGEEVRRCNEQR-CP 484          

HSP 3 Score: 55.8398 bits (133), Expect = 5.703e-8
Identity = 45/110 (40.91%), Postives = 61/110 (55.45%), Query Frame = 3
Query:  654 EWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            EWS W+ CSVTC  G+Q R+R C+ P   G  C    ++T+ C  + LCP++G W  WS WS CS +CG     QR+R  +   P   G+ C GL    + C N+ L CP
Sbjct:  272 EWSQWSTCSVTCGQGSQVRTRTCVPP--YGTHCSSPLRETRVCNNTALCPVHGVWEEWSPWSLCSFTCGRG---QRTRTRSCTPPQYGGRHCEGLEMQHKPC-NIAL-CP 374          
BLAST of PKD1L-2 vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 97.8265 bits (242), Expect = 7.645e-22
Identity = 69/160 (43.12%), Postives = 87/160 (54.37%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VTCG G   R R C NP PANGG  C  + ++ + C N  CP+   W EWS W  CS +C +G Q+R+R C +P   + G  C G   +T  C     CP++G W++W  WS+CS SCG      R RLCNNP PS  G  CSG  T  Q C     +CP
Sbjct: 4542 VTCGKGIQKRSRLCDNPPPANGGRPCQGADSEARHCHNKLCPVDGHWSEWSFWEDCSRSCGHGNQTRTRTCSNPPAQHGGRPCEGHAVETIMCNIRP-CPVHGVWNAWQPWSACSKSCGKGS-QTRMRLCNNPPPSFGGAHCSGAETQMQVCNE--RHCP 4697          

HSP 2 Score: 95.1301 bits (235), Expect = 5.941e-21
Identity = 66/151 (43.71%), Postives = 84/151 (55.63%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            +CG G+  R R C NP P+ GG  C+ + TQ Q C    CP+   W  WSSW+AC+V+C  G + R+R C D  P   G  C GT   +  C  S  CP +GNWS WS W +CS +C     M+R R C+NP PSN G+ C G  T  Q C
Sbjct: 4657 SCGKGSQTRMRLCNNPPPSFGGAHCSGAETQMQVCNERHCPVDGRWATWSSWSACTVSCGGGARKRTRDCSDPVPQYGGNKCEGTGVQSDFC-NSDPCPTHGNWSPWSGWGTCSRTCNGGQ-MRRYRTCDNPRPSNGGRACGGPDTQIQRC 4805          

HSP 3 Score: 87.4261 bits (215), Expect = 2.499e-18
Identity = 63/152 (41.45%), Postives = 81/152 (53.29%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            V+CG G   R R C++P P  GG  C  +  Q   C +  CP   +W  WS W  CS TCN G   R R C +  PSN G  C G D   Q C  + +CP++G+W +W +WS CSVSCG      R RLC+NP P+  G+ C G +T    C
Sbjct: 4713 VSCGGGARKRTRDCSDPVPQYGGNKCEGTGVQSDFCNSDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPRPSNGGRACGGPDTQIQRC-NTDMCPVDGSWGTWHSWSHCSVSCGGGE-RTRKRLCDNPVPTKGGRSCPGDATQVSRC 4862          

HSP 4 Score: 79.7221 bits (195), Expect = 7.225e-16
Identity = 59/159 (37.11%), Postives = 87/159 (54.72%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            +CG+G   R RTC+NP   +GG  C   + +   C    CP+   W  W  W+ACS +C  G+Q+R R+C +P  S  G  C G +   Q C +   CP++G W++WS+WS+C+VSCG     +R+R C++P P   G  C G    +  C + P  CP
Sbjct: 4600 SCGHGNQTRTRTCSNPPAQHGGRPCEGHAVETIMCNIRPCPVHGVWNAWQPWSACSKSCGKGSQTRMRLCNNPPPSFGGAHCSGAETQMQVCNERH-CPVDGRWATWSSWSACTVSCGGGA-RKRTRDCSDPVPQYGGNKCEGTGVQSDFCNSDP--CP 4754          

HSP 5 Score: 60.077 bits (144), Expect = 2.226e-9
Identity = 48/111 (43.24%), Postives = 64/111 (57.66%), Query Frame = 3
Query:  657 WSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            WS+W  CSVTC  G Q RSR+C +  P+N G  C G D + + C  + LCP++G+WS WS W  CS SCG      R+R C+NP   + G+ C G + +T  C   P  CP
Sbjct: 4534 WSAWRPCSVTCGKGIQKRSRLCDNPPPANGGRPCQGADSEARHC-HNKLCPVDGHWSEWSFWEDCSRSCGHGN-QTRTRTCSNPPAQHGGRPCEGHAVETIMCNIRP--CP 4640          
BLAST of PKD1L-2 vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 97.4413 bits (241), Expect = 8.867e-22
Identity = 69/160 (43.12%), Postives = 87/160 (54.37%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VTCG G   R R C NP PANGG  C  + ++ + C N  CP+   W EWS W  CS +C +G Q+R+R C +P   + G  C G   +T  C     CP++G W++W  WS+CS SCG      R RLCNNP PS  G  CSG  T  Q C     +CP
Sbjct: 4542 VTCGKGIQKRSRLCDNPPPANGGRPCQGADSEARHCHNKLCPVDGHWSEWSFWEDCSRSCGHGNQTRTRTCSNPPAQHGGRPCEGHAVETIMCNIRP-CPVHGVWNAWQPWSACSKSCGKGS-QTRMRLCNNPPPSFGGAHCSGAETQMQVCNE--RHCP 4697          

HSP 2 Score: 95.1301 bits (235), Expect = 6.103e-21
Identity = 66/151 (43.71%), Postives = 84/151 (55.63%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            +CG G+  R R C NP P+ GG  C+ + TQ Q C    CP+   W  WSSW+AC+V+C  G + R+R C D  P   G  C GT   +  C  S  CP +GNWS WS W +CS +C     M+R R C+NP PSN G+ C G  T  Q C
Sbjct: 4657 SCGKGSQTRMRLCNNPPPSFGGAHCSGAETQMQVCNERHCPVDGRWATWSSWSACTVSCGGGARKRTRDCSDPVPQYGGNKCEGTGVQSDFC-NSDPCPTHGNWSPWSGWGTCSRTCNGGQ-MRRYRTCDNPRPSNGGRACGGPDTQIQRC 4805          

HSP 3 Score: 87.0409 bits (214), Expect = 2.688e-18
Identity = 63/152 (41.45%), Postives = 81/152 (53.29%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            V+CG G   R R C++P P  GG  C  +  Q   C +  CP   +W  WS W  CS TCN G   R R C +  PSN G  C G D   Q C  + +CP++G+W +W +WS CSVSCG      R RLC+NP P+  G+ C G +T    C
Sbjct: 4713 VSCGGGARKRTRDCSDPVPQYGGNKCEGTGVQSDFCNSDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPRPSNGGRACGGPDTQIQRC-NTDMCPVDGSWGTWHSWSHCSVSCGGGE-RTRKRLCDNPVPTKGGRSCPGDATQVSRC 4862          

HSP 4 Score: 79.7221 bits (195), Expect = 7.985e-16
Identity = 59/159 (37.11%), Postives = 87/159 (54.72%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            +CG+G   R RTC+NP   +GG  C   + +   C    CP+   W  W  W+ACS +C  G+Q+R R+C +P  S  G  C G +   Q C +   CP++G W++WS+WS+C+VSCG     +R+R C++P P   G  C G    +  C + P  CP
Sbjct: 4600 SCGHGNQTRTRTCSNPPAQHGGRPCEGHAVETIMCNIRPCPVHGVWNAWQPWSACSKSCGKGSQTRMRLCNNPPPSFGGAHCSGAETQMQVCNERH-CPVDGRWATWSSWSACTVSCGGGA-RKRTRDCSDPVPQYGGNKCEGTGVQSDFCNSDP--CP 4754          

HSP 5 Score: 60.077 bits (144), Expect = 2.306e-9
Identity = 48/111 (43.24%), Postives = 64/111 (57.66%), Query Frame = 3
Query:  657 WSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            WS+W  CSVTC  G Q RSR+C +  P+N G  C G D + + C  + LCP++G+WS WS W  CS SCG      R+R C+NP   + G+ C G + +T  C   P  CP
Sbjct: 4534 WSAWRPCSVTCGKGIQKRSRLCDNPPPANGGRPCQGADSEARHC-HNKLCPVDGHWSEWSFWEDCSRSCGHGN-QTRTRTCSNPPAQHGGRPCEGHAVETIMCNIRP--CP 4640          
BLAST of PKD1L-2 vs. Ensembl Mouse
Match: Adgrb2 (adhesion G protein-coupled receptor B2 [Source:MGI Symbol;Acc:MGI:2451244])

HSP 1 Score: 83.1889 bits (204), Expect = 5.365e-17
Identity = 60/159 (37.74%), Postives = 86/159 (54.09%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLA-CPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            +TCG G  +R R+C +   +  G  C+    + + C N A CP+   W EW SW+ CS +C  G++SR R C+ P + G  C G +  T+ C  +  CP+ G W  W  W  CS SC +    QRSR C+   P+ A   C+G  TDT+ C+N  L+CP
Sbjct:  314 LTCGQGLQVRTRSCVS---SPYGTLCSGPLRETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGPELQTKLCSMAA-CPVEGQWLEWGPWGPCSSSCANGT-QQRSRKCSVAGPAWA--TCAGALTDTRECSN--LDCP 463          

HSP 2 Score: 72.7886 bits (177), Expect = 1.599e-13
Identity = 36/98 (36.73%), Postives = 50/98 (51.02%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII--SWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            +C NGT  R R C+   PA    +C  + T  + C NL CP     WG W++W+ CS TC+ G Q R R+C      G  C GT ++ + C +   CP
Sbjct:  425 SCANGTQQRSRKCSVAGPA--WATCAGALTDTRECSNLDCPATDGKWGPWNAWSLCSKTCDTGWQRRFRMCQASGTQGYPCEGTGEEVKPCSEKR-CP 519          

HSP 3 Score: 55.4546 bits (132), Expect = 6.467e-8
Identity = 43/110 (39.09%), Postives = 58/110 (52.73%), Query Frame = 3
Query:  654 EWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            EWS W+ CS+TC  G Q R+R C+  S  G  C G  ++T+ C  S  CP++G W  W +WS CS SCG      RSR+     P + G+ C G    T+ C+     CP
Sbjct:  305 EWSPWSVCSLTCGQGLQVRTRSCVS-SPYGTLCSGPLRETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRG---SRSRMRTCVPPQHGGKACEGPELQTKLCSMAA--CP 408          
BLAST of PKD1L-2 vs. Ensembl Mouse
Match: Adgrb2 (adhesion G protein-coupled receptor B2 [Source:MGI Symbol;Acc:MGI:2451244])

HSP 1 Score: 83.1889 bits (204), Expect = 5.886e-17
Identity = 60/159 (37.74%), Postives = 86/159 (54.09%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLA-CPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            +TCG G  +R R+C +   +  G  C+    + + C N A CP+   W EW SW+ CS +C  G++SR R C+ P + G  C G +  T+ C  +  CP+ G W  W  W  CS SC +    QRSR C+   P+ A   C+G  TDT+ C+N  L+CP
Sbjct:  314 LTCGQGLQVRTRSCVS---SPYGTLCSGPLRETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGPELQTKLCSMAA-CPVEGQWLEWGPWGPCSSSCANGT-QQRSRKCSVAGPAWA--TCAGALTDTRECSN--LDCP 463          

HSP 2 Score: 72.4034 bits (176), Expect = 1.705e-13
Identity = 36/98 (36.73%), Postives = 50/98 (51.02%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII--SWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            +C NGT  R R C+   PA    +C  + T  + C NL CP     WG W++W+ CS TC+ G Q R R+C      G  C GT ++ + C +   CP
Sbjct:  425 SCANGTQQRSRKCSVAGPA--WATCAGALTDTRECSNLDCPATDGKWGPWNAWSLCSKTCDTGWQRRFRMCQASGTQGYPCEGTGEEVKPCSEKR-CP 519          

HSP 3 Score: 55.4546 bits (132), Expect = 6.946e-8
Identity = 43/110 (39.09%), Postives = 58/110 (52.73%), Query Frame = 3
Query:  654 EWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            EWS W+ CS+TC  G Q R+R C+  S  G  C G  ++T+ C  S  CP++G W  W +WS CS SCG      RSR+     P + G+ C G    T+ C+     CP
Sbjct:  305 EWSPWSVCSLTCGQGLQVRTRSCVS-SPYGTLCSGPLRETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRG---SRSRMRTCVPPQHGGKACEGPELQTKLCSMAA--CP 408          
BLAST of PKD1L-2 vs. Ensembl Mouse
Match: Adgrb2 (adhesion G protein-coupled receptor B2 [Source:MGI Symbol;Acc:MGI:2451244])

HSP 1 Score: 82.8037 bits (203), Expect = 6.969e-17
Identity = 60/159 (37.74%), Postives = 86/159 (54.09%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLA-CPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            +TCG G  +R R+C +   +  G  C+    + + C N A CP+   W EW SW+ CS +C  G++SR R C+ P + G  C G +  T+ C  +  CP+ G W  W  W  CS SC +    QRSR C+   P+ A   C+G  TDT+ C+N  L+CP
Sbjct:  314 LTCGQGLQVRTRSCVS---SPYGTLCSGPLRETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGPELQTKLCSMAA-CPVEGQWLEWGPWGPCSSSCANGT-QQRSRKCSVAGPAWA--TCAGALTDTRECSN--LDCP 463          

HSP 2 Score: 72.4034 bits (176), Expect = 1.873e-13
Identity = 36/98 (36.73%), Postives = 50/98 (51.02%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII--SWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            +C NGT  R R C+   PA    +C  + T  + C NL CP     WG W++W+ CS TC+ G Q R R+C      G  C GT ++ + C +   CP
Sbjct:  425 SCANGTQQRSRKCSVAGPA--WATCAGALTDTRECSNLDCPATDGKWGPWNAWSLCSKTCDTGWQRRFRMCQASGTQGYPCEGTGEEVKPCSEKR-CP 519          

HSP 3 Score: 55.0694 bits (131), Expect = 7.409e-8
Identity = 41/103 (39.81%), Postives = 56/103 (54.37%), Query Frame = 3
Query:  654 EWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 962
            EWS W+ CS+TC  G Q R+R C+  S  G  C G  ++T+ C  S  CP++G W  W +WS CS SCG      RSR+     P + G+ C G    T+ C+
Sbjct:  305 EWSPWSVCSLTCGQGLQVRTRSCVS-SPYGTLCSGPLRETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRG---SRSRMRTCVPPQHGGKACEGPELQTKLCS 403          
BLAST of PKD1L-2 vs. UniProt/SwissProt
Match: sp|Q96RW7|HMCN1_HUMAN (Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2)

HSP 1 Score: 98.9821 bits (245), Expect = 2.266e-21
Identity = 68/151 (45.03%), Postives = 85/151 (56.29%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            +CG GT  R R C NP PA GG  C+ + TQ Q C    CPI   W  W+SW+ACSV+C  G + R+R C D  P   G  C G+D  +  C  S  CP +GNWS WS W +CS +C     M+R R C+NP PSN G+ C G  +  Q C
Sbjct: 4658 SCGKGTQTRARLCNNPPPAFGGSYCDGAETQMQVCNERNCPIHGKWATWASWSACSVSCGGGARQRTRGCSDPVPQYGGRKCEGSDVQSDFC-NSDPCPTHGNWSPWSGWGTCSRTCNGGQ-MRRYRTCDNPPPSNGGRACGGPDSQIQRC 4806          

HSP 2 Score: 94.3597 bits (233), Expect = 7.400e-20
Identity = 68/160 (42.50%), Postives = 84/160 (52.50%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VTCG G   R R C  P PANGG  C  S  + + C N  CP+  SW EWS W  C+ +C  G Q+R+R C +PS  + G  C G   +   C     CP++G WS+W  W +CS SCG      R+RLCNNP P+  G  C G  T  Q C     NCP
Sbjct: 4543 VTCGKGIQKRSRLCNQPLPANGGKPCQGSDLEMRNCQNKPCPVDGSWSEWSLWEECTRSCGRGNQTRTRTCNNPSVQHGGRPCEGNAVEIIMCNIRP-CPVHGAWSAWQPWGTCSESCGKGT-QTRARLCNNPPPAFGGSYCDGAETQMQVCNE--RNCP 4698          

HSP 3 Score: 86.2705 bits (212), Expect = 4.405e-17
Identity = 63/152 (41.45%), Postives = 79/152 (51.97%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            V+CG G   R R C++P P  GG  C  S  Q   C +  CP   +W  WS W  CS TCN G   R R C +  PSN G  C G D   Q C  + +CP++G+W SW +WS CS SCG      R RLC++P P   G+ C G +T    C
Sbjct: 4714 VSCGGGARQRTRGCSDPVPQYGGRKCEGSDVQSDFCNSDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPPPSNGGRACGGPDSQIQRC-NTDMCPVDGSWGSWHSWSQCSASCGGGE-KTRKRLCDHPVPVKGGRPCPGDTTQVTRC 4863          

HSP 4 Score: 80.8777 bits (198), Expect = 2.469e-15
Identity = 60/159 (37.74%), Postives = 88/159 (55.35%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            +CG G   R RTC NP+  +GG  C  ++ +   C    CP+  +W  W  W  CS +C  GTQ+R+R+C +P  +  G  C G +   Q C +   CPI+G W++W++WS+CSVSCG     QR+R C++P P   G+ C G    +  C + P  CP
Sbjct: 4601 SCGRGNQTRTRTCNNPSVQHGGRPCEGNAVEIIMCNIRPCPVHGAWSAWQPWGTCSESCGKGTQTRARLCNNPPPAFGGSYCDGAETQMQVCNERN-CPIHGKWATWASWSACSVSCGGGA-RQRTRGCSDPVPQYGGRKCEGSDVQSDFCNSDP--CP 4755          

HSP 5 Score: 57.7658 bits (138), Expect = 8.778e-8
Identity = 47/114 (41.23%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            + +WS+W ACSVTC  G Q RSR+C    P+N G  C G+D + + C ++  CP++G+WS WS W  C+ SCG      R+R CNNP+  + G+ C G + +   C   P  CP
Sbjct: 4532 FSQWSAWRACSVTCGKGIQKRSRLCNQPLPANGGKPCQGSDLEMRNC-QNKPCPVDGSWSEWSLWEECTRSCGRGN-QTRTRTCNNPSVQHGGRPCEGNAVEIIMCNIRP--CP 4641          
BLAST of PKD1L-2 vs. UniProt/SwissProt
Match: sp|D3YXG0|HMCN1_MOUSE (Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.347e-21
Identity = 69/160 (43.12%), Postives = 87/160 (54.37%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VTCG G   R R C NP PANGG  C  + ++ + C N  CP+   W EWS W  CS +C +G Q+R+R C +P   + G  C G   +T  C     CP++G W++W  WS+CS SCG      R RLCNNP PS  G  CSG  T  Q C     +CP
Sbjct: 4542 VTCGKGIQKRSRLCDNPPPANGGRPCQGADSEARHCHNKLCPVDGHWSEWSFWEDCSRSCGHGNQTRTRTCSNPPAQHGGRPCEGHAVETIMCNIRP-CPVHGVWNAWQPWSACSKSCGKGS-QTRMRLCNNPPPSFGGAHCSGAETQMQVCNE--RHCP 4697          

HSP 2 Score: 95.1301 bits (235), Expect = 4.155e-20
Identity = 66/151 (43.71%), Postives = 84/151 (55.63%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            +CG G+  R R C NP P+ GG  C+ + TQ Q C    CP+   W  WSSW+AC+V+C  G + R+R C D  P   G  C GT   +  C  S  CP +GNWS WS W +CS +C     M+R R C+NP PSN G+ C G  T  Q C
Sbjct: 4657 SCGKGSQTRMRLCNNPPPSFGGAHCSGAETQMQVCNERHCPVDGRWATWSSWSACTVSCGGGARKRTRDCSDPVPQYGGNKCEGTGVQSDFC-NSDPCPTHGNWSPWSGWGTCSRTCNGGQ-MRRYRTCDNPRPSNGGRACGGPDTQIQRC 4805          

HSP 3 Score: 87.4261 bits (215), Expect = 1.748e-17
Identity = 63/152 (41.45%), Postives = 81/152 (53.29%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            V+CG G   R R C++P P  GG  C  +  Q   C +  CP   +W  WS W  CS TCN G   R R C +  PSN G  C G D   Q C  + +CP++G+W +W +WS CSVSCG      R RLC+NP P+  G+ C G +T    C
Sbjct: 4713 VSCGGGARKRTRDCSDPVPQYGGNKCEGTGVQSDFCNSDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPRPSNGGRACGGPDTQIQRC-NTDMCPVDGSWGTWHSWSHCSVSCGGGE-RTRKRLCDNPVPTKGGRSCPGDATQVSRC 4862          

HSP 4 Score: 79.7221 bits (195), Expect = 5.054e-15
Identity = 59/159 (37.11%), Postives = 87/159 (54.72%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            +CG+G   R RTC+NP   +GG  C   + +   C    CP+   W  W  W+ACS +C  G+Q+R R+C +P  S  G  C G +   Q C +   CP++G W++WS+WS+C+VSCG     +R+R C++P P   G  C G    +  C + P  CP
Sbjct: 4600 SCGHGNQTRTRTCSNPPAQHGGRPCEGHAVETIMCNIRPCPVHGVWNAWQPWSACSKSCGKGSQTRMRLCNNPPPSFGGAHCSGAETQMQVCNERH-CPVDGRWATWSSWSACTVSCGGGA-RKRTRDCSDPVPQYGGNKCEGTGVQSDFCNSDP--CP 4754          

HSP 5 Score: 60.077 bits (144), Expect = 1.557e-8
Identity = 48/111 (43.24%), Postives = 64/111 (57.66%), Query Frame = 3
Query:  657 WSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            WS+W  CSVTC  G Q RSR+C +  P+N G  C G D + + C  + LCP++G+WS WS W  CS SCG      R+R C+NP   + G+ C G + +T  C   P  CP
Sbjct: 4534 WSAWRPCSVTCGKGIQKRSRLCDNPPPANGGRPCQGADSEARHC-HNKLCPVDGHWSEWSFWEDCSRSCGHGN-QTRTRTCSNPPAQHGGRPCEGHAVETIMCNIRP--CP 4640          
BLAST of PKD1L-2 vs. UniProt/SwissProt
Match: sp|B3EWZ3|CADN_ACRMI (Coadhesin (Fragment) OS=Acropora millepora OX=45264 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.097e-19
Identity = 60/154 (38.96%), Postives = 83/154 (53.90%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPI-ISWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTN 965
            VTCG GT  R R C NPAPA GG  C   S++   C  + CP+  +W  W  W+ CS  C  G   R R C +  P+N+GL C G D++++ C  ST CP++G WS+WS+    +        ++R+R CNNP P   G  C G  T+ +   N
Sbjct:  417 VTCGQGTRERTRLCDNPAPAQGGSQCQGPSSELVGCTEIPCPVNGNWSSWGDWSNCSSGCGPGKSYRYRDCDNPAPANNGLNCTGPDQESKDC-NSTACPVDGGWSAWSSTPCSATCGQGT--LKRTRECNNPKPQYGGASCFGNETEQEVACN 567          

HSP 2 Score: 78.1814 bits (191), Expect = 1.603e-14
Identity = 62/151 (41.06%), Postives = 83/151 (54.97%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            TC  G   RQRTCTNP+P NGG  C+  STQ + C    CP+   W  WS  + C+  C  G Q +SR C +  P + G  C G    +  C  +  CP++G WS W ++SSC+ +CG      R+R+CN+PAPS  G  C G + D Q C
Sbjct:  239 TCNPGQRSRQRTCTNPSPKNGGTDCSGPSTQSEPCQVQFCPVDGGWSAWSGLSRCTRACGGGRQYQSRTCSNPFPGHGGRDCVGVRSLSFTC-NTQCCPVHGGWSPWGSFSSCTRTCGGGQ-KSRTRVCNSPAPSCNGITCPGGNQDIQPC 387          

HSP 3 Score: 75.485 bits (184), Expect = 1.147e-13
Identity = 56/147 (38.10%), Postives = 80/147 (54.42%), Query Frame = 3
Query:  528 GTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPI-ISWGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            GT  R RTC +PAP  GG  C   + + + C +    +   W  W  W+ CS TCN G +SR R C +PS  N G  C G    ++ C +   CP++G WS+WS  S C+ +CG     Q SR C+NP P + G+DC G+ + + +C
Sbjct:  186 GTAKRTRTCADPAPVFGGSPCEGVNEEEKICNDCVGTVNGGWSPWGLWSRCSTTCNPGQRSRQRTCTNPSPKNGGTDCSGPSTQSEPC-QVQFCPVDGGWSAWSGLSRCTRACGGGRQYQ-SRTCSNPFPGHGGRDCVGVRSLSFTC 330          

HSP 4 Score: 71.633 bits (174), Expect = 2.122e-12
Identity = 61/159 (38.36%), Postives = 84/159 (52.83%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII---------SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            TCG G   R R C +PAP+  G++C   +   Q C    CP           ++  W  W ACSVTC  GT+ R+R+C +  P+  G  C G   +   C +   CP+NGNWSSW  WS+CS  CG      R R C+NPAP+N G +C+G   +++ C
Sbjct:  353 TCGGGQKSRTRVCNSPAPSCNGITCPGGNQDIQPCNQQTCPTSPSTSFPINGNYSNWGQWTACSVTCGQGTRERTRLCDNPAPAQGGSQCQGPSSELVGCTE-IPCPVNGNWSSWGDWSNCSSGCGPGKSY-RYRDCDNPAPANNGLNCTGPDQESKDC 509          

HSP 5 Score: 67.3958 bits (163), Expect = 6.248e-11
Identity = 38/95 (40.00%), Postives = 54/95 (56.84%), Query Frame = 3
Query:  519 CGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAA--CSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQ-ACGK 788
            CG G + R R C NPAPAN G++C     + + C + ACP+   G WS+W++  CS TC  GT  R+R C +P     G +C G + + + AC K
Sbjct:  476 CGPGKSYRYRDCDNPAPANNGLNCTGPDQESKDCNSTACPVD--GGWSAWSSTPCSATCGQGTLKRTRECNNPKPQYGGASCFGNETEQEVACNK 568          
BLAST of PKD1L-2 vs. UniProt/SwissProt
Match: sp|B3EWY9|MLP_ACRMI (Mucin-like protein (Fragment) OS=Acropora millepora OX=45264 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.057e-17
Identity = 64/159 (40.25%), Postives = 89/159 (55.97%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            +CG G  +R R CTNP P N G  C     + + C N +CPI  ++ +W  W+ CSVTC  G Q R R C    PSN G  C G   +T+ C K   CP++GN++ W  WS CS +C +   + R R C NP P+  G+DC G + +T++C + P  CP
Sbjct:  156 SCGPGIQVRFRNCTNPPPINNGSDCVGPRNETRPCNNGSCPIDGNFTQWEIWSGCSVTCGKGVQRRFRSCTKPPPSNGGQDCIGDRLETRECLKPP-CPVDGNFTEWGAWSKCSQTCENGTQV-RFRSCTNPPPAFGGRDCMGPTNETRACNDGP--CP 310          

HSP 2 Score: 78.1814 bits (191), Expect = 1.712e-14
Identity = 39/93 (41.94%), Postives = 53/93 (56.99%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQAC 782
            VTCG G   R R+CT P P+NGG  C     + + C+   CP+  ++ EW +W+ CS TC NGTQ R R C +  P+  G  C G   +T+AC
Sbjct:  212 VTCGKGVQRRFRSCTKPPPSNGGQDCIGDRLETRECLKPPCPVDGNFTEWGAWSKCSQTCENGTQVRFRSCTNPPPAFGGRDCMGPTNETRAC 304          

HSP 3 Score: 55.4546 bits (132), Expect = 4.384e-7
Identity = 40/112 (35.71%), Postives = 52/112 (46.43%), Query Frame = 3
Query:  654 EWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            EWS +  CS +C  G Q R R C +P   N+G  C G   +T+ C   + CPI     +     S        G+ +R R C  P PSN GQDC G   +T+ C   P  CP
Sbjct:  146 EWSPFGPCSTSCGPGIQVRFRNCTNPPPINNGSDCVGPRNETRPCNNGS-CPI-DGNFTQWEIWSGCSVTCGKGVQRRFRSCTKPPPSNGGQDCIGDRLETRECLKPP--CP 253          
BLAST of PKD1L-2 vs. UniProt/SwissProt
Match: sp|Q8CGM1|AGRB2_MOUSE (Adhesion G protein-coupled receptor B2 OS=Mus musculus OX=10090 GN=Adgrb2 PE=1 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 5.003e-16
Identity = 60/159 (37.74%), Postives = 86/159 (54.09%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLA-CPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            +TCG G  +R R+C +   +  G  C+    + + C N A CP+   W EW SW+ CS +C  G++SR R C+ P + G  C G +  T+ C  +  CP+ G W  W  W  CS SC +    QRSR C+   P+ A   C+G  TDT+ C+N  L+CP
Sbjct:  314 LTCGQGLQVRTRSCVS---SPYGTLCSGPLRETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGPELQTKLCSMAA-CPVEGQWLEWGPWGPCSSSCANGT-QQRSRKCSVAGPAWA--TCAGALTDTRECSN--LDCP 463          

HSP 2 Score: 72.4034 bits (176), Expect = 1.344e-12
Identity = 36/98 (36.73%), Postives = 50/98 (51.02%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII--SWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            +C NGT  R R C+   PA    +C  + T  + C NL CP     WG W++W+ CS TC+ G Q R R+C      G  C GT ++ + C +   CP
Sbjct:  425 SCANGTQQRSRKCSVAGPA--WATCAGALTDTRECSNLDCPATDGKWGPWNAWSLCSKTCDTGWQRRFRMCQASGTQGYPCEGTGEEVKPCSEKR-CP 519          

HSP 3 Score: 55.0694 bits (131), Expect = 5.269e-7
Identity = 41/103 (39.81%), Postives = 56/103 (54.37%), Query Frame = 3
Query:  654 EWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 962
            EWS W+ CS+TC  G Q R+R C+  S  G  C G  ++T+ C  S  CP++G W  W +WS CS SCG      RSR+     P + G+ C G    T+ C+
Sbjct:  305 EWSPWSVCSLTCGQGLQVRTRSCVS-SPYGTLCSGPLRETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRG---SRSRMRTCVPPQHGGKACEGPELQTKLCS 403          
BLAST of PKD1L-2 vs. TrEMBL
Match: A0A0H3YFF8 (PKD1L-2 OS=Schmidtea mediterranea OX=79327 GN=PKD1L-2 PE=2 SV=1)

HSP 1 Score: 509.22 bits (1310), Expect = 1.457e-163
Identity = 289/293 (98.63%), Postives = 290/293 (98.98%), Query Frame = 3
Query:  105 VQANYTIYLQVSSKPSSGSTAMNYIILKGNLGISPLTNINNFPNGTANPAILKDGQLVVINDKFPNDYGYINTVTVGNLGATLTMQSLNIFDNVRNLWSNMTFIYPIGYIQISSSTDFLYLVXXXXXXXXXXXXXXVTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VQANYTIYLQVSSKPSSGSTAMNYIILKGNLGISPLTNINNFPNGTANPAILKDGQLVVINDKFPNDYGYINTVTVGNLGATLTMQSLNIFDNVRNLWSNMTFIYPIGYIQISSSTDFLYLVNGSWSDWSNWGSCSVTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCID SNSGL CPGTDKDTQACG STLCPINGNWSSW+TWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP
Sbjct:   21 VQANYTIYLQVSSKPSSGSTAMNYIILKGNLGISPLTNINNFPNGTANPAILKDGQLVVINDKFPNDYGYINTVTVGNLGATLTMQSLNIFDNVRNLWSNMTFIYPIGYIQISSSTDFLYLVNGSWSDWSNWGSCSVTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDSSNSGLPCPGTDKDTQACGNSTLCPINGNWSSWNTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 313          
BLAST of PKD1L-2 vs. TrEMBL
Match: C3YBD5 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_67521 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.442e-25
Identity = 70/162 (43.21%), Postives = 91/162 (56.17%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTC-VNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQ-RSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VTCG G   R RTCTNPAPANGG  C+  + + Q C   L CP+   W +W SW+ACSVTC  G Q+R R C D  P+N G  C G  ++TQAC     C +  +       S  + S       Q R R C NPAP++ G DC GL+ +TQ+C +  ++CP
Sbjct: 1476 VTCGVGEQTRDRTCTNPAPANGGADCDGVTQETQACDTGLLCPVDGGWTDWGSWSACSVTCGVGEQTRDRTCTDPEPANGGADCDGLAQETQACDTGVSCLVIVDGGWTDWGSWSACSMTCEVGEQTRDRTCTNPAPAHGGADCDGLAQETQAC-DTGVSCP 1636          

HSP 2 Score: 89.7373 bits (221), Expect = 6.603e-16
Identity = 45/104 (43.27%), Postives = 62/104 (59.62%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTC-VNLACPII---SWGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPI 806
            VTCG G   R RTCT+P PANGG  C+  + + Q C   ++C +I    W +W SW+ACS+TC  G Q+R R C +P+  + G  C G  ++TQAC     CP+
Sbjct: 1534 VTCGVGEQTRDRTCTDPEPANGGADCDGLAQETQACDTGVSCLVIVDGGWTDWGSWSACSMTCEVGEQTRDRTCTNPAPAHGGADCDGLAQETQACDTGVSCPV 1637          

HSP 3 Score: 77.411 bits (189), Expect = 9.985e-12
Identity = 50/106 (47.17%), Postives = 68/106 (64.15%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            W +WS W+ CSVTC  G Q+R R C +  P+N G  C G  ++TQAC    LCP++G W+ W +WS+CSV+CG      R R C +P P+N G DC GL+ +TQ+C
Sbjct: 1465 WTDWSPWSDCSVTCGVGEQTRDRTCTNPAPANGGADCDGVTQETQACDTGLLCPVDGGWTDWGSWSACSVTCGVGE-QTRDRTCTDPEPANGGADCDGLAQETQAC 1569          
BLAST of PKD1L-2 vs. TrEMBL
Match: A0A3M6U2W8 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00010651 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 3.650e-25
Identity = 61/160 (38.12%), Postives = 85/160 (53.12%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTC-NNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            +CG G   R+R C NP P NGG  C+      Q C    CP+  SW EWS W +CS+TC + G + R R C +  P+N GL C G  ++T+AC K+  CP+        +           GI  R R C+NP P++ G+ C G ST+T++C+    NCP
Sbjct:  238 SCGGGIQGRRRYCINPPPKNGGRDCSGKGYDVQRCNTQGCPVNGSWTEWSDWGSCSLTCGDGGIKKRIRTCTNPPPANGGLECEGAGEETEAC-KAGECPV-DGKWGEWSDWGVCSRSCGTGIQSRFRDCDNPPPAHGGKQCPGSSTETRNCSTN--NCP 393          

HSP 2 Score: 96.2857 bits (238), Expect = 4.057e-18
Identity = 44/101 (43.56%), Postives = 59/101 (58.42%), Query Frame = 3
Query:  513 VTCGNG-TTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCP 803
            +TCG+G    R RTCTNP PANGG+ C  +  + + C    CP+   WGEWS W  CS +C  G QSR R C +  P++ G  CPG+  +T+ C  +  CP
Sbjct:  294 LTCGDGGIKKRIRTCTNPPPANGGLECEGAGEETEACKAGECPVDGKWGEWSDWGVCSRSCGTGIQSRFRDCDNPPPAHGGKQCPGSSTETRNCSTNN-CP 393          

HSP 3 Score: 81.2629 bits (199), Expect = 4.588e-13
Identity = 51/118 (43.22%), Postives = 67/118 (56.78%), Query Frame = 3
Query:  612 QTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            QTC  L     +W  W+ W+ CS +C  G Q R R CI+  P N G  C G   D Q C     CP+NG+W+ WS W SCS++CG  GI +R R C NP P+N G +C G   +T++C
Sbjct:  214 QTCKQLQPVHGNWSAWAEWSDCSASCGGGIQGRRRYCINPPPKNGGRDCSGKGYDVQRCNTQG-CPVNGSWTEWSDWGSCSLTCGDGGIKKRIRTCTNPPPANGGLECEGAGEETEAC 330          
BLAST of PKD1L-2 vs. TrEMBL
Match: C3XRG8 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_68242 PE=3 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.290e-24
Identity = 81/208 (38.94%), Postives = 109/208 (52.40%), Query Frame = 3
Query:  372 IFDNVRNLWSNMTFIYPIGYIQISSSTDFLYLVXXXXXXXXXXXXXXVTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTC-VNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            + D   N W  +       ++    + D   L              SVTCG GT  R R+CTNPAP NGG  C+  + + Q C   ++CP+   W EWS+W+ CSVTC  GTQ+R R C +  P+N G  C G  ++TQ C     CP++G WS WS  S CSV+CG      R R C NPAP+N G  C G + +TQ C +  ++CP
Sbjct:  230 VLDYEENRWLTLASCRRHWFVSWDVTYDVTRLEGLVIHLDITCTRRSVTCGVGTQTRDRSCTNPAPGNGGAVCDGDTEETQVCDSEVSCPVDGGWSEWSAWSGCSVTCGVGTQTRDRSCTNPAPANGGAVCEGDTEETQVCDSGVSCPVDGGWSEWSPLSVCSVTCGVGT-QTRDRSCTNPAPANGGAVCEGDTEETQVC-DSGVSCP 435          

HSP 2 Score: 108.612 bits (270), Expect = 2.786e-22
Identity = 75/161 (46.58%), Postives = 96/161 (59.63%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTC-VNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VTCG GT  R R+CTNPAPANGG  C   + + Q C   ++CP+   W EWS  + CSVTC  GTQ+R R C +  P+N G  C G  ++TQ C     CP++G WS WS  S CSV+CG      R R C NPAP+N G  C G + +TQ C +  ++CP
Sbjct:  335 VTCGVGTQTRDRSCTNPAPANGGAVCEGDTEETQVCDSGVSCPVDGGWSEWSPLSVCSVTCGVGTQTRDRSCTNPAPANGGAVCEGDTEETQVCDSGVSCPVDGGWSEWSPLSVCSVTCGVGT-QTRDRSCTNPAPANGGAVCEGDTEETQVC-DSGVSCP 493          

HSP 3 Score: 108.612 bits (270), Expect = 2.786e-22
Identity = 75/161 (46.58%), Postives = 96/161 (59.63%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTC-VNLACPIIS-WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VTCG GT  R R+CTNPAPANGG  C   + + Q C   ++CP+   W EWS  + CSVTC  GTQ+R R C +  P+N G  C G  ++TQ C     CP++G WS WS  S CSV+CG      R R C NPAP+N G  C G + +TQ C +  ++CP
Sbjct:  451 VTCGVGTQTRDRSCTNPAPANGGAVCEGDTEETQVCDSGVSCPVDGGWSEWSPLSVCSVTCGVGTQTRDRSCTNPAPANGGAVCEGDTEETQVCDSGVSCPVDGGWSEWSPLSVCSVTCGVGT-QTRDRSCTNPAPANGGAVCEGDTEETQVC-DSGVSCP 609          

HSP 4 Score: 105.916 bits (263), Expect = 2.283e-21
Identity = 71/161 (44.10%), Postives = 94/161 (58.39%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTC-VNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VTCG GT  R R+CTNPAPANGG  C   + + Q C   ++CP+   W EWS  + CSVTC  GTQ+R R C +  P+N G  C G  ++TQ C     CP++G WS WS  S C+V+CG      R R C NPAP + G +C G +   + C +  ++CP
Sbjct:  509 VTCGVGTQTRDRSCTNPAPANGGAVCEGDTEETQVCDSGVSCPVDGGWSEWSPLSVCSVTCGVGTQTRDRSCTNPAPANGGAVCEGDTEETQVCDSGVSCPVDGGWSEWSPLSVCNVTCGVGT-QTRDRSCTNPAPQHGGAECEGEAVAKKEC-DTGVSCP 667          
BLAST of PKD1L-2 vs. TrEMBL
Match: A0A1S3HCM2 (uncharacterized protein LOC106153735 isoform X14 OS=Lingula unguis OX=7574 GN=LOC106153735 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.343e-23
Identity = 67/160 (41.88%), Postives = 90/160 (56.25%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIIS-WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VTCG GT  R R C NPAP+NGG +C  S ++ Q C    CP+   WG WSSWA+C V+C  GTQ+++R+C +  PSN G +CPG+ + +Q C     CP+      + T+          G   R+RLCNNP P+  G +C G    +QSC   P  CP
Sbjct: 1961 VTCGGGTQTRSRQCDNPAPSNGGNTCFGSGSESQQCNTQGCPVTGNWGSWSSWASCPVSCGGGTQTKTRLCDNPAPSNGGSSCPGSSEMSQQCNTEN-CPV-HGNWGYWTYWGTCTVTCGGGTQSRTRLCNNPTPNYGGDNCPGEGKVSQSCNTQP--CP 2116          

HSP 2 Score: 110.153 bits (274), Expect = 1.074e-22
Identity = 66/152 (43.42%), Postives = 86/152 (56.58%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPI-ISWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            V CG G+  R R+C+NPAP+NGG SC    TQ+Q C   AC +  +WG WS W+ CS TC  G +SR+RVC +  P+N G TCPG + +++ C   T CP         T  S        G   RSR C+NPAPSN G  C G  +++Q C
Sbjct: 1847 VNCGGGSQARTRSCSNPAPSNGGASCPGERTQFQQCNTQACQVNGNWGGWSGWSTCSATCGIGQRSRARVCDNPAPANGGTTCPGNNAESEQC-SITGCP-ADGNWGSWTPWSSCSVTCGGGTQTRSRQCDNPAPSNGGNTCFGSGSESQQC 1996          

HSP 3 Score: 108.612 bits (270), Expect = 3.818e-22
Identity = 66/155 (42.58%), Postives = 90/155 (58.06%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIIS--WGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTD--KDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
             TCG G+  RQR C NPAP+NGG SC  S+ + + C  LAC  +   WG+W SW+ CSVTC +G Q+R+R C DP  S SG  CP +D   +TQ+C +S  CP+           S   +  + G   R+R C++PAPSN G  C G  T+++ C
Sbjct: 1445 ATCGGGSHSRQRVCNNPAPSNGGSSCIGSNLEVEICNTLACANVDGNWGQWGSWSTCSVTCGSGQQTRTRECNDPPQSGSGQPCPSSDPSSETQSCTQSA-CPV-NGNWGAWNAWSGCSALCNGGTRTRNRACDSPAPSNGGSSCPGDRTESEQC 1597          

HSP 4 Score: 107.457 bits (267), Expect = 7.721e-22
Identity = 73/150 (48.67%), Postives = 97/150 (64.67%), Query Frame = 3
Query:  519 CGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPI-ISWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            C  GT  R R C +PAP+NGG SC    T+ + C   ACP+  +WG W++WA+C+V+C  G +SR+RVC +  PSN G +CPG+  +++ CG    CP+NGNW SWS+W++C VSCG      R+R CNNPAPSN G  C G  T  Q C
Sbjct: 1564 CNGGTRTRNRACDSPAPSNGGSSCPGDRTESEQCNTQACPVNGNWGAWANWASCTVSCGGGQRSRTRVCDNPAPSNGGSSCPGSATESEQCGTQG-CPVNGNWGSWSSWTTCPVSCGGES-QARARSCNNPAPSNGGASCPGEGTQFQQC 1711          

HSP 5 Score: 102.064 bits (253), Expect = 5.292e-20
Identity = 71/153 (46.41%), Postives = 95/153 (62.09%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPI-ISWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 962
            V+CG G   R R C NPAP+NGG SC  S+T+ + C    CP+  +WG WSSW  C V+C   +Q+R+R C +  PSN G +CPG     Q C  +  C +NGNW  WS W++CSV+CG      R+R+C+NPAP+N G  C G   DTQ+C+
Sbjct: 1619 VSCGGGQRSRTRVCDNPAPSNGGSSCPGSATESEQCGTQGCPVNGNWGSWSSWTTCPVSCGGESQARARSCNNPAPSNGGASCPGEGTQFQQC-NTQACQVNGNWGGWSVWNTCSVTCGIGQ-QSRARVCDNPAPANGGTTCPGNRIDTQNCS 1769          

HSP 6 Score: 101.679 bits (252), Expect = 6.687e-20
Identity = 70/153 (45.75%), Postives = 93/153 (60.78%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPI-ISWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 962
            VTCG GT  R R C NPAP+NGG  C  S ++ Q C    CP+  +WG WSSW  C V C  G+Q+R+R C +  PSN G +CPG     Q C  +  C +NGNW  WS WS+CS +CG      R+R+C+NPAP+N G  C G + +++ C+
Sbjct: 1790 VTCGGGTQTRTRQCDNPAPSNGGNPCFGSGSESQQCNTQGCPVNGNWGSWSSWTTCPVNCGGGSQARTRSCSNPAPSNGGASCPGERTQFQQC-NTQACQVNGNWGGWSGWSTCSATCGIGQ-RSRARVCDNPAPANGGTTCPGNNAESEQCS 1940          

HSP 7 Score: 100.908 bits (250), Expect = 1.361e-19
Identity = 71/152 (46.71%), Postives = 93/152 (61.18%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            V+CG GT  + R C NPAP+NGG SC  SS   Q C    CP+   WG W+ W  C+VTC  GTQSR+R+C +P+    G  CPG  K +Q+C  +  CP+NGNW  W++WS CS +CG+     R+R+C+ P PSN G  C G S +  SC
Sbjct: 2018 VSCGGGTQTKTRLCDNPAPSNGGSSCPGSSEMSQQCNTENCPVHGNWGYWTYWGTCTVTCGGGTQSRTRLCNNPTPNYGGDNCPGEGKVSQSC-NTQPCPVNGNWGQWASWSQCSKTCGTGA-HSRTRVCDQPPPSNGGISCPGNSQEDASC 2167          

HSP 8 Score: 99.3673 bits (246), Expect = 4.587e-19
Identity = 67/154 (43.51%), Postives = 99/154 (64.29%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSC--NDSSTQWQTCVNLACPI-ISWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            VTCG+G   R R C +P  +  G  C  +D S++ Q+C   ACP+  +WG W++W+ CS  CN GT++R+R C    PSN G +CPG   +++ C  +  CP+NGNW +W+ W+SC+VSCG      R+R+C+NPAPSN G  C G +T+++ C
Sbjct: 1503 VTCGSGQQTRTRECNDPPQSGSGQPCPSSDPSSETQSCTQSACPVNGNWGAWNAWSGCSALCNGGTRTRNRACDSPAPSNGGSSCPGDRTESEQC-NTQACPVNGNWGAWANWASCTVSCGGGQ-RSRTRVCDNPAPSNGGSSCPGSATESEQC 1654          

HSP 9 Score: 97.0561 bits (240), Expect = 3.050e-18
Identity = 72/152 (47.37%), Postives = 91/152 (59.87%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIIS-WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            VTCG G   R R C NPAPANGG +C  +    Q C    CP    WG W+ W++C VTC  GTQ+R+R C +  PSN G  C G+  ++Q C  +  CP+NGNW SWS+W++C V+CG      R+R C+NPAPSN G  C G  T  Q C
Sbjct: 1733 VTCGIGQQSRARVCDNPAPANGGTTCPGNRIDTQNCSITGCPADGNWGSWTPWSSCPVTCGGGTQTRTRQCDNPAPSNGGNPCFGSGSESQQC-NTQGCPVNGNWGSWSSWTTCPVNCGGGS-QARTRSCSNPAPSNGGASCPGERTQFQQC 1882          
BLAST of PKD1L-2 vs. Ensembl Cavefish
Match: ENSAMXT00000044661.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001762.1:6524:8010:-1 gene:ENSAMXG00000044078.1 transcript:ENSAMXT00000044661.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.3445 bits (207), Expect = 3.193e-18
Identity = 70/163 (42.94%), Postives = 88/163 (53.99%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSC--NDSSTQWQTCVNLACPIIS--WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            V+CG GT  R R C +PAP +GG  C  ND    +        P ++  WG WSSW +CS TCN G   R R C +  P+N G  C G D + Q C   + CP++GNW  W  W  CS SCGS    +R R+CN+P+PSN G+ C G ST    C   P  CP
Sbjct:  114 VSCGGGTRQRTRLCASPAPQHGGRQCEGNDIHIDFSN-YPFTAPTVNGNWGPWSSWGSCSRTCNGGQMRRYRTCENPRPANGGRACAGADTEIQKCSTES-CPVDGNWGLWQPWGECSASCGSGE-QKRVRICNSPSPSNKGRPCPGDSTQLSKCNIRP--CP 271          

HSP 2 Score: 73.1738 bits (178), Expect = 2.252e-14
Identity = 52/181 (28.73%), Postives = 68/181 (37.57%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIIS------------------------------WGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 962
            TCG G   R R C NP P+  G  C  + TQ Q C    CP                                 W  W SW  CSV+C  GT+ R+R+C  P+  + G  C G D            P         +         + G M+R R C NP P+N G+ C+G  T+ Q C+
Sbjct:   29 TCGKGMQTRIRLCNNPPPSFDGPPCKGAETQTQVCTERNCPGKKLNIQYSPKTGLQKCQLTSRRSDKTIDCSDLWSSWVSWGPCSVSCGGGTRQRTRLCASPAPQHGGRQCEGNDIHIDFSNYPFTAPTVNGNWGPWSSWGSCSRTCNGGQMRRYRTCENPRPANGGRACAGADTEIQKCS 209          
BLAST of PKD1L-2 vs. Ensembl Cavefish
Match: thbs1b (thrombospondin-1-like [Source:NCBI gene;Acc:103031445])

HSP 1 Score: 82.4185 bits (202), Expect = 6.682e-17
Identity = 46/101 (45.54%), Postives = 52/101 (51.49%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPI-ISWGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPI 806
            VTCG+G   R R C +P P  GG  C     Q + C    CPI   WG WS W  CS+TC  GTQSR R+C DP+    G  C G    TQ C K   CPI
Sbjct:  457 VTCGSGVITRIRLCNSPTPQMGGKDCQGQGRQTEKCEKSPCPINGGWGPWSPWDKCSLTCGGGTQSRKRLCNDPAPKYGGKDCVGDATATQICNKQA-CPI 556          

HSP 2 Score: 71.2478 bits (173), Expect = 3.429e-13
Identity = 52/151 (34.44%), Postives = 67/151 (44.37%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            V+CG G   R R+C        G S        Q C        +W  WS W++CSVTC +G  +R R+C  P+    G  C G  + T+ C KS  CPI        +           G   R RLCN+PAP   G+DC G +T TQ C
Sbjct:  401 VSCGRGIQQRGRSCDRINNNCEGTSVQTRDCYLQECDKRFKQDGNWSHWSPWSSCSVTCGSGVITRIRLCNSPTPQMGGKDCQGQGRQTEKCEKSP-CPI-NGGWGPWSPWDKCSLTCGGGTQSRKRLCNDPAPKYGGKDCVGDATATQIC 549          

HSP 3 Score: 51.6026 bits (122), Expect = 7.406e-7
Identity = 40/117 (34.19%), Postives = 50/117 (42.74%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDT-----QACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            W  WS W  CSV+C  G Q R R C   +N+   C GT   T     Q C K           S  +  S       +G++ R RLCN+P P   G+DC G    T+ C   P  CP
Sbjct:  390 WSPWSEWTHCSVSCGRGIQQRGRSCDRINNN---CEGTSVQTRDCYLQECDKRFK---QDGNWSHWSPWSSCSVTCGSGVITRIRLCNSPTPQMGGKDCQGQGRQTEKCEKSP--CP 498          
BLAST of PKD1L-2 vs. Ensembl Cavefish
Match: adgrb3 (adhesion G protein-coupled receptor B3 [Source:ZFIN;Acc:ZDB-GENE-070424-99])

HSP 1 Score: 78.5666 bits (192), Expect = 1.441e-15
Identity = 58/153 (37.91%), Postives = 86/153 (56.21%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLA-CPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTN 965
            VTCG G+ +R RTC +P     G  C+    + + C N A CP+   W EWS W+ CS TC  G ++R+R+C  P + G  C G +  ++ C  + LCP++G W  WS WS CSV+C +    QR R C+  A ++ G +C G   +++ C N
Sbjct:  305 VTCGQGSQVRTRTCVSPY----GTHCSGPLRESRVCNNTAPCPVHGVWEEWSPWSLCSFTCGRGHRTRTRLCTPPQHGGRACDGPETQSKLCNIA-LCPVDGQWQEWSAWSDCSVTCANGT-QQRKRQCS--AAAHGGSECRGHWAESRECHN 449          

HSP 2 Score: 63.5438 bits (153), Expect = 1.030e-10
Identity = 35/98 (35.71%), Postives = 49/98 (50.00%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPI-ISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            VTC NGT  R+R C+  A A+GG  C     + + C N  C     W  W  W+ CS +C+ G Q R RVC   + +G  C G  ++ + C +   CP
Sbjct:  414 VTCANGTQQRKRQCS--AAAHGGSECRGHWAESRECHNPECTANGQWNPWGPWSGCSKSCDGGWQRRVRVCQGLAVTGQQCEGNGEEVRKCSEQR-CP 508          

HSP 3 Score: 54.6842 bits (130), Expect = 7.330e-8
Identity = 45/110 (40.91%), Postives = 64/110 (58.18%), Query Frame = 3
Query:  654 EWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            EWS W++CSVTC  G+Q R+R C+ P   G  C G  ++++ C  +  CP++G W  WS WS CS +CG      R+RLC    P + G+ C G  T ++ C N+ L CP
Sbjct:  296 EWSQWSSCSVTCGQGSQVRTRTCVSP--YGTHCSGPLRESRVCNNTAPCPVHGVWEEWSPWSLCSFTCGRGH-RTRTRLCT--PPQHGGRACDGPETQSKLC-NIAL-CP 398          
BLAST of PKD1L-2 vs. Ensembl Cavefish
Match: thbs2b (thrombospondin 2 [Source:NCBI gene;Acc:103028711])

HSP 1 Score: 78.5666 bits (192), Expect = 1.442e-15
Identity = 42/101 (41.58%), Postives = 50/101 (49.50%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIIS-WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPI 806
            VTCG G   R R C +P P  GG  C     + Q+C    CPI   WG WS WA+CS TC  G +SR R C    P + G  C G   + + C K   CPI
Sbjct:  461 VTCGEGVITRIRHCNSPIPQRGGKDCEGEGRETQSCQAEPCPIDGGWGPWSPWASCSATCGGGLKSRERECNSPVPQHGGRKCMGDSVENEVCNKLE-CPI 560          

HSP 2 Score: 70.4774 bits (171), Expect = 6.252e-13
Identity = 60/159 (37.74%), Postives = 80/159 (50.31%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VTCG+GT  R R+C + +    G S          C         W  WS W+ACSVTC  G  +R R C  P     G  C G  ++TQ+C ++  CPI+G W  WS W+SCS +CG   +  R R CN+P P + G+ C G S + + C    L CP
Sbjct:  405 VTCGSGTQQRGRSCDDSSNTCSGPSIQTRRCSLGKCDRRVRQDGGWSLWSPWSACSVTCGEGVITRIRHCNSPIPQRGGKDCEGEGRETQSC-QAEPCPIDGGWGPWSPWASCSATCGGG-LKSRERECNSPVPQHGGRKCMGDSVENEVCNK--LECP 559          

HSP 3 Score: 63.1586 bits (152), Expect = 1.538e-10
Identity = 57/162 (35.19%), Postives = 70/162 (43.21%), Query Frame = 3
Query:  516 TCGNGTTI-RQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIIS---WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQAC--GKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            TC  G  + RQ TC   A AN      +       C  +  P+ S   W  WS W  C+VTC +GTQ R R C D SN   TC G    T+ C  GK           S  +  S        G++ R R CN+P P   G+DC G   +TQSC   P  CP
Sbjct:  353 TCQEGKVVCRQITCPPVACANPSFIDGE-------CCPVCLPMDSDDGWSPWSEWTQCTVTCGSGTQQRGRSCDDSSN---TCSGPSIQTRRCSLGKCDRRVRQDGGWSLWSPWSACSVTCGEGVITRIRHCNSPIPQRGGKDCEGEGRETQSCQAEP--CP 502          
BLAST of PKD1L-2 vs. Ensembl Cavefish
Match: adgrb3 (adhesion G protein-coupled receptor B3 [Source:ZFIN;Acc:ZDB-GENE-070424-99])

HSP 1 Score: 78.5666 bits (192), Expect = 1.449e-15
Identity = 58/153 (37.91%), Postives = 86/153 (56.21%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLA-CPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTN 965
            VTCG G+ +R RTC +P     G  C+    + + C N A CP+   W EWS W+ CS TC  G ++R+R+C  P + G  C G +  ++ C  + LCP++G W  WS WS CSV+C +    QR R C+  A ++ G +C G   +++ C N
Sbjct:  305 VTCGQGSQVRTRTCVSPY----GTHCSGPLRESRVCNNTAPCPVHGVWEEWSPWSLCSFTCGRGHRTRTRLCTPPQHGGRACDGPETQSKLCNIA-LCPVDGQWQEWSAWSDCSVTCANGT-QQRKRQCS--AAAHGGSECRGHWAESRECHN 449          

HSP 2 Score: 63.929 bits (154), Expect = 8.804e-11
Identity = 35/98 (35.71%), Postives = 49/98 (50.00%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPI-ISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            VTC NGT  R+R C+  A A+GG  C     + + C N  C     W  W  W+ CS +C+ G Q R RVC   + +G  C G  ++ + C +   CP
Sbjct:  414 VTCANGTQQRKRQCS--AAAHGGSECRGHWAESRECHNPECTANGQWNPWGPWSGCSKSCDGGWQRRVRVCQGLAVTGQQCEGNGEEVRKCSEQR-CP 508          

HSP 3 Score: 54.6842 bits (130), Expect = 7.562e-8
Identity = 45/110 (40.91%), Postives = 64/110 (58.18%), Query Frame = 3
Query:  654 EWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            EWS W++CSVTC  G+Q R+R C+ P   G  C G  ++++ C  +  CP++G W  WS WS CS +CG      R+RLC    P + G+ C G  T ++ C N+ L CP
Sbjct:  296 EWSQWSSCSVTCGQGSQVRTRTCVSP--YGTHCSGPLRESRVCNNTAPCPVHGVWEEWSPWSLCSFTCGRGH-RTRTRLCT--PPQHGGRACDGPETQSKLC-NIAL-CP 398          
BLAST of PKD1L-2 vs. Ensembl Sea Lamprey
Match: thbs1a (thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402-2])

HSP 1 Score: 76.6406 bits (187), Expect = 1.005e-15
Identity = 40/101 (39.60%), Postives = 56/101 (55.45%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPI 806
            VTCG G   R R C +P P  GG  C+ S  + Q C    CP+   +G WS W+AC VTC    + R+R+C +P    +G  C G+D++T+ C K   CP+
Sbjct:  445 VTCGAGVNTRIRLCNSPVPQMGGDECDGSGRENQKCEMEPCPVDGQYGPWSPWSACPVTCGGALRERARLCNNPKPQYNGKDCLGSDRETEICNKKP-CPV 544          

HSP 2 Score: 74.3294 bits (181), Expect = 7.175e-15
Identity = 60/159 (37.74%), Postives = 84/159 (52.83%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VTCG+GT  R R+C +      G S    + Q + C         W  WS W++CSVTC  G  +R R+C  P     G  C G+ ++ Q C +   CP++G +  WS WS+C V+CG   + +R+RLCNNP P   G+DC G   +T+ C   P  CP
Sbjct:  389 VTCGSGTQQRGRSCDSVNNPCEGPSIQGRTCQLKACDKRVRQDGGWSFWSPWSSCSVTCGAGVNTRIRLCNSPVPQMGGDECDGSGRENQKC-EMEPCPVDGQYGPWSPWSACPVTCGGA-LRERARLCNNPKPQYNGKDCLGSDRETEICNKKP--CP 543          

HSP 3 Score: 51.6026 bits (122), Expect = 1.697e-7
Identity = 41/119 (34.45%), Postives = 49/119 (41.18%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCID-------PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            W  WS W  CSVTC +GTQ R R C         PS  G TC       +AC K           S+ +  S        G+  R RLCN+P P   G +C G   + Q C   P  CP
Sbjct:  378 WSPWSEWTECSVTCGSGTQQRGRSCDSVNNPCEGPSIQGRTC-----QLKACDKRVR---QDGGWSFWSPWSSCSVTCGAGVNTRIRLCNSPVPQMGGDECDGSGRENQKCEMEP--CP 486          
BLAST of PKD1L-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002352.1 (pep scaffold:Pmarinus_7.0:GL476883:4338:91444:1 gene:ENSPMAG00000002137.1 transcript:ENSPMAT00000002352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 2.275e-14
Identity = 38/98 (38.78%), Postives = 45/98 (45.92%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            V+C NGT  R R C    P  GG  C    T+ Q C    CP+   W  W  W  C VTC  G + R RVC  P N G  C G   +T+ C  +  CP
Sbjct:   19 VSCANGTQQRSRECE--GPIYGGAECRGQWTEKQECYIRVCPVDGQWMSWGQWNECPVTCGRGERRRIRVCHGPFNDGKMCDGLSSETKTCADAK-CP 113          

HSP 2 Score: 60.077 bits (144), Expect = 3.146e-10
Identity = 47/112 (41.96%), Postives = 65/112 (58.04%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            W +WS+W  CSV+C NGTQ RSR C  P   G  C G   + Q C    +CP++G W SW  W+ C V+CG     +R R+C+ P   N G+ C GLS++T++C +    CP
Sbjct:    8 WTKWSNWTPCSVSCANGTQQRSRECEGPIYGGAECRGQWTEKQEC-YIRVCPVDGQWMSWGQWNECPVTCGRGE-RRRIRVCHGPF--NDGKMCDGLSSETKTCADA--KCP 113          
BLAST of PKD1L-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000912.1 (pep scaffold:Pmarinus_7.0:GL477542:3:94122:1 gene:ENSPMAG00000000814.1 transcript:ENSPMAT00000000912.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 5.043e-14
Identity = 38/97 (39.18%), Postives = 47/97 (48.45%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLAC-PIISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            +CG+G   R R C +PAP  GG  C   S + + C   +C     W EWS WA CSV C  G Q+R R C+ P   GL       +T  C  S  CP
Sbjct: 1406 SCGDGVQYRYRLCDSPAPHAGGRGCAGPSREEKECRARSCVDSWPWSEWSPWANCSVGCGGGEQTRHRSCLHPPCPGLATHSKACNTHVCQASAGCP 1502          

HSP 2 Score: 58.5362 bits (140), Expect = 9.844e-10
Identity = 48/136 (35.29%), Postives = 64/136 (47.06%), Query Frame = 3
Query:  618 CVNLACPIIS-WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDK-----------DTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            C N  CP+   W EWS W  CS TC + T SR R C    P + G  C G  +           + + C     CP +G W  WS+WS+C    G   +  R+R CN+P P   G +C G ST ++ C   P +CP
Sbjct: 1142 CTNQPCPVDGGWCEWSPWTPCSRTCGSETASRYRTCACPLPRDGGAPCAGAQRGHEHRDVGVQLEAKPCNLFPFCPTDGGWGFWSSWSACDACAGGAAV--RTRECNSPTPRFGGAECEGNSTVSRPCQGDPSSCP 1275          

HSP 3 Score: 58.5362 bits (140), Expect = 1.011e-9
Identity = 32/84 (38.10%), Postives = 43/84 (51.19%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDPS----NSGLTCP 755
            TC  GT  R R+ T+P  A GG  C+    +   C  L C  + WGEW +W+ CS +C  G + RSR C  P+       L+CP
Sbjct:  819 TCDVGTRRRFRSATHPPAAFGGRGCSGLPVEVAYCGLLPCKAV-WGEWEAWSGCSASCGGGVRVRSRTCPTPAPPPHGQTLSCP 901          

HSP 4 Score: 54.299 bits (129), Expect = 2.545e-8
Identity = 32/92 (34.78%), Postives = 40/92 (43.48%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCI--DPSNSGLTCPGTDKDTQAC 782
            +CG G   RQR         G  SCN +    + C   ACP+   WG WS+W+ C V C  G + R R C    P N G  C G     + C
Sbjct:  321 SCGLGVMFRQRDVLREEQTGG--SCNRTLMGSRACFMQACPVEGQWGAWSAWSPCDVRCGGGMRVRQRTCSAPPPKNGGRACAGDGVQPERC 410          

HSP 5 Score: 51.2174 bits (121), Expect = 2.198e-7
Identity = 24/66 (36.36%), Postives = 31/66 (46.97%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRS 713
            +CG G  IR R C NP P N G +C   S + Q C    CP+ISW   S+    + T       +S
Sbjct: 2102 SCGTGKQIRTRACINPPPRNNGTACQGPSLENQECATAPCPVISWSSLSNREPLASTAEAAGHRKS 2167          

HSP 6 Score: 47.7506 bits (112), Expect = 2.672e-6
Identity = 36/109 (33.03%), Postives = 50/109 (45.87%), Query Frame = 3
Query:  519 CGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACP------------IISWGEWSSWAACSVTC-----NNGTQSRSRVCIDPSNSGLT---CPGTDKDTQACG 785
            C  G+  R R+ TNPA + GG  C   ST+ + C    CP               WG+WS+W+ C+ TC       GT++R R C   +   +T   CP  D  T+ CG
Sbjct:  537 CRTGSQERYRSPTNPAASGGGAPCVGDSTELRDCNAGPCPGDEAPEEGGDGDRGGWGQWSAWSRCTRTCFYSPERVGTRARHRRCNATAVDDVTGDPCPEEDAQTELCG 645          

HSP 7 Score: 46.595 bits (109), Expect = 7.195e-6
Identity = 31/93 (33.33%), Postives = 36/93 (38.71%), Query Frame = 3
Query:  519 CGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQT--CVNLACPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQAC 782
            CG G   R RT  NP   NG    +  +  W+   C    C +   W  WS WA C   C  G   R R C +P   N G  CPG       C
Sbjct: 1790 CGVGQQQRMRT-YNPPLGNGSWCPDIIAGNWEVRFCNTDVCKVDGGWSSWSPWAPCDRACGGGRSLRVRACTNPPRKNGGQPCPGDKYQVTVC 1881          

HSP 8 Score: 46.595 bits (109), Expect = 7.517e-6
Identity = 22/59 (37.29%), Postives = 33/59 (55.93%), Query Frame = 3
Query:  615 TCVNLACPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQAC 782
            +C  LAC I   WG W+ W+AC+ +C +G Q R R+C  P+    G  C G  ++ + C
Sbjct: 1382 SCTELACRIDGGWGSWTGWSACARSCGDGVQYRYRLCDSPAPHAGGRGCAGPSREEKEC 1440          
BLAST of PKD1L-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000072.1 (pep scaffold:Pmarinus_7.0:GL479818:18487:29074:1 gene:ENSPMAG00000000067.1 transcript:ENSPMAT00000000072.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 1.689e-13
Identity = 40/98 (40.82%), Postives = 51/98 (52.04%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPI 806
            TCG G   R R C+   P +GG SC     Q + C    CP+   W +WS W+ CSVTC NGTQ RSR C+ P   G  C G   + + C  +  CP+
Sbjct:   67 TCGRGLRTRMRHCS--VPQHGGSSCEGPYNQTKVCNIALCPVDGQWADWSKWSTCSVTCENGTQQRSRECVGPIYGGTECVGPGTENRRC-DNNPCPV 161          

HSP 2 Score: 65.4698 bits (158), Expect = 7.758e-13
Identity = 38/91 (41.76%), Postives = 47/91 (51.65%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQAC 782
            VTC NGT  R R C    P  GG  C    T+ + C N  CP+   WG W++W  CS TC +G + R R C  P + GL C G DK+   C
Sbjct:  121 VTCENGTQQRSRECV--GPIYGGTECVGPGTENRRCDNNPCPVDGRWGVWAAWGECSATCGSGLRWRQRKCWGPFHGGLLCQGGDKEPANC 209          

HSP 3 Score: 57.3806 bits (137), Expect = 4.739e-10
Identity = 51/158 (32.28%), Postives = 75/158 (47.47%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLA-CPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            +CG G+ +R R C   + +    +C+    + + C + + CP+   WGEWS W+ CS TC  G ++R R C  P + G +C G    T+ C    LCP+     +  +  S       NG  QRSR C  P     G +C G  T+ + C N P  CP
Sbjct:   12 SCGEGSQVRARVCLASSKS---AACSGPLREIRVCDSSSVCPVHGVWGEWSPWSLCSYTCGRGLRTRMRHCSVPQHGGSSCEGPYNQTKVC-NIALCPV-DGQWADWSKWSTCSVTCENGTQQRSRECVGPI--YGGTECVGPGTENRRCDNNP--CP 160          

HSP 4 Score: 45.8246 bits (107), Expect = 4.154e-6
Identity = 21/51 (41.18%), Postives = 32/51 (62.75%), Query Frame = 3
Query:  654 EWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPI 806
            EWS W+ CS +C  G+Q R+RVC+  S S   C G  ++ + C  S++CP+
Sbjct:    2 EWSEWSVCSSSCGEGSQVRARVCLASSKS-AACSGPLREIRVCDSSSVCPV 51          
BLAST of PKD1L-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008404.1 (pep scaffold:Pmarinus_7.0:GL476608:255441:311832:-1 gene:ENSPMAG00000007555.1 transcript:ENSPMAT00000008404.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 2.077e-13
Identity = 43/97 (44.33%), Postives = 52/97 (53.61%), Query Frame = 3
Query:  519 CGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLC 800
            CG GT  R R+CTNPAP NGG  CN   TQ   C  + CP+   W EWS W+ C   C   T  RSR C +P+  N G  C G+   +Q C  + LC
Sbjct:  225 CGRGTQKRTRSCTNPAPLNGGAVCNGQGTQKIPCSTI-CPVDGGWVEWSKWSTCGPDC---THWRSRECSNPAPVNGGKDCHGSPLQSQNCSDA-LC 316          

HSP 2 Score: 60.8474 bits (146), Expect = 1.569e-10
Identity = 45/109 (41.28%), Postives = 62/109 (56.88%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNV 968
            W  W+ W+ C+  C  GTQ R+R C +P+  N G  C G  + TQ    ST+CP++G W  WS WS+C   C       RSR C+NPAP N G+DC G    +Q+C++ 
Sbjct:  212 WSLWTEWSPCNSKCGRGTQKRTRSCTNPAPLNGGAVCNG--QGTQKIPCSTICPVDGGWVEWSKWSTCGPDCT----HWRSRECSNPAPVNGGKDCHGSPLQSQNCSDA 314          
BLAST of PKD1L-2 vs. Ensembl Nematostella
Match: EDO40760 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S664])

HSP 1 Score: 106.686 bits (265), Expect = 1.605e-25
Identity = 63/152 (41.45%), Postives = 96/152 (63.16%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 962
            TCG GT  R RTCTNP PA+GG  C   + + + C   AC +   W ++SSW++C+ TC  GTQ+R+R C +  P++ G  C G  K+T+ C ++  C +NG WS +S+WSSC+ +CG      R+R C NP P++ G++C G + +T+ C+
Sbjct:  187 TCGGGTQTRTRTCTNPKPAHGGKECVGDAKETRHCSEAACAVNGGWSDYSSWSSCTKTCGGGTQTRTRTCTNPKPAHGGKECVGDAKETRHCSEAA-CAVNGGWSDYSSWSSCTKTCGGGT-QTRTRTCTNPKPAHGGKECVGDAKETRHCS 336          

HSP 2 Score: 104.76 bits (260), Expect = 8.769e-25
Identity = 62/151 (41.06%), Postives = 94/151 (62.25%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            TCG GT  R RTCTNP PA+GG  C   + + + C   AC +   W ++SSW++C+ TC  GTQ+R+R C +P  ++ G  C G  K+T+ C ++  C +NG WS +S W+ CS +CG     +R+R C +PAPS+ G+ C+G + + + C
Sbjct:  244 TCGGGTQTRTRTCTNPKPAHGGKECVGDAKETRHCSEAACAVNGGWSDYSSWSSCTKTCGGGTQTRTRTCTNPKPAHGGKECVGDAKETRHCSEAA-CAVNGGWSDFSKWTKCSKTCGGGK-QERTRTCTSPAPSHNGKKCAGDAREEREC 392          

HSP 3 Score: 83.9593 bits (206), Expect = 6.555e-18
Identity = 40/99 (40.40%), Postives = 53/99 (53.54%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCP 803
            TCG GT  R RTCTNP PA+GG  C   + + + C   AC +   W ++S W  CS TC  G Q R+R C    PS++G  C G  ++ + C     CP
Sbjct:  301 TCGGGTQTRTRTCTNPKPAHGGKECVGDAKETRHCSEAACAVNGGWSDFSKWTKCSKTCGGGKQERTRTCTSPAPSHNGKKCAGDAREERECNTDK-CP 398          

HSP 4 Score: 68.5514 bits (166), Expect = 8.039e-13
Identity = 43/107 (40.19%), Postives = 71/107 (66.36%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT 962
            W ++SSW++C+ TC  GTQ+R+R C +  P++ G  C G  K+T+ C ++  C +NG WS +S+WSSC+ +CG      R+R C NP P++ G++C G + +T+ C+
Sbjct:  175 WSDYSSWSSCTKTCGGGTQTRTRTCTNPKPAHGGKECVGDAKETRHCSEAA-CAVNGGWSDYSSWSSCTKTCGGGT-QTRTRTCTNPKPAHGGKECVGDAKETRHCS 279          
BLAST of PKD1L-2 vs. Ensembl Nematostella
Match: EDO31173 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYQ3])

HSP 1 Score: 85.8853 bits (211), Expect = 9.383e-21
Identity = 45/92 (48.91%), Postives = 58/92 (63.04%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQAC 782
            TCG+GT  R R C +PAP NGG +C   S+Q Q C     P+   WG W++W+ACS TC +GTQ+R+R+C DP+  N G  C G    TQAC
Sbjct:   17 TCGDGTQTRTRVCDDPAPKNGGSACVGDSSQTQACKIATSPVDGHWGSWTAWSACSKTCGDGTQTRTRMCDDPAPKNGGSACVGDSSQTQAC 108          

HSP 2 Score: 72.7886 bits (177), Expect = 6.638e-16
Identity = 45/106 (42.45%), Postives = 60/106 (56.60%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            WG W++W+ACS TC +GTQ+R+RVC DP+  N G  C G    TQAC K    P+        T  S       +G   R+R+C++PAP N G  C G S+ TQ+C
Sbjct:    5 WGRWTAWSACSKTCGDGTQTRTRVCDDPAPKNGGSACVGDSSQTQAC-KIATSPV-DGHWGSWTAWSACSKTCGDGTQTRTRMCDDPAPKNGGSACVGDSSQTQAC 108          
BLAST of PKD1L-2 vs. Ensembl Nematostella
Match: EDO49967 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RES9])

HSP 1 Score: 81.6481 bits (200), Expect = 2.216e-19
Identity = 45/92 (48.91%), Postives = 55/92 (59.78%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQAC 782
            TCG G  +R RTCTNPAP  GG SC  SST  Q+C  + C +   W  WS W +CS++C  GTQSR+R C  P+  N G  CPG    T+ C
Sbjct:   20 TCGGGAQMRTRTCTNPAPIGGGRSCYGSSTDKQSCNPIPCRVDGQWSSWSGWDSCSMSCGGGTQSRTRACNSPAPRNGGRQCPGQSGQTRNC 111          

HSP 2 Score: 56.9954 bits (136), Expect = 2.073e-10
Identity = 38/106 (35.85%), Postives = 51/106 (48.11%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            W  WSSW  CS TC  G Q R+R C +P+    G +C G+  D Q+C     C +     S  +           G   R+R CN+PAP N G+ C G S  T++C
Sbjct:    8 WSSWSSWQTCSRTCGGGAQMRTRTCTNPAPIGGGRSCYGSSTDKQSC-NPIPCRV-DGQWSSWSGWDSCSMSCGGGTQSRTRACNSPAPRNGGRQCPGQSGQTRNC 111          
BLAST of PKD1L-2 vs. Ensembl Nematostella
Match: EDO33294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL1])

HSP 1 Score: 83.5741 bits (205), Expect = 9.501e-19
Identity = 50/151 (33.11%), Postives = 76/151 (50.33%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            +CG G   R R C NP PA+GG +C  S+   + C    CP+   W  W SW  C+ +C  G + R R C +  P++ G TCPG+++D + C  +  CP+     S     +        G+  R+R C +P PS+ G++C G  T +  C
Sbjct:  105 SCGTGLRYRYRACDNPFPAHGGATCPGSNEDRERCSAQPCPVPGGWSAWQSWTPCTQSCGTGLRYRYRACDNPFPAHGGATCPGSNEDRERC-SAQPCPV-DGKWSTWADWTVCSRSCGGGVQYRTRTCTSPPPSDGGRECLGDETVSSVC 253          

HSP 2 Score: 58.5362 bits (140), Expect = 5.150e-10
Identity = 36/114 (31.58%), Postives = 56/114 (49.12%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            W  W SW  C+ +C  G + R R C +  P++ G TCPG+++D + C  +  CP+     S     +        G+  R R C+NP P++ G  C G + D + C+  P  CP
Sbjct:   93 WSAWQSWTPCTQSCGTGLRYRYRACDNPFPAHGGATCPGSNEDRERC-SAQPCPV-PGGWSAWQSWTPCTQSCGTGLRYRYRACDNPFPAHGGATCPGSNEDRERCSAQP--CP 202          
BLAST of PKD1L-2 vs. Ensembl Nematostella
Match: EDO47421 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM08])

HSP 1 Score: 78.1814 bits (191), Expect = 4.498e-18
Identity = 42/92 (45.65%), Postives = 53/92 (57.61%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIIS-WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQAC 782
            TCG+GT  R R C +PAP NGG +C   S+Q Q C     P+   WG WSSW ACS +C +GT  R+R+C D    N G  C G    ++AC
Sbjct:   16 TCGDGTQTRTRVCDDPAPKNGGSACVGDSSQAQVCKIATSPVDGHWGRWSSWGACSKSCGDGTHVRTRLCDDSQAKNGGSGCVGDSSQSEAC 107          

HSP 2 Score: 59.3066 bits (142), Expect = 2.982e-11
Identity = 47/106 (44.34%), Postives = 65/106 (61.32%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            WG WS W+ACS TC +GTQ+R+RVC DP+  N G  C G     Q C K    P++G+W  WS+W +CS SCG    + R+RLC++    N G  C G S+ +++C
Sbjct:    4 WGRWSVWSACSQTCGDGTQTRTRVCDDPAPKNGGSACVGDSSQAQVC-KIATSPVDGHWGRWSSWGACSKSCGDGTHV-RTRLCDDSQAKNGGSGCVGDSSQSEAC 107          
BLAST of PKD1L-2 vs. Ensembl Medaka
Match: hmcn1 (hemicentin 1 [Source:NCBI gene;Acc:101172646])

HSP 1 Score: 90.1225 bits (222), Expect = 1.957e-19
Identity = 61/157 (38.85%), Postives = 75/157 (47.77%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDPSNS--GLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLST-----DTQSC 959
            V+CG GT  R R C +PAP +GG SC  +      C    CP+  +WG WSSW +CS TCN G   R R C  P  +  G  C G D+  Q C   + CP     S            G      R RLCNNPAPS  G+ C G S+     +TQ+C
Sbjct: 4451 VSCGGGTRQRTRLCASPAPQHGGRSCEGNGVHMDFCNTDPCPVSGNWGTWSSWGSCSKTCNGGQMRRYRTCDSPRPAFGGRACAGADEQMQRCSIVS-CPDGNWGSWQPWGQCSVSCGGGERT--RLRLCNNPAPSYGGRQCPGDSSLLSRCNTQAC 4604          

HSP 2 Score: 86.6557 bits (213), Expect = 3.326e-18
Identity = 58/159 (36.48%), Postives = 70/159 (44.03%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            V+CG G   R R C NP PANGG  C  S T+  +C    CP  +W EWS W  CS TC  G ++R R C +  P   G  C G   +   C   ++ P                     G+  R RLCNNP P   G  C G  TDTQS   +   CP
Sbjct: 4283 VSCGAGIQKRLRQCNNPLPANGGHHCAGSDTEKSSCQGNPCPDGNWSEWSVWEECSQTCGQGNRTRFRTCSNPLPQYGGKPCEGKAVEVIMC---SVRPCPAGNWGSWLPWGPCSETCGRGMQSRIRLCNNPPPQFDGSQCEG--TDTQSKMCLERLCP 4436          

HSP 3 Score: 85.1149 bits (209), Expect = 1.085e-17
Identity = 60/158 (37.97%), Postives = 84/158 (53.16%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDPS--NSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            TCG G   R R C NP P   G  C  + TQ + C+   CP   W  W +W  CSV+C  GT+ R+R+C  P+  + G +C G       C     CP++GNW +WS+W SCS +C     M+R R C++P P+  G+ C+G     Q C+ V  +CP
Sbjct: 4396 TCGRGMQSRIRLCNNPPPQFDGSQCEGTDTQSKMCLERLCPHGKWSSWMNWGPCSVSCGGGTRQRTRLCASPAPQHGGRSCEGNGVHMDFCNTDP-CPVSGNWGTWSSWGSCSKTCNGGQ-MRRYRTCDSPRPAFGGRACAGADEQMQRCSIV--SCP 4549          

HSP 4 Score: 52.373 bits (124), Expect = 4.656e-7
Identity = 36/114 (31.58%), Postives = 50/114 (43.86%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            + EWS W +CSV+C  G Q R R C +  P+N G  C G+D +  +C +   CP                    N    R R C+NP P   G+ C G + +   C+  P  CP
Sbjct: 4272 YSEWSEWGSCSVSCGAGIQKRLRQCNNPLPANGGHHCAGSDTEKSSC-QGNPCPDGNWSEWSVWEECSQTCGQGNRT--RFRTCSNPLPQYGGKPCEGKAVEVIMCSVRP--CP 4380          
BLAST of PKD1L-2 vs. Ensembl Medaka
Match: thbs2a (thrombospondin 2 [Source:NCBI gene;Acc:101175102])

HSP 1 Score: 81.2629 bits (199), Expect = 1.906e-16
Identity = 44/101 (43.56%), Postives = 51/101 (50.50%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIIS-WGEWSSWAACSVTCNNGTQSRSRVC--IDPSNSGLTCPGTDKDTQACGKSTLCPI 806
            VTCG G   R R C  P P  GG  C  S  + Q C    CPI   WG WS WA+CS TC  G +SR+R C    P + G  C G   D+ +C K   CPI
Sbjct:  453 VTCGEGQITRIRHCNAPVPQLGGTDCEGSGRETQNCTATPCPIDGGWGPWSPWASCSATCGGGIKSRTRECNSPQPQHGGKKCLGEASDSDSCNKKD-CPI 552          

HSP 2 Score: 66.2402 bits (160), Expect = 1.459e-11
Identity = 61/159 (38.36%), Postives = 82/159 (51.57%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VTCG GT  R R+C   +    G S          C +       W  WS W++CSVTC  G  +R R C  P     G  C G+ ++TQ C  +T CPI+G W  WS W+SCS +CG   I  R+R CN+P P + G+ C G ++D+ SC     +CP
Sbjct:  397 VTCGIGTQQRGRSCDATSNPCSGPSIQTRKCSLGKCDSRVRQDGGWSLWSPWSSCSVTCGEGQITRIRHCNAPVPQLGGTDCEGSGRETQNC-TATPCPIDGGWGPWSPWASCSATCGGG-IKSRTRECNSPQPQHGGKKCLGEASDSDSCNK--KDCP 551          

HSP 3 Score: 51.6026 bits (122), Expect = 7.858e-7
Identity = 42/114 (36.84%), Postives = 48/114 (42.11%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQAC--GKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            W  WS W  C+VTC  GTQ R R C   SN    C G    T+ C  GK           S  +  S        G + R R CN P P   G DC G   +TQ+CT  P  CP
Sbjct:  386 WSPWSEWTECTVTCGIGTQQRGRSCDATSNP---CSGPSIQTRKCSLGKCDSRVRQDGGWSLWSPWSSCSVTCGEGQITRIRHCNAPVPQLGGTDCEGSGRETQNCTATP--CP 494          
BLAST of PKD1L-2 vs. Ensembl Medaka
Match: thbs2a (thrombospondin 2 [Source:NCBI gene;Acc:101175102])

HSP 1 Score: 80.8777 bits (198), Expect = 2.190e-16
Identity = 44/101 (43.56%), Postives = 51/101 (50.50%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIIS-WGEWSSWAACSVTCNNGTQSRSRVC--IDPSNSGLTCPGTDKDTQACGKSTLCPI 806
            VTCG G   R R C  P P  GG  C  S  + Q C    CPI   WG WS WA+CS TC  G +SR+R C    P + G  C G   D+ +C K   CPI
Sbjct:  438 VTCGEGQITRIRHCNAPVPQLGGTDCEGSGRETQNCTATPCPIDGGWGPWSPWASCSATCGGGIKSRTRECNSPQPQHGGKKCLGEASDSDSCNKKD-CPI 537          

HSP 2 Score: 66.2402 bits (160), Expect = 1.515e-11
Identity = 61/159 (38.36%), Postives = 82/159 (51.57%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VTCG GT  R R+C   +    G S          C +       W  WS W++CSVTC  G  +R R C  P     G  C G+ ++TQ C  +T CPI+G W  WS W+SCS +CG   I  R+R CN+P P + G+ C G ++D+ SC     +CP
Sbjct:  382 VTCGIGTQQRGRSCDATSNPCSGPSIQTRKCSLGKCDSRVRQDGGWSLWSPWSSCSVTCGEGQITRIRHCNAPVPQLGGTDCEGSGRETQNC-TATPCPIDGGWGPWSPWASCSATCGGG-IKSRTRECNSPQPQHGGKKCLGEASDSDSCNK--KDCP 536          

HSP 3 Score: 51.6026 bits (122), Expect = 8.091e-7
Identity = 42/114 (36.84%), Postives = 48/114 (42.11%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQAC--GKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            W  WS W  C+VTC  GTQ R R C   SN    C G    T+ C  GK           S  +  S        G + R R CN P P   G DC G   +TQ+CT  P  CP
Sbjct:  371 WSPWSEWTECTVTCGIGTQQRGRSCDATSNP---CSGPSIQTRKCSLGKCDSRVRQDGGWSLWSPWSSCSVTCGEGQITRIRHCNAPVPQLGGTDCEGSGRETQNCTATP--CP 479          
BLAST of PKD1L-2 vs. Ensembl Medaka
Match: adgrb3 (adhesion G protein-coupled receptor B3 [Source:NCBI gene;Acc:101172925])

HSP 1 Score: 80.1073 bits (196), Expect = 4.310e-16
Identity = 59/153 (38.56%), Postives = 88/153 (57.52%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLA-CPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTN 965
            VTCG G+ +R RTC +P     G  C+    + + C N A CP+   W EWS W+ CS TC  G ++R+R+C  P + G  C G +  T+ C  + LCP++G W  WS+WS CSV+C +    QR+R C+  A ++ G +C G   +++ C N
Sbjct:  304 VTCGQGSQVRTRTCVSPY----GTHCSGPLRESRVCNNTAPCPVHGVWEEWSPWSLCSFTCGRGQRTRTRMCAPPQHGGRACDGPETQTKLCNIA-LCPVDGQWQEWSSWSVCSVTCANGT-QQRTRQCS--AAAHGGSECRGHWAESRECHN 448          

HSP 2 Score: 65.855 bits (159), Expect = 2.361e-11
Identity = 36/98 (36.73%), Postives = 50/98 (51.02%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPI-ISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            VTC NGT  R R C+  A A+GG  C     + + C N  C     W  W  W+ CS +C+ G Q R+RVC   + +G  C GT ++ + C +   CP
Sbjct:  413 VTCANGTQQRTRQCS--AAAHGGSECRGHWAESRECHNPDCTANGQWNPWGPWSGCSKSCDGGWQRRARVCQGAAVTGQQCDGTGEEVRKCSEQR-CP 507          

HSP 3 Score: 55.0694 bits (131), Expect = 6.000e-8
Identity = 45/110 (40.91%), Postives = 64/110 (58.18%), Query Frame = 3
Query:  654 EWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            EWS W++CSVTC  G+Q R+R C+ P   G  C G  ++++ C  +  CP++G W  WS WS CS +CG      R+R+C    P + G+ C G  T T+ C N+ L CP
Sbjct:  295 EWSQWSSCSVTCGQGSQVRTRTCVSP--YGTHCSGPLRESRVCNNTAPCPVHGVWEEWSPWSLCSFTCGRGQ-RTRTRMC--APPQHGGRACDGPETQTKLC-NIAL-CP 397          
BLAST of PKD1L-2 vs. Ensembl Medaka
Match: adgrb3 (adhesion G protein-coupled receptor B3 [Source:NCBI gene;Acc:101172925])

HSP 1 Score: 80.1073 bits (196), Expect = 4.660e-16
Identity = 59/153 (38.56%), Postives = 88/153 (57.52%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLA-CPIIS-WGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTN 965
            VTCG G+ +R RTC +P     G  C+    + + C N A CP+   W EWS W+ CS TC  G ++R+R+C  P + G  C G +  T+ C  + LCP++G W  WS+WS CSV+C +    QR+R C+  A ++ G +C G   +++ C N
Sbjct:  267 VTCGQGSQVRTRTCVSPY----GTHCSGPLRESRVCNNTAPCPVHGVWEEWSPWSLCSFTCGRGQRTRTRMCAPPQHGGRACDGPETQTKLCNIA-LCPVDGQWQEWSSWSVCSVTCANGT-QQRTRQCS--AAAHGGSECRGHWAESRECHN 411          

HSP 2 Score: 65.4698 bits (158), Expect = 2.644e-11
Identity = 36/98 (36.73%), Postives = 50/98 (51.02%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPI-ISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCP 803
            VTC NGT  R R C+  A A+GG  C     + + C N  C     W  W  W+ CS +C+ G Q R+RVC   + +G  C GT ++ + C +   CP
Sbjct:  376 VTCANGTQQRTRQCS--AAAHGGSECRGHWAESRECHNPDCTANGQWNPWGPWSGCSKSCDGGWQRRARVCQGAAVTGQQCDGTGEEVRKCSEQR-CP 470          

HSP 3 Score: 55.0694 bits (131), Expect = 6.251e-8
Identity = 45/110 (40.91%), Postives = 64/110 (58.18%), Query Frame = 3
Query:  654 EWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            EWS W++CSVTC  G+Q R+R C+ P   G  C G  ++++ C  +  CP++G W  WS WS CS +CG      R+R+C    P + G+ C G  T T+ C N+ L CP
Sbjct:  258 EWSQWSSCSVTCGQGSQVRTRTCVSP--YGTHCSGPLRESRVCNNTAPCPVHGVWEEWSPWSLCSFTCGRGQ-RTRTRMC--APPQHGGRACDGPETQTKLC-NIAL-CP 360          
BLAST of PKD1L-2 vs. Planmine SMEST
Match: SMESG000014725.1 (SMESG000014725.1)

HSP 1 Score: 499.204 bits (1284), Expect = 9.216e-171
Identity = 289/293 (98.63%), Postives = 290/293 (98.98%), Query Frame = 3
Query:  105 VQANYTIYLQVSSKPSSGSTAMNYIILKGNLGISPLTNINNFPNGTANPAILKDGQLVVINDKFPNDYGYINTVTVGNLGATLTMQSLNIFDNVRNLWSNMTFIYPIGYIQISSSTDFLYLVXXXXXXXXXXXXXXVTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VQANYTIYLQVSSKPSSGSTAMNYIILKGNLGISPLTNINNFPNGTANPAILKDGQLVVINDKFPNDYGYINTVTVGNLGATLTMQSLNIFDNVRNLWSNMTFIYPIGYIQISSSTDFLYLVNGSWSDWSNWGSCSVTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCID SNSGL CPGTDKDTQACG STLCPINGNWSSW+TWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP
Sbjct:   23 VQANYTIYLQVSSKPSSGSTAMNYIILKGNLGISPLTNINNFPNGTANPAILKDGQLVVINDKFPNDYGYINTVTVGNLGATLTMQSLNIFDNVRNLWSNMTFIYPIGYIQISSSTDFLYLVNGSWSDWSNWGSCSVTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDSSNSGLPCPGTDKDTQACGNSTLCPINGNWSSWNTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 315          

HSP 2 Score: 125.561 bits (314), Expect = 1.119e-31
Identity = 102/165 (61.82%), Postives = 115/165 (69.70%), Query Frame = 3
Query:  513 VTCG-NGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVN--LACPIISWGEWSSWAACSVTC--NNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTL-CPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            V+CG NG   R R C NPAP+N G  C+  ST  Q+C N  L CP+       S  +       +NG   RSR+C +P  SN+G  C G   DTQ+C   +L CP+NGNWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP
Sbjct:  271 VSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGSWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVSLNCPVNGNWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 435          

HSP 3 Score: 61.6178 bits (148), Expect = 2.860e-10
Identity = 75/146 (51.37%), Postives = 93/146 (63.70%), Query Frame = 3
Query:  519 CG-NGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVN--LACPII-SWGEWSSWAACSVTC-NNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTL-CPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCS 932
            CG NG   R R C NPAP+N G  C+  ST  Q+C N  L CP+  +W  WS+W++CSV+C +NG   RSR+C +P  SN+G  C G   DTQ+C    L CP+NG WSSWSTWSSCS SCG      R+R C+NP+P N G  CS
Sbjct:  333 CGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVSLNCPVNGNWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGMWSSWSTWSSCSSSCGFGT-RSRTRNCDNPSPLNGGLGCS 477          
BLAST of PKD1L-2 vs. Planmine SMEST
Match: SMESG000014725.1 (SMESG000014725.1)

HSP 1 Score: 499.204 bits (1284), Expect = 9.219e-171
Identity = 289/293 (98.63%), Postives = 290/293 (98.98%), Query Frame = 3
Query:  105 VQANYTIYLQVSSKPSSGSTAMNYIILKGNLGISPLTNINNFPNGTANPAILKDGQLVVINDKFPNDYGYINTVTVGNLGATLTMQSLNIFDNVRNLWSNMTFIYPIGYIQISSSTDFLYLVXXXXXXXXXXXXXXVTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            VQANYTIYLQVSSKPSSGSTAMNYIILKGNLGISPLTNINNFPNGTANPAILKDGQLVVINDKFPNDYGYINTVTVGNLGATLTMQSLNIFDNVRNLWSNMTFIYPIGYIQISSSTDFLYLVNGSWSDWSNWGSCSVTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCID SNSGL CPGTDKDTQACG STLCPINGNWSSW+TWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP
Sbjct:   21 VQANYTIYLQVSSKPSSGSTAMNYIILKGNLGISPLTNINNFPNGTANPAILKDGQLVVINDKFPNDYGYINTVTVGNLGATLTMQSLNIFDNVRNLWSNMTFIYPIGYIQISSSTDFLYLVNGSWSDWSNWGSCSVTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDSSNSGLPCPGTDKDTQACGNSTLCPINGNWSSWNTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 313          

HSP 2 Score: 125.561 bits (314), Expect = 1.218e-31
Identity = 102/165 (61.82%), Postives = 115/165 (69.70%), Query Frame = 3
Query:  513 VTCG-NGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVN--LACPIISWGEWSSWAACSVTC--NNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTL-CPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            V+CG NG   R R C NPAP+N G  C+  ST  Q+C N  L CP+       S  +       +NG   RSR+C +P  SN+G  C G   DTQ+C   +L CP+NGNWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP
Sbjct:  269 VSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGSWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVSLNCPVNGNWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 433          

HSP 3 Score: 61.6178 bits (148), Expect = 3.099e-10
Identity = 75/146 (51.37%), Postives = 93/146 (63.70%), Query Frame = 3
Query:  519 CG-NGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVN--LACPII-SWGEWSSWAACSVTC-NNGTQSRSRVCIDP--SNSGLTCPGTDKDTQACGKSTL-CPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCS 932
            CG NG   R R C NPAP+N G  C+  ST  Q+C N  L CP+  +W  WS+W++CSV+C +NG   RSR+C +P  SN+G  C G   DTQ+C    L CP+NG WSSWSTWSSCS SCG      R+R C+NP+P N G  CS
Sbjct:  331 CGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVSLNCPVNGNWSSWSTWSSCSVSCGSNGIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCPVNGMWSSWSTWSSCSSSCGFGT-RSRTRNCDNPSPLNGGLGCS 475          
BLAST of PKD1L-2 vs. Planmine SMEST
Match: SMESG000014728.1 (SMESG000014728.1)

HSP 1 Score: 326.635 bits (836), Expect = 1.159e-110
Identity = 205/292 (70.21%), Postives = 228/292 (78.08%), Query Frame = 3
Query:  105 VQANYTIYLQVSSKPSSGSTAMNYIILKGNLGISPLTNINNFPNGTANPAILKDGQLVVINDKFPNDYGYINTVTVGNLGATLTMQSLNIFDNVRNLWSNMTFIYPIGYIQISSSTDFLYLVXXXXXXXXXXXXXXVTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNC 980
             +ANY++YLQVSSKPSSGS A NYIILKGNLG SPLT INNFPNGTANP IL+DGQL VI DKFP DYGYINTVTVGN G TL MQSLN+FDN+RNLWSNMTFIYPIGYIQISSSTDFLY VNGSWSDW +WG CS+TCG+GT +RQRTCTNP PANGG++CN SSTQWQ CVN  CP  SW +WSSW+ CSVTC+ G QSRSR C D +     C G   D Q C  +  CPI+G W+ WS WS+CS  CG NG +QR+R CNNP PSN G +CSG S D Q C N   NC
Sbjct:   21 AKANYSVYLQVSSKPSSGSGATNYIILKGNLGYSPLTAINNFPNGTANPVILQDGQLAVIKDKFPKDYGYINTVTVGNYGDTLLMQSLNVFDNMRNLWSNMTFIYPIGYIQISSSTDFLYPVNGSWSDWLSWGGCSITCGSGTMVRQRTCTNPDPANGGLACNGSSTQWQACVNSTCPASSWSDWSSWSECSVTCDLGFQSRSRSCTDSN-----CDGNKYDFQICLNNFSCPIDGEWNVWSNWSTCSEPCGLNGTIQRTRECNNPFPSNGGVNCSGPSVDNQMCFNYSQNC 307          
BLAST of PKD1L-2 vs. Planmine SMEST
Match: SMESG000014733.1 (SMESG000014733.1)

HSP 1 Score: 241.506 bits (615), Expect = 6.330e-77
Identity = 150/289 (51.90%), Postives = 183/289 (63.32%), Query Frame = 3
Query:  108 QANYTIYLQVSSKPSSGSTAMNYIILKGNLGISPLTNINNFPNGTANPAILKDGQLVVINDKFPNDYGYINTVTVGNLGATLTMQSLNIFDNVRNLWSNMTFIYPIGYIQISSSTDFLYLVXXXXXXXXXXXXXXVTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII---SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
             ANYTIYL VSS P SGS ++NY+ L G+ G SP T IN FPNG+ANP +L DGQL VI +KFP+DYGYI+ V++GN    LTMQ+LNIFD  RNLWSNM+F +P G IQ  SS D LY V G WSDWS WG+CS TCGNGT  RQR CTNP PANGG  C DS+ + Q+C N  CP++    W EWS+W +CSVTC NG  SR R+C +  P+N G  C  +     AC  +  C I     S  +          NG+M R+R C NP P+N G  C+    +   C
Sbjct:   20 DANYTIYLYVSSIPGSGSASINYLTLTGDKGSSPKTPINTFPNGSANPNVLVDGQLTVIPNKFPSDYGYISVVSIGNTNDNLTMQALNIFDVFRNLWSNMSFNFPFGGIQAGSSIDILYPVTGGWSDWSLWGACSATCGNGTMNRQRICTNPVPANGGALCKDSNNETQSCFNNTCPMVVNGGWTEWSNWGSCSVTCGNGNLSRQRMCTNPIPTNGGTICNESGTQWMACSVNP-CAI-NGGWSDWSQWGNCSVFCGNGVMSRTRNCTNPIPANGGSPCNNSYIEWMPC 306          

HSP 2 Score: 51.2174 bits (121), Expect = 4.857e-7
Identity = 23/42 (54.76%), Postives = 26/42 (61.90%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACP 638
            V CGNG   R R CTNP PANGG  CN+S  +W  C   +CP
Sbjct:  271 VFCGNGVMSRTRNCTNPIPANGGSPCNNSYIEWMPCQGDSCP 312          
BLAST of PKD1L-2 vs. Planmine SMEST
Match: SMESG000021248.1 (SMESG000021248.1)

HSP 1 Score: 88.5817 bits (218), Expect = 5.943e-19
Identity = 70/160 (43.75%), Postives = 90/160 (56.25%), Query Frame = 3
Query:  519 CGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCV-NLACPI-ISWGEWSSWAACSVTCN-NGTQSRSRVC--IDPSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            CG+G   R R C NP P+N G  C   + +   C  NL CPI  +W EW  W  CS+TC   G+Q R R C   +P N+G  C G + + +AC K   CPI+G WSSWS WS CS SCGS  I Q++R C+NP P   G +C G +   + C  +P  CP
Sbjct: 3141 CGSGIRQRTRRCDNPPPSNLGKPCIGEAIEDILCEGNLPCPINGAWSEWKPWTVCSITCGFGGSQRRDRSCNSPEPKNNGKFCDGKELEVRACSKGP-CPIDGRWSSWSKWSYCSKSCGSG-IKQKARRCDNPTPKFGGANCVGTNIKKEKCNELP--CP 3296          

HSP 2 Score: 85.1149 bits (209), Expect = 8.132e-18
Identity = 60/160 (37.50%), Postives = 85/160 (53.12%), Query Frame = 3
Query:  513 VTCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCTNVPLNCP 983
            ++CG G   R+R C NP P+  GM+C     + + C+   CP    W  W  W+ CS  C +G + R+R C +  PSN G  C G   +   C  +  CPING WS W  W+ CS++CG  G  +R R CN+P P N G+ C G   + ++C+  P  CP
Sbjct: 3082 LSCGKGFISRKRLCNNPPPSEFGMTCIGEDFEKRDCLLRFCPTDGEWSPWQEWSICSTKCGSGIRQRTRRCDNPPPSNLGKPCIGEAIEDILCEGNLPCPINGAWSEWKPWTVCSITCGFGGSQRRDRSCNSPEPKNNGKFCDGKELEVRACSKGP--CP 3239          

HSP 3 Score: 77.7962 bits (190), Expect = 2.041e-15
Identity = 49/153 (32.03%), Postives = 75/153 (49.02%), Query Frame = 3
Query:  513 VTCG-NGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDPSNS--GLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSC 959
            +TCG  G+  R R+C +P P N G  C+    + + C    CPI   W  WS W+ CS +C +G + ++R C +P+    G  C GT+   + C +   CP+     S     S   +   +G+ +R R C  P+P+  GQ C G S + Q C
Sbjct: 3197 ITCGFGGSQRRDRSCNSPEPKNNGKFCDGKELEVRACSKGPCPIDGRWSSWSKWSYCSKSCGSGIKQKARRCDNPTPKFGGANCVGTNIKKEKCNELP-CPV-HGQWSNWGSWSECSTECGSGLQERDRTCTEPSPNFGGQWCRGPSKEVQKC 3347          

HSP 4 Score: 74.7146 bits (182), Expect = 1.865e-14
Identity = 35/94 (37.23%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  516 TCGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTCVNLACPII-SWGEWSSWAACSVTCNNGTQSRSRVCIDPSNS--GLTCPGTDKDTQACGK 788
            +CG+G   + R C NP P  GG +C  ++ + + C  L CP+   W  W SW+ CS  C +G Q R R C +PS +  G  C G  K+ Q C +
Sbjct: 3256 SCGSGIKQKARRCDNPTPKFGGANCVGTNIKKEKCNELPCPVHGQWSNWGSWSECSTECGSGLQERDRTCTEPSPNFGGQWCRGPSKEVQKCNE 3349          

HSP 5 Score: 59.6918 bits (143), Expect = 1.488e-9
Identity = 42/115 (36.52%), Postives = 58/115 (50.43%), Query Frame = 3
Query:  648 WGEWSSWAACSVTCNNGTQSRSRVCID--PSNSGLTCPGTDKDTQACGKSTLCPIXXXXXXXXXXXXXXXXXXXXXIMQRSRLCNNPAPSNAGQDCSGLSTDTQSCT-NVPLNCP 983
            W  W  W+ CS++C  G  SR R+C +  PS  G+TC G D + + C     CP      S     S   +   +GI QR+R C+NP PSN G+ C G + +   C  N+P  CP
Sbjct: 3071 WSAWQEWSKCSLSCGKGFISRKRLCNNPPPSEFGMTCIGEDFEKRDC-LLRFCP-TDGEWSPWQEWSICSTKCGSGIRQRTRRCDNPPPSNLGKPCIGEAIEDILCEGNLP--CP 3181          

HSP 6 Score: 49.2914 bits (116), Expect = 3.246e-6
Identity = 28/83 (33.73%), Postives = 40/83 (48.19%), Query Frame = 3
Query:  519 CGNGTTIRQRTCTNPAPANGGMSCNDSSTQWQTC---------VNLACPIISWGEWSSWAACSVTC-----NNGTQSRSRVCI 725
            CG+G   R RTCT P+P  GG  C   S + Q C         VN+  P      WS W++CS+ C     +   ++R+R C+
Sbjct: 3314 CGSGLQERDRTCTEPSPNFGGQWCRGPSKEVQKCNENKCTINKVNIVSP------WSEWSSCSLPCLKNSVDTSERTRNRKCL 3390          
The following BLAST results are available for this feature:
BLAST of PKD1L-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HMCN14.718e-2245.03hemicentin 1 [Source:HGNC Symbol;Acc:HGNC:19194][more]
ADGRB21.060e-1637.74adhesion G protein-coupled receptor B2 [Source:HGN... [more]
ADGRB21.411e-1637.74adhesion G protein-coupled receptor B2 [Source:HGN... [more]
ADGRB21.468e-1637.74adhesion G protein-coupled receptor B2 [Source:HGN... [more]
ADGRB21.469e-1637.74adhesion G protein-coupled receptor B2 [Source:HGN... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adt-13.837e-1332.26A disintegrin and metalloproteinase with thrombosp... [more]
C36B7.59.006e-933.78pep chromosome:WBcel235:X:7089228:7096449:-1 gene:... [more]
C36B7.51.007e-833.78pep chromosome:WBcel235:X:7089228:7096449:-1 gene:... [more]
unc-51.459e-839.29Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
unc-51.493e-839.29Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Sema5c1.953e-1534.01gene:FBgn0284221 transcript:FBtr0076052[more]
Sema5c2.006e-1534.01gene:FBgn0284221 transcript:FBtr0300339[more]
gogo4.443e-644.00gene:FBgn0052227 transcript:FBtr0074848[more]
back to top
BLAST of PKD1L-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmcn12.009e-2245.00hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322][more]
hmcn12.028e-2245.00hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322][more]
thbs2a2.799e-1947.52thrombospondin 2a [Source:ZFIN;Acc:ZDB-GENE-020708... [more]
thbs2a3.127e-1947.52thrombospondin 2a [Source:ZFIN;Acc:ZDB-GENE-020708... [more]
thbs2a3.300e-1947.52thrombospondin 2a [Source:ZFIN;Acc:ZDB-GENE-020708... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eftud25.867e-2241.06elongation factor Tu GTP binding domain containing... [more]
eftud25.867e-2241.06elongation factor Tu GTP binding domain containing... [more]
eftud26.563e-2241.06elongation factor Tu GTP binding domain containing... [more]
galnt49.348e-1539.87polypeptide N-acetylgalactosaminyltransferase 4 [S... [more]
galnt41.089e-1439.87polypeptide N-acetylgalactosaminyltransferase 4 [S... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hmcn17.645e-2243.13hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
Hmcn18.867e-2243.13hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
Adgrb25.365e-1737.74adhesion G protein-coupled receptor B2 [Source:MGI... [more]
Adgrb25.886e-1737.74adhesion G protein-coupled receptor B2 [Source:MGI... [more]
Adgrb26.969e-1737.74adhesion G protein-coupled receptor B2 [Source:MGI... [more]
back to top
BLAST of PKD1L-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96RW7|HMCN1_HUMAN2.266e-2145.03Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1... [more]
sp|D3YXG0|HMCN1_MOUSE5.347e-2143.13Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=... [more]
sp|B3EWZ3|CADN_ACRMI1.097e-1938.96Coadhesin (Fragment) OS=Acropora millepora OX=4526... [more]
sp|B3EWY9|MLP_ACRMI1.057e-1740.25Mucin-like protein (Fragment) OS=Acropora millepor... [more]
sp|Q8CGM1|AGRB2_MOUSE5.003e-1637.74Adhesion G protein-coupled receptor B2 OS=Mus musc... [more]
back to top
BLAST of PKD1L-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFF81.457e-16398.63PKD1L-2 OS=Schmidtea mediterranea OX=79327 GN=PKD1... [more]
C3YBD51.442e-2543.21Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A3M6U2W83.650e-2538.13Uncharacterized protein OS=Pocillopora damicornis ... [more]
C3XRG81.290e-2438.94Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A1S3HCM21.343e-2341.88uncharacterized protein LOC106153735 isoform X14 O... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000044661.13.193e-1842.94pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
thbs1b6.682e-1745.54thrombospondin-1-like [Source:NCBI gene;Acc:103031... [more]
adgrb31.441e-1537.91adhesion G protein-coupled receptor B3 [Source:ZFI... [more]
thbs2b1.442e-1541.58thrombospondin 2 [Source:NCBI gene;Acc:103028711][more]
adgrb31.449e-1537.91adhesion G protein-coupled receptor B3 [Source:ZFI... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
thbs1a1.005e-1539.60thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402... [more]
ENSPMAT00000002352.12.275e-1438.78pep scaffold:Pmarinus_7.0:GL476883:4338:91444:1 ge... [more]
ENSPMAT00000000912.15.043e-1439.18pep scaffold:Pmarinus_7.0:GL477542:3:94122:1 gene:... [more]
ENSPMAT00000000072.11.689e-1340.82pep scaffold:Pmarinus_7.0:GL479818:18487:29074:1 g... [more]
ENSPMAT00000008404.12.077e-1344.33pep scaffold:Pmarinus_7.0:GL476608:255441:311832:-... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD1L-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO407601.605e-2541.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311739.383e-2148.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499672.216e-1948.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332949.501e-1933.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474214.498e-1845.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PKD1L-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmcn11.957e-1938.85hemicentin 1 [Source:NCBI gene;Acc:101172646][more]
thbs2a1.906e-1643.56thrombospondin 2 [Source:NCBI gene;Acc:101175102][more]
thbs2a2.190e-1643.56thrombospondin 2 [Source:NCBI gene;Acc:101175102][more]
adgrb34.310e-1638.56adhesion G protein-coupled receptor B3 [Source:NCB... [more]
adgrb34.660e-1638.56adhesion G protein-coupled receptor B3 [Source:NCB... [more]
back to top
BLAST of PKD1L-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014725.19.216e-17198.63SMESG000014725.1[more]
SMESG000014725.19.219e-17198.63SMESG000014725.1[more]
SMESG000014728.11.159e-11070.21SMESG000014728.1[more]
SMESG000014733.16.330e-7751.90SMESG000014733.1[more]
SMESG000021248.15.943e-1943.75SMESG000021248.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30004732
GenBankAKN21725.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004732 ID=SMED30004732|Name=PKD1L-2|organism=Schmidtea mediterranea sexual|type=transcript|length=984bp
ATTGTTTCGGTATTAAACAAATTTCTCGACAACTCCTTCAAAGGATGAGT
CTTATAAATTTGTGGATCTTACAGATCCTTATAAACCTTACCCTTATAAC
CATTGTTCAAGCAAATTATACAATTTATCTACAAGTCAGTTCAAAACCTT
CAAGTGGATCCACAGCAATGAACTACATCATTCTCAAAGGAAATCTTGGA
ATCTCGCCTCTTACGAATATCAATAACTTCCCAAATGGTACTGCGAACCC
TGCGATTCTGAAAGACGGACAATTGGTCGTCATAAACGACAAGTTCCCAA
ATGACTACGGATACATCAACACGGTCACGGTGGGGAATCTCGGGGCCACT
TTGACAATGCAATCGTTGAATATATTTGATAATGTAAGAAACTTGTGGTC
AAACATGACATTTATCTATCCGATTGGTTACATTCAGATCAGCTCAAGCA
CTGACTTTTTATATTTAGTGAACGGAAGTTGGTCGGATTGGTCTAATTGG
GGAAGTTGTTCGGTAACTTGTGGAAACGGGACAACAATTCGACAAAGGAC
GTGTACTAATCCAGCGCCTGCAAACGGTGGGATGAGTTGTAACGATTCGA
GTACACAATGGCAAACTTGTGTAAATTTGGCATGTCCAATTATTTCTTGG
GGTGAATGGTCGTCTTGGGCAGCTTGTTCGGTAACTTGCAATAATGGAAC
ACAGAGTCGATCCAGAGTTTGTATTGACCCGTCCAACTCAGGGCTCACAT
GTCCTGGTACAGATAAAGATACTCAAGCATGTGGAAAGAGCACCTTATGT
CCAATTAATGGAAATTGGAGTTCATGGAGTACATGGTCATCATGCTCGGT
TTCGTGTGGATCCAATGGCATTATGCAAAGAAGCCGCCTATGTAACAATC
CGGCACCGTCAAACGCTGGACAGGACTGTTCTGGTCTTTCAACTGATACT
CAAAGCTGTACAAATGTTCCATTGAATTGTCCAG
back to top

protein sequence of SMED30004732-orf-1

>SMED30004732-orf-1 ID=SMED30004732-orf-1|Name=SMED30004732-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=327bp
CFGIKQISRQLLQRMSLINLWILQILINLTLITIVQANYTIYLQVSSKPS
SGSTAMNYIILKGNLGISPLTNINNFPNGTANPAILKDGQLVVINDKFPN
DYGYINTVTVGNLGATLTMQSLNIFDNVRNLWSNMTFIYPIGYIQISSST
DFLYLVNGSWSDWSNWGSCSVTCGNGTTIRQRTCTNPAPANGGMSCNDSS
TQWQTCVNLACPIISWGEWSSWAACSVTCNNGTQSRSRVCIDPSNSGLTC
PGTDKDTQACGKSTLCPINGNWSSWSTWSSCSVSCGSNGIMQRSRLCNNP
APSNAGQDCSGLSTDTQSCTNVPLNCP
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004096catalase activity
GO:0020037heme binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0098869cellular oxidant detoxification
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0007520dorsal-ventral axis of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036383TSP1_rpt_sf
IPR000884TSP1_rpt
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR01705TSP1REPEATcoord: 270..283
score: 53.95
coord: 289..300
score: 44.35
coord: 308..319
score: 34.23
NoneNo IPR availablePANTHERPTHR22906:SF30COMPLEMENT FACTOR PROPERDINcoord: 118..320
NoneNo IPR availablePANTHERPTHR22906PROPERDINcoord: 118..320
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
IPR000884Thrombospondin type-1 (TSP1) repeatSMARTSM00209TSP1_2coord: 216..267
e-value: 4.1E-12
score: 56.2
coord: 272..327
e-value: 4.7E-12
score: 56.0
coord: 160..212
e-value: 3.8E-13
score: 59.7
IPR000884Thrombospondin type-1 (TSP1) repeatPFAMPF00090TSP_1coord: 217..266
e-value: 5.2E-12
score: 45.8
coord: 161..211
e-value: 2.2E-12
score: 47.0
coord: 273..321
e-value: 1.0E-12
score: 48.1
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 157..212
score: 13.039
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 269..327
score: 13.134
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 213..267
score: 12.241
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 269..323
e-value: 5.9E-18
score: 66.8
coord: 157..211
e-value: 9.5E-17
score: 63.0
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 215..260
e-value: 2.0E-12
score: 49.3
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 155..211
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 216..260
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 266..321