FMRFamide-activated amiloride-sensitive sodium channel

Overview
NameFMRFamide-activated amiloride-sensitive sodium channel
Smed IDSMED30004731
Length (bp)1984
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30004731) t-SNE clustered cells

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30004731) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30004731) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30004731) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004731

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30004731SMESG000039581.1 SmedASXL_015475SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30004731SMESG000039581.1 dd_Smed_v4_18385_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004731SMESG000039581.1 dd_Smed_v4_18385_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004731SMESG000039581.1 dd_Smed_v4_18385_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30004731SMESG000039581.1 dd_Smed_v4_18385_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004731SMESG000039581.1 dd_Smed_v4_18385_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004731SMESG000039581.1 dd_Smed_v4_18385_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30004731SMESG000039581.1 dd_Smed_v6_18385_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 57.7658 bits (138), Expect = 4.953e-8
Identity = 58/232 (25.00%), Postives = 96/232 (41.38%), Query Frame = 3
Query:  783 FSHHEHFNCYTFEAKVDKITTLGIIVSMGPPPDYSAT-----EQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYN-DLERFY--NYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRAT---EWHLHWIRLQ 1445
            F H  + NCYTF  K +      + +S  P  +   +     EQ   +       G +V+VH    P  +D+GG ++ PG    IS R  +  L+       + D  K   +  +E  Y   YTQ +C+ S  Q+ +I EC C +I+ PR     + + YC       D  + +    C   +Q D +        KC + C+  +Y+ S   ++W +    EW    +  Q
Sbjct:  297 FHHPMYGNCYTFNDKNNS----NLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMR--KETLDRLGGD--YGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPR----PQNVEYC-------DYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRWPSVTSQEWVFQMLSRQ 509          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 57.7658 bits (138), Expect = 5.779e-8
Identity = 57/233 (24.46%), Postives = 95/233 (40.77%), Query Frame = 3
Query:  783 FSHHEHFNCYTFEAK------VDKITTLGIIVSMGPPPDYSATEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYN-DLERFY--NYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRAT---EWHLHWIRLQ 1445
            F H  + NCYTF  K      +  +  +   +S+         EQ   +       G +V+VH    P  +D+GG ++ PG    IS R  +  L+       + D  K   +  +E  Y   YTQ +C+ S  Q+ +I EC C +I+ PR     + + YC       D  + +    C   +Q D +        KC + C+  +Y+ S   ++W +    EW    +  Q
Sbjct:  320 FHHPMYGNCYTFNDKNNSNLWMSSMPGINNGLSL-----MLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMR--KETLDRLGGD--YGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPR----PQNVEYC-------DYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRWPSVTSQEWVFQMLSRQ 532          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 57.3806 bits (137), Expect = 6.846e-8
Identity = 57/233 (24.46%), Postives = 95/233 (40.77%), Query Frame = 3
Query:  783 FSHHEHFNCYTFEAK------VDKITTLGIIVSMGPPPDYSATEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYN-DLERFY--NYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRAT---EWHLHWIRLQ 1445
            F H  + NCYTF  K      +  +  +   +S+         EQ   +       G +V+VH    P  +D+GG ++ PG    IS R  +  L+       + D  K   +  +E  Y   YTQ +C+ S  Q+ +I EC C +I+ PR     + + YC       D  + +    C   +Q D +        KC + C+  +Y+ S   ++W +    EW    +  Q
Sbjct:  356 FHHPMYGNCYTFNDKNNSNLWMSSMPGINNGLSL-----MLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMR--KETLDRLGGD--YGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPR----PQNVEYC-------DYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRWPSVTSQEWVFQMLSRQ 568          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 56.225 bits (134), Expect = 1.011e-7
Identity = 48/191 (25.13%), Postives = 80/191 (41.88%), Query Frame = 3
Query:  891 TEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYN-DLERFY--NYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRAT---EWHLHWIRLQ 1445
             EQ   +       G +V+VH    P  +D+GG ++ PG    IS R  +  L+       + D  K   +  +E  Y   YTQ +C+ S  Q+ +I EC C +I+ PR     + + YC       D  + +    C   +Q D +        KC + C+  +Y+ S   ++W +    EW    +  Q
Sbjct:   34 AEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMR--KETLDRLGGD--YGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPR----PQNVEYC-------DYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRWPSVTSQEWVFQMLSRQ 209          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: delm-2 (DEgenerin Linked to Mechanosensation [Source:UniProtKB/TrEMBL;Acc:P91103])

HSP 1 Score: 55.8398 bits (133), Expect = 6.816e-8
Identity = 83/411 (20.19%), Postives = 152/411 (36.98%), Query Frame = 3
Query:  264 FCSTTSMKGMNKITRGPKPLRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQT-PFPSITICHHHPFSTEAYKYWRENKILSPSTFNRKMRNLTHSNLM-----------GNRVMEAEGISNYD-VISVYYQNIGYNDS---MLIGHQKDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFEAKVDKITTLGIIVSMGPPPDYSATEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEW-KLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLE-----SEKCFQRCT---YMTYETSISITKWRATEW 1421
            FC TT+M G  +I +G +     WL  V T   +LI   C+L  +++   V  ++   +  +   FP ITIC+  P          +   +SP+  N  M   T   ++           GN+ ++    +N +  +  ++ + G++ S    L   Q + F  C  +   +++    C  L+       S H+       E  +     + +   +    D S    A   ++F    G +  VH P   P + +    V P   N ++Y  +   + E  PT   + +  +   + ++    Y    C+S  + K  ++ C C     P +    + L  C  F            + C+ N     N   KLE       +C Q+C    Y  + +  +    RA EW
Sbjct:   68 FCETTTMHGPKRIFQGKRWATLFWLIMVCTSIGLLITQVCILASNYLSKPVVSDVSFLINEEGIQFPQITICNFTPIRKTFVNEMNKTGQISPNMINYIMHWFTEVPILIGSSNWQLLHEGNKDLQEYQKNNPNFTVQGFFIDAGFSCSDIFKLCSFQGETF-DCCSISTPVLTPLGKCYTLDLLSSTKPSMHKQ-----TEPGIQAGLAITLDAHLEEQFDGSNGMDALFTNSF--VNGFQYFVHPPNTIPHLSSDEFTVTP---NSVAYTAISSERFELLPTNK-WGNCTEHYPSGIKSDLPYLTGNCVSLCKAKFFMENCGC----TPAVYNNERNLKECTPF----------ETLACVNNHNGSNNATGKLEFKLPRCAQCAQQCNNLIYRAFNSQGNQFSARAFEW 452          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: del-4 (DEgenerin Like [Source:UniProtKB/TrEMBL;Acc:P91835])

HSP 1 Score: 50.447 bits (119), Expect = 3.302e-6
Identity = 93/407 (22.85%), Postives = 158/407 (38.82%), Query Frame = 3
Query:  246 KNVFILFCSTTSMKGMNKITRG-PKPLRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSTEAYKYWRENKILSPSTFNRKMRNLTH---SNLMGNRVMEAEGISNYDVISVYYQNIG---YNDSMLIGHQ-KDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFEAKVDKITTLGIIVSMGPPPDYSA-----TEQAFIVDTF---RQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPY--CGNFLEDSDLSELNHRIEC--LTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKW 1406
            K VF  F   TS  G+  I     + LR  W+  V+    + I     L+ +++ + VN    ++ A +T FP++TICH +P+     K    +       +N    +      ++L  +R  +A   S + ++  Y + +    YND+  I +   D+ +SC        +Y      + ++    F +  + NC  F        T G+  S    P Y       T+Q    DT+    +A G+ + +H     P  D  G    PG  + +    V+    + P   C    K +  +       YT + C  S  Q++II  C C   Y P     +    Y  C N ++   LS LN    C  L N  +   F    + + C Q C   +Y  ++S  +W
Sbjct:    9 KYVFTDFSCWTSTHGVPHIGMANARWLRAFWILVVVVSIALFIWQFITLLTNYLSFSVNTETTLQFAERT-FPTVTICHLNPWKLSETKSVDPDMSALIDAYNSDSSSAQFGLPASLTADRQQQA---SKWTLM--YSERLNEKQYNDAADIAYSYDDMVVSC--------TYNAKTCNITDF--NDFYNPSYGNCLQFN-------TDGMYSSSRAGPLYGLRMVMRTDQ----DTYLPWTEASGVIIDIHMQDEIPYPDVFGYFAPPGTASSLGVSYVQTTRLSKPYGSCTTKTKLKTTHYTG---TYTVEACFRSCMQEKIIASCGC---YYPAYSHASNTTQYVSCDNGVQ--TLSNLN----CVDLINSADSTEFDVLTDCD-CPQPCEIDSYGVTVSTAQW 375          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Match: ppk8 (gene:FBgn0052792 transcript:FBtr0307180)

HSP 1 Score: 51.9878 bits (123), Expect = 1.375e-6
Identity = 48/197 (24.37%), Postives = 77/197 (39.09%), Query Frame = 3
Query:  933 GLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRP----VEWKLENTP--TKPCF--NDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRATEWHLHWIRLQLLTFRQLKNNPQINATDS 1499
            G K+ +H P   P++   GV + PG   ++   P     E  L N    ++ C   N++K      L  F +YTQ  C++      +I  C C+  Y PRL   +   P               H+ EC+    E + F+  +  E C   C    ++ S S   +          R+ L  FR+  +N   N TD+
Sbjct:  287 GFKIALHSPNESPNVRETGVLLAPGMETKLRIDPSKILTEKHLRNVDRRSRRCLFHNELK------LRWFAHYTQRNCVAECLSGWLIRHCGCVTFYMPRLNANDTICPL--------------HKRECV----ELIRFRTIIAMESCLDECLPSCFDLSFSAIAYST--------RISLDGFRETPSNGGWNFTDA 451          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Match: ppk8 (gene:FBgn0052792 transcript:FBtr0307179)

HSP 1 Score: 51.9878 bits (123), Expect = 1.421e-6
Identity = 48/197 (24.37%), Postives = 77/197 (39.09%), Query Frame = 3
Query:  933 GLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRP----VEWKLENTP--TKPCF--NDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRATEWHLHWIRLQLLTFRQLKNNPQINATDS 1499
            G K+ +H P   P++   GV + PG   ++   P     E  L N    ++ C   N++K      L  F +YTQ  C++      +I  C C+  Y PRL   +   P               H+ EC+    E + F+  +  E C   C    ++ S S   +          R+ L  FR+  +N   N TD+
Sbjct:  150 GFKIALHSPNESPNVRETGVLLAPGMETKLRIDPSKILTEKHLRNVDRRSRRCLFHNELK------LRWFAHYTQRNCVAECLSGWLIRHCGCVTFYMPRLNANDTICPL--------------HKRECV----ELIRFRTIIAMESCLDECLPSCFDLSFSAIAYST--------RISLDGFRETPSNGGWNFTDA 314          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Match: ppk28 (gene:FBgn0030795 transcript:FBtr0074335)

HSP 1 Score: 50.447 bits (119), Expect = 4.820e-6
Identity = 45/161 (27.95%), Postives = 70/161 (43.48%), Query Frame = 3
Query:  933 GLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKE-------RYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSIS 1394
            G KV+VH P   P + N G  V  G+   I   P+E   E+    P    IKK          NDL  +  Y++  C    E K ++ EC C+  Y PR + P  ++  CG      + ++   R++  T I+  +     L  E C+  C  +TY  ++S
Sbjct:  285 GFKVLVHNPAELPKVSNYGFVVTAGREARI---PIEPVYEDA--LPTIRSIKKSVRRCLFSDENDLAYYRTYSRKNCELECEAKLLLRECSCVLYYLPR-IDPLARV--CG-----PNDNQCTDRVQ--TEIESSLT---NLSCENCWPGCFELTYRATLS 427          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: foxe3 (forkhead box E3 [Source:Xenbase;Acc:XB-GENE-480592])

HSP 1 Score: 52.7582 bits (125), Expect = 1.767e-6
Identity = 41/169 (24.26%), Postives = 67/169 (39.64%), Query Frame = 3
Query:  924 QAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFY--NYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPN------KKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKW 1406
            QA G ++++H P  PP +++ G  + PG    I  +  E +       PC +D        L+  Y  +YT   CL+S  Q ++ + C C + + P  + P        K P  G+         L+HR  C T               +C  +CT   Y+ S    +W
Sbjct:  304 QAAGARIMIHNPNQPPRVEHQGFDIRPGTETSIGVKQDEVRHLGGKYGPCASDGNNL---GLKLLYSTSYTLQACLNSCFQYKMTETCGCGYYFYP--LPPGTEYCNYNKHPGWGHCFYQLYEKMLDHRHHCFT---------------QCPMQCTKTRYQLSAGTAQW 452          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: copg2 (coatomer protein complex subunit gamma 2 [Source:Xenbase;Acc:XB-GENE-941264])

HSP 1 Score: 51.2174 bits (121), Expect = 4.858e-6
Identity = 55/236 (23.31%), Postives = 91/236 (38.56%), Query Frame = 3
Query:  762 EEYEVKMFSHHEHFNCYT----------FEAKVDKITTLGIIVSMGPPPDYSATEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYN--YTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLS---------ELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKW 1406
            +E E   F H  + NC+T          + ++  K   L I+V          T+    +    QA G ++++H P  PP +++ G  + PG  N IS +  E          C +D        ++  YN  YT   CL+S  Q ++I+ C C + + P   +P   + YC N+ +  D            L+H + C T               +C ++C    Y  S    KW
Sbjct:  249 DEREYVHFHHPIYGNCFTINNHWKENSWYSSRPGKQYGLSIVVK---------TDLHDNMPLLSQAAGARIMIHNPNQPPLVEHQGFDIRPGTENSISVKQEEAIRLGGKYSQCTSDGSDL---GIKILYNTSYTMQACLNSCFQYKMIEVCGCGYYFYP---LP-PGMEYC-NYNKHPDWGYCFYQLYEKMLDHTLICFT---------------QCPKQCKQTEYHLSAGTAKW 452          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: copg2 (coatomer protein complex subunit gamma 2 [Source:Xenbase;Acc:XB-GENE-941264])

HSP 1 Score: 50.8322 bits (120), Expect = 6.409e-6
Identity = 57/250 (22.80%), Postives = 97/250 (38.80%), Query Frame = 3
Query:  720 RNNMISYEENCSKLEEYEVKMFSHHEHFNCYT----------FEAKVDKITTLGIIVSMGPPPDYSATEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYN--YTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLS---------ELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKW 1406
            R+ +++   N    +E E   F H  + NC+T          + ++  K   L I+V          T+    +    QA G ++++H P  PP +++ G  + PG  N IS +  E          C +D        ++  YN  YT   CL+S  Q ++I+ C C + + P   +P   + YC N+ +  D            L+H + C T               +C ++C    Y  S    KW
Sbjct:  235 RDYILTCHFNEMPCDEREYVHFHHPIYGNCFTINNHWKENSWYSSRPGKQYGLSIVVK---------TDLHDNMPLLSQAAGARIMIHNPNQPPLVEHQGFDIRPGTENSISVKQEEAIRLGGKYSQCTSDGSDL---GIKILYNTSYTMQACLNSCFQYKMIEVCGCGYYFYP---LP-PGMEYC-NYNKHPDWGYCFYQLYEKMLDHTLICFT---------------QCPKQCKQTEYHLSAGTAKW 452          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 60.077 bits (144), Expect = 6.153e-9
Identity = 52/225 (23.11%), Postives = 94/225 (41.78%), Query Frame = 3
Query:  783 FSHHEHFNCYTFEAKVDKITTLGIIVSMGPPPDYSA-TEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKW---RATEWHLHWIRLQ 1445
            F H  + NCYTF  K +    +  +  +      +  TEQ   +       G +V+VH    P  +D+GG +V PG    IS R             C  +       +L     YTQ +C+ S  Q+ +I +C C +I+ P+     K + +C ++L+ S      ++++   ++     F       KC + C+   Y+ S   ++W   ++ +W    + LQ
Sbjct:  218 FHHPMYGNCYTFNNKNNSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVKNLYP-SKYTQQVCIHSCFQENMIKKCGCAYIFYPK----PKGVEFC-DYLKQSSWGYCYYKLQAAFSLDSLGCF------SKCRKPCSVTNYKLSAGYSRWPSVKSQDWIFEMLSLQ 430          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 60.077 bits (144), Expect = 6.220e-9
Identity = 52/225 (23.11%), Postives = 94/225 (41.78%), Query Frame = 3
Query:  783 FSHHEHFNCYTFEAKVDKITTLGIIVSMGPPPDYSA-TEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKW---RATEWHLHWIRLQ 1445
            F H  + NCYTF  K +    +  +  +      +  TEQ   +       G +V+VH    P  +D+GG +V PG    IS R             C  +       +L     YTQ +C+ S  Q+ +I +C C +I+ P+     K + +C ++L+ S      ++++   ++     F       KC + C+   Y+ S   ++W   ++ +W    + LQ
Sbjct:  218 FHHPMYGNCYTFNNKNNSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVKNLYP-SKYTQQVCIHSCFQENMIKKCGCAYIFYPK----PKGVEFC-DYLKQSSWGYCYYKLQAAFSLDSLGCF------SKCRKPCSVTNYKLSAGYSRWPSVKSQDWIFEMLSLQ 430          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 59.6918 bits (143), Expect = 9.883e-9
Identity = 52/225 (23.11%), Postives = 94/225 (41.78%), Query Frame = 3
Query:  783 FSHHEHFNCYTFEAKVDKITTLGIIVSMGPPPDYSA-TEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKW---RATEWHLHWIRLQ 1445
            F H  + NCYTF  K +    +  +  +      +  TEQ   +       G +V+VH    P  +D+GG +V PG    IS R             C  +       +L     YTQ +C+ S  Q+ +I +C C +I+ P+     K + +C ++L+ S      ++++   ++     F       KC + C+   Y+ S   ++W   ++ +W    + LQ
Sbjct:  299 FHHPMYGNCYTFNNKNNSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVKNLYP-SKYTQQVCIHSCFQENMIKKCGCAYIFYPK----PKGVEFC-DYLKQSSWGYCYYKLQAAFSLDSLGCFS------KCRKPCSVTNYKLSAGYSRWPSVKSQDWIFEMLSLQ 511          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 59.6918 bits (143), Expect = 9.883e-9
Identity = 52/225 (23.11%), Postives = 94/225 (41.78%), Query Frame = 3
Query:  783 FSHHEHFNCYTFEAKVDKITTLGIIVSMGPPPDYSA-TEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKW---RATEWHLHWIRLQ 1445
            F H  + NCYTF  K +    +  +  +      +  TEQ   +       G +V+VH    P  +D+GG +V PG    IS R             C  +       +L     YTQ +C+ S  Q+ +I +C C +I+ P+     K + +C ++L+ S      ++++   ++     F       KC + C+   Y+ S   ++W   ++ +W    + LQ
Sbjct:  299 FHHPMYGNCYTFNNKNNSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVKNLYP-SKYTQQVCIHSCFQENMIKKCGCAYIFYPK----PKGVEFC-DYLKQSSWGYCYYKLQAAFSLDSLGCFS------KCRKPCSVTNYKLSAGYSRWPSVKSQDWIFEMLSLQ 511          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 59.3066 bits (142), Expect = 1.166e-8
Identity = 52/225 (23.11%), Postives = 94/225 (41.78%), Query Frame = 3
Query:  783 FSHHEHFNCYTFEAKVDKITTLGIIVSMGPPPDYSA-TEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKW---RATEWHLHWIRLQ 1445
            F H  + NCYTF  K +    +  +  +      +  TEQ   +       G +V+VH    P  +D+GG +V PG    IS R             C  +       +L     YTQ +C+ S  Q+ +I +C C +I+ P+     K + +C ++L+ S      ++++   ++     F       KC + C+   Y+ S   ++W   ++ +W    + LQ
Sbjct:  325 FHHPMYGNCYTFNNKNNSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVKNLYP-SKYTQQVCIHSCFQENMIKKCGCAYIFYPK----PKGVEFC-DYLKQSSWGYCYYKLQAAFSLDSLGCFS------KCRKPCSVTNYKLSAGYSRWPSVKSQDWIFEMLSLQ 537          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q25011|FANA_CORAP (FMRFamide-activated amiloride-sensitive sodium channel OS=Cornu aspersum OX=6535 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 8.805e-17
Identity = 122/577 (21.14%), Postives = 228/577 (39.51%), Query Frame = 3
Query:  159 HHQHSNSCRRFRARMSIYALRDRLRNPKTKNVFILFCSTTSMKGMNKI-TRGPKPLRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSTEAYKYWRENKILSPSTFNRKMRNLTHSNLMGNRVMEAEGISNYDVISVYYQNIGYNDSMLIGHQKDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFEA-------KVDKITTLGIIVSMGPPPDYSATEQAFIVD-TFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNF------------KKKLESEK-------CFQRCTYMTYETSISITKWRATEWHLHWIRLQLLTFRQLKNNPQINATDSTY-FKQWLKYWNATNLTVIDEDRKERFLANDNFAYIVLRRESDNSVRK--------YERLVISPYV---------LVSRIGGLCSFTVGITASFFVEILEFL 1751
            HHQH+    R+      Y+      N    ++     S ++  G+ KI T      + +W   V+   T   +   LLVR ++ + V    E++ +    +PS++IC+  P S          + +    FN + +NL  + L   +    E  S  + I  +Y+N+G +   L  + +D+ + C    N  + +  N S         F    +FNC+TF +              L +I S+        T   +  D     + G++V+VH PG  P   + G+ + PG  + +  + +       P   C ND+     N +++ Y YT   CL   +Q+ II  C C     P   +P+    +CG  ++D      NH  E     +ED  F            +K L +++       CFQ C+  +Y  S+S++ W    + L  +      F+Q +   Q +   + Y + + L + +  +L   D    +    + + +   + +E+ + +R+         E L +  Y          L + IGG     +GI+    +E++E +
Sbjct:   16 HHQHAMMRNRYHPHHCNYS-----DNRSAIDIIAELGSESNAHGLAKIVTSRDTKRKVIWALLVIAGFTAATLQLSLLVRKYLQFQVVELSEIKDSMPVQYPSVSICNIEPISL---------RTIRRMYFNNESQNLI-TWLRFIQKFRFEQDSFMNSIRAFYENLGQDAKKLSHNLEDMLMHCRF--NRELCHVSNFST--------FFDGNYFNCFTFNSGQRLQMHATGPENGLSLIFSVEKDDPLPGTYGVYNFDNNILHSAGVRVVVHAPGSMPSPVDHGIDIPPGYSSSVGLKAILHTRLPYPYGNCTNDM----LNGIKQ-YKYTFFACLQLCKQRLIIQRCGCKSSALPE--VPSYNATFCG-VIKDWQEINRNHSNEDHNQSEEDRAFIPTPYLACEEREQKNLNNDRTYELSCGCFQPCSETSYLKSVSLSYWPLEFYQLSAVE---RFFKQERQAGQNHFMKTAYEYLEKLAHPSQKHLARNDSHMDDILSKSYSLSEKEMAKEASDLIRQNMLRLNIYLEDLSVVEYRQLPAYGLADLFADIGGTLGLWMGISVLTIMELIELV 556          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|O97741|SCNNA_RABIT (Amiloride-sensitive sodium channel subunit alpha OS=Oryctolagus cuniculus OX=9986 GN=SCNN1A PE=2 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 2.739e-9
Identity = 55/225 (24.44%), Postives = 92/225 (40.89%), Query Frame = 3
Query:  783 FSHHEHFNCYTFEAKVDKITTLGIIVSMGPPPDYSA-TEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRAT---EWHLHWIRLQ 1445
            F H  + NCYTF  K +    +  +  +      +  TEQ   +       G +V+VH    P  +D+GG ++ PG    IS R             C  +       +L R   YTQ +C+ S  Q+ ++ EC C +I+ P   +P + + YC       D  + N    C   +Q+  +  +     KC + C+   YE S   ++W +    +W    + LQ
Sbjct:  274 FHHPMYGNCYTFNDKNNSSLWMSSMPGINNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKESLDRLGGDYGDCTQNGSDVPVKNLYR-SKYTQQVCIHSCFQENMVKECGCAYIFYP---LP-EGVEYC-------DYRKHNSWGYCYYKLQDAFSSDRLGCFTKCRKPCSVTNYELSAGYSRWPSVTSQDWVFQMLSLQ 486          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q61180|SCNNA_MOUSE (Amiloride-sensitive sodium channel subunit alpha OS=Mus musculus OX=10090 GN=Scnn1a PE=1 SV=2)

HSP 1 Score: 59.3066 bits (142), Expect = 8.366e-8
Identity = 52/225 (23.11%), Postives = 94/225 (41.78%), Query Frame = 3
Query:  783 FSHHEHFNCYTFEAKVDKITTLGIIVSMGPPPDYSA-TEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKW---RATEWHLHWIRLQ 1445
            F H  + NCYTF  K +    +  +  +      +  TEQ   +       G +V+VH    P  +D+GG +V PG    IS R             C  +       +L     YTQ +C+ S  Q+ +I +C C +I+ P+     K + +C ++L+ S      ++++   ++     F       KC + C+   Y+ S   ++W   ++ +W    + LQ
Sbjct:  324 FHHPMYGNCYTFNNKNNSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVKNLYP-SKYTQQVCIHSCFQENMIKKCGCAYIFYPK----PKGVEFC-DYLKQSSWGYCYYKLQAAFSLDSLGCFS------KCRKPCSVTNYKLSAGYSRWPSVKSQDWIFEMLSLQ 536          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|P55270|SCNNA_BOVIN (Amiloride-sensitive sodium channel subunit alpha OS=Bos taurus OX=9913 GN=SCNN1A PE=1 SV=2)

HSP 1 Score: 58.9214 bits (141), Expect = 1.034e-7
Identity = 54/211 (25.59%), Postives = 85/211 (40.28%), Query Frame = 3
Query:  783 FSHHEHFNCYTFEAKVDKITTLGIIVSMGPPPDYSA-TEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYN--YTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKW 1406
            F H  + NCYTF  K      +  +  +      +  TEQ   +       G +V+VHE   P  +D+ G ++ PG    IS               C    K      +E  YN  YTQ +C+ S  Q+ +I EC C +I+ PR   P+         +E  D  + N    C   +Q+  +  +     KC + C+   Y+ S S ++W
Sbjct:  278 FHHPMYGNCYTFNDKNSSNLWMSSMPGVNNGLSLTLRTEQNDFIPLLSTVTGARVMVHERDEPAFMDDAGFNLRPGVETSISMSKEAVDRLGGDYGDC---TKNGSEVPVENLYNTKYTQQVCIHSCFQESMIKECGCAYIFYPR---PDG--------VEFCDYRKHNSWGYCYYKLQDAFSSDRLGCFTKCRKPCSVTIYKLSASYSQW 474          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|P37088|SCNNA_HUMAN (Amiloride-sensitive sodium channel subunit alpha OS=Homo sapiens OX=9606 GN=SCNN1A PE=1 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 2.379e-7
Identity = 58/232 (25.00%), Postives = 96/232 (41.38%), Query Frame = 3
Query:  783 FSHHEHFNCYTFEAKVDKITTLGIIVSMGPPPDYSAT-----EQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYN-DLERFY--NYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRAT---EWHLHWIRLQ 1445
            F H  + NCYTF  K +      + +S  P  +   +     EQ   +       G +V+VH    P  +D+GG ++ PG    IS R  +  L+       + D  K   +  +E  Y   YTQ +C+ S  Q+ +I EC C +I+ PR     + + YC       D  + +    C   +Q D +        KC + C+  +Y+ S   ++W +    EW    +  Q
Sbjct:  297 FHHPMYGNCYTFNDKNNS----NLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMR--KETLDRLGGD--YGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPR----PQNVEYC-------DYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRWPSVTSQEWVFQMLSRQ 509          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A0R3TLF4 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS8069 PE=3 SV=1)

HSP 1 Score: 484.182 bits (1245), Expect = 6.643e-161
Identity = 244/547 (44.61%), Postives = 344/547 (62.89%), Query Frame = 3
Query:  240 KTKNVFILFCSTTSMKGMNKITRGPKPLRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSTEAYKYWRENKILSPSTFNRKMRNLTHSNLMGNRVMEAEGISNYDVISVYYQNIGYNDSMLIGHQKDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFE----AKVDKITTLGIIVSMGPPPDYSATEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRATEWHLHWIRLQLLTFRQLK----NNPQINATDSTYFKQWLKYWNATNLTVIDEDRKERFLA--------------------NDNFAYIVLRRESDNSVRKYERLVISPYVLVSRIGGLCSFTVGITASFFVEILEFLYLYYQSNKTSKLEKS 1796
            + +N+F+LFC  T+++G+ K+ +GPK LR  W  FV++M +VLI++  LL+ DF+ YDV ++ ++ L   +PFPS+TICHH+PFS +A K W+E K+LSP  FNR MRNLT ++L+ N V  AE I+ YD +SVYYQN+   +++ +GH   IFL+CM + +     E++C  L  Y+VK FSHH++ NC+TFE    A+    + L +IVSMGP       EQAF+ D F QA+GL+V+VHEPG  PD++  G+H EPGKLNEI Y PV+W   NTPT+PCF+     +YNDL+  YNYT + C+   +QK IIDEC C ++ NPR   P ++ PYCG      D  +  +R+ C+   + +++ K+K +   C  RC Y TYE+SISITKWRA  W L+W+R+Q    R  K    NN  ++ T+S  +K W +Y    NL  I  +     LA                    +D FAYIVL+R+S N+    E+LV++  VLVSRIGGLCS T+GITA+  VEI+EF+Y Y    K+   EKS
Sbjct:   17 RLRNLFVLFCRCTTVRGLGKLWQGPKFLRITWAIFVVSMMSVLIIAVVLLIVDFLNYDVGVHTKLLLDEPSPFPSLTICHHYPFSLQARKLWQEKKVLSPGQFNRYMRNLTWTSLLNNDVNAAEAITFYDSLSVYYQNLKPEEAVALGHDYKIFLNCMRVASQTNIIEDDCRVLSGYKVKQFSHHQYLNCHTFEPENHAEALSTSFLSLIVSMGPKESSGPDEQAFLTDVFEQAKGLRVVVHEPGTYPDLEKFGLHAEPGKLNEIGYEPVKWTKMNTPTRPCFH--TAPQYNDLDGVYNYTHEQCILLHQQKEIIDECGCHYVMNPRPYFPTEEKPYCGKMWPRMDTEKFVNRLNCIVG-KLNISVKQKYDGTVCQPRCEYYTYESSISITKWRAHPWQLYWLRVQTQGVRLAKAFAENNTNVSITESLGYKMWQRYLGEKNLGKIPVEATWNNLARPPDILRHINLDIDGSVSTNSDGFAYIVLKRKSQNTKDNTEKLVLTLNVLVSRIGGLCSVTIGITAACVVEIIEFIY-YSNKPKSKDQEKS 559          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A0R3U2C4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS598 PE=3 SV=1)

HSP 1 Score: 483.411 bits (1243), Expect = 1.513e-160
Identity = 238/546 (43.59%), Postives = 342/546 (62.64%), Query Frame = 3
Query:  255 FILFCSTTSMKGMNKITRGPKPLRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSTEAYKYWRENKILSPSTFNRKMRNLTHSNLMGNRVMEAEGISNYDVISVYYQNIGYNDSMLIGHQKDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFEA----KVDKITTLGIIVSMGPPPDYSATEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRATEWHLHWIRLQLLTFRQLKN----NPQINATDSTYFKQWLKYWNATNLTVI-------DEDRKERFLA-------------NDNFAYIVLRRESDNSVRKYERLVISPYVLVSRIGGLCSFTVGITASFFVEILEFLYLYYQSNKTSKLEKSEDNI 1808
            F+LFC  T+++G  K+ +GP  LRF+W +FV++M  VLI S  LL+ DF  YDV ++  + L   +PFP++T+CHH+PFS  A K W+E ++LSP  FNR MRN+T +NL+ N +  AE  S YD +SVYYQN+  +++ L+GH   +FL+CM + +    +E++C  L+ Y+V+ FSHH++ NC+TFE     +    + L +IVSMGP       EQAF+ D F QA+GL+V+VHEPG  PD++  G+H EPGKLNEI Y PV W   NTPTKPCF+  +   YNDL+  YNYT + CL   +QK II+ C C ++ NPR   P+ + PYCG      D+ E   R+ECL + + D++ K+K +   C  RC Y TY+++ISITKWRA  W L+W+R+Q    R +++    NP  +  DS  ++ W +Y    NL  I       D +R    +              +D FAYIVL+R+S N++   E+LV++  VLVSRIGGLCS T+GITA+  VEI+EF+Y Y   +K SK ++  D +
Sbjct:   22 FVLFCRCTTVRGFGKLWQGPMLLRFIWATFVVSMMCVLITSVVLLILDFFAYDVGVHTRLLLDDPSPFPALTVCHHYPFSLAARKLWQEKQVLSPGQFNRYMRNITWTNLLNNDLQAAEATSFYDSLSVYYQNLRPDEAKLLGHDHRVFLNCMRISSQTTFFEDDCRLLKGYKVRQFSHHQYLNCHTFEPTNWQESMDTSFLSLIVSMGPKESSDPDEQAFLPDIFEQAKGLRVVVHEPGTYPDLERFGLHAEPGKLNEIGYEPVRWTKMNTPTKPCFH--QAGLYNDLDEVYNYTHEQCLLLHQQKEIIESCGCYYVMNPRPSFPSDEKPYCGRMWPKLDIEEFVKRLECLKH-KLDISVKRKYDGSTCLPRCEYYTYDSAISITKWRAQLWQLYWLRVQNQAIRLVQDHISKNPGKDIKDSLGYRMWKRYLGKENLRDIPKEASLSDAERPPDVIKRVNLDIDDDLSTNDDGFAYIVLKRKSQNTIDNTEKLVLTLNVLVSRIGGLCSVTIGITAACVVEIIEFVY-YANRHKKSKHQRRRDGM 563          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4S2JQK4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_011292 PE=3 SV=1)

HSP 1 Score: 481.871 bits (1239), Expect = 1.357e-159
Identity = 234/538 (43.49%), Postives = 337/538 (62.64%), Query Frame = 3
Query:  243 TKNVFILFCSTTSMKGMNKITRGPKPLRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSTEAYKYWRENKILSPSTFNRKMRNLTHSNLMGNRVMEAEGISNYDVISVYYQNIGYNDSMLIGHQKDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFEA----KVDKITTLGIIVSMGPPPDYSATEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPC----------FNDIKKER------------YNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLS-ELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRATEWHLHWIR-----LQLLTFRQLKNNPQINATDSTYFKQWLKYWNATNLTVI-DEDRKERFLANDNFAYIVLRRESDNSVRKYERLVISPYVLVSRIGGLCSFTVGITASFFVEILEFLYL 1757
            + N+  L   T +++G+ ++ RGP+ LR LW  FV+TM+  L ++S  LV+D++LYDV +N+ V L + +PFP++T+CHHHPFS EAY+ WRENK+LSPS FNR+MR LT  +L  N +  +  +  YD +S+YYQN+   D+  +GH   IFL+CM   N  +  E++C+K++ + ++ FSHH  FNC+T E     + +   T+ ++V +GP PDYS  EQAF++D +  AQGL+V+VHEPG  PD++  G+HVEPGKLNEI+Y+P+ W+  NTP  PC             I  +R            Y DL   Y YTQ  C+    Q  IID+CHC +IYNPR   P+K++PYCG+FL + D +  L+ RIECL     + + K+   + KCF  C Y +YE+++S+T WR   W LHW+R      Q +   Q +  P  N T S  + +W +Y ++ NLT I   D K+  L   NFAY+VLRR S +     E+LV+S  VL+SRIGGLCS T+G+TA+F VE++EF YL
Sbjct:    5 SSNLIKLVSDTFTIRGVPRLNRGPRFLRGLWWFFVITMTVGLFLTSYYLVQDYLLYDVAVNVHVALDAHSPFPALTVCHHHPFSAEAYRLWRENKVLSPSAFNREMRKLTQYHLERNNLDISSNLYQYDSMSIYYQNLNTEDAYRLGHDTSIFLNCMRRVNQAMQIEDDCTKMDGFRIRKFSHHTFFNCHTIEPTDKMEAEATDTIALVVGLGPTPDYSDEEQAFLMDLYEMAQGLRVVVHEPGAYPDLEREGLHVEPGKLNEINYQPIHWQRLNTPRHPCRTERVDRTHELASITSDRLPKSPSSDYAYAYTDLNVSYRYTQSQCIHLYMQLNIIDKCHCQYIYNPRPKHPSKEVPYCGSFLYEQDKTLALSKRIECLNAGPMNTSLKRIHAATKCFPLCNYYSYESTMSVTTWRTENWQLHWLRHLNNAFQAMQREQEEKGPDFNVTKSAGYARWKEYLDSQNLTNIPTNDLKKLNLEGSNFAYVVLRRRSQDLQINKEKLVLSISVLLSRIGGLCSLTIGLTAAFVVELVEFTYL 542          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: H2KNG0 (FMRFamide-activated amiloride-sensitive sodium channel OS=Clonorchis sinensis OX=79923 GN=CLF_100069 PE=3 SV=1)

HSP 1 Score: 481.1 bits (1237), Expect = 8.695e-159
Identity = 245/586 (41.81%), Postives = 356/586 (60.75%), Query Frame = 3
Query:  234 NPKTKNV------FILFCSTTSMKGMNKITRGPKPLRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSTEAYKYWRENKILSPSTFNRKMRNLTHSNLMGNRVMEAEGISNYDVISVYYQNIGYNDSMLIGHQKDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFEA----KVDKITTLGIIVSMGPPPDYSATEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRATEWHLHWIRLQ------LLTFRQLKNNPQINATDSTYFKQWLKYWNATNLTVIDEDRKERFLAN--------------------DNFAYIVLRRESDNSVRKYERLVISPYVLVSRIGGLCSFTVGITASFFVEILEFLYLYY-QSNKTSKLEKSEDNIYEKTQFSPKRVLKKSSLKKIPNTK 1880
            +PK+K +      F LFC  TS++GM+K+  GP+ LR +WL FV++M+ +LI ++ LL++DF+ YDV++  ++RL   +PFPS+T+CH  PFS  AY+ W  N ILSP+ +NR MR L    L  N +  A  I  YD +SVYYQN+ Y+  + +GH   IFLSCM    +  ++E+NC+ L  Y ++ FSHH++ NCYTFE     K  + +   ++VSMGP       + AF  D F QA+G++++VHEPG  PD++  G+HVEPGKLNEI+Y P  W + +TP +PC    +  R+ DLE  +NYT + CL  ++Q  II+ CHCI++  PRL +P K LPYCG    D + +    R+ECL     D++ K+K +  KC  RC Y  Y ++ SITKWR   W L+W+R+Q      LL  ++L  +P +N T    F++W  Y    NLT I   ++   L N                    ++FAYIVLRR+S N+V + E LV+S YVLVSR+GGLCS T+G+TA+F VE++EFLYL+Y Q N+  +  +   N+ E T  +   VL+K  +  IP T+
Sbjct:   44 SPKSKELCPSGEAFQLFCKCTSVRGMSKLHTGPQFLRCIWLIFVLSMTCLLISATALLIKDFLCYDVSVRTQLRLDDDSPFPSLTVCHQPPFSYRAYELWNRNDILSPAEYNRYMRKLVLDALQKNDIESASSIWGYDTLSVYYQNLDYDKVIQLGHSPSIFLSCMRSFEHTFTFEDNCTILPGYMLRRFSHHQYMNCYTFEPSDMQKAIETSFFTLVVSMGPRDRDVPPQAAFFPDIFEQARGMRIVVHEPGTMPDLERNGIHVEPGKLNEINYEPHRWNVLSTPRRPCIQPNETHRFRDLETLFNYTHEDCLLVQQQLEIINNCHCIYVMYPRLSLPTKSLPYCGQIWPDYNQTAFVKRLECLAKYL-DISVKRKYDGTKCLPRCNYYMYPSTTSITKWRGYPWQLYWLRVQNQASESLLKLKEL--HPDLNVTAQAEFERWKLYLTYDNLTHIPSHKELTRLGNGSDVYSEMPKWPPEKLDLDGEDFAYIVLRRKSRNTVEENENLVLSLYVLVSRVGGLCSLTIGLTAAFVVELMEFLYLFYVQRNRMKRGNEMRTNL-ETTITTNNNVLEK-KIVTIPLTQ 624          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A504Z5C8 (FMRFamide-activated amiloride-sensitive sodium channel OS=Fasciola gigantica OX=46835 GN=FGIG_09726 PE=3 SV=1)

HSP 1 Score: 479.559 bits (1233), Expect = 8.742e-159
Identity = 232/543 (42.73%), Postives = 334/543 (61.51%), Query Frame = 3
Query:  252 VFILFCSTTSMKGMNKITRGPKPLRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSTEAYKYWRENKILSPSTFNRKMRNLTHSNLMGNRVMEAEGISNYDVISVYYQNIGYNDSMLIGHQKDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFE----AKVDKITTLGIIVSMGPPPDYSATEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRATEWHLHWIRLQLLTFRQL----KNNPQINATDSTYFKQWLKYWNATNLTVIDEDRK--------ERFLAN-------------DNFAYIVLRRESDNSVRKYERLVISPYVLVSRIGGLCSFTVGITASFFVEILEFLYLYYQSNKTSKLEK 1793
             F LFC  TS++GM+K+  GPK LR +WL+FV++M+ +L+ S+ LL++D++ YDV+++I+V+L +  PFP++T+CH  PFS EAY+ W  ++ILSPS FNR MR L    L    +  A  I  YD  SVYYQN+   +++ +GH   IFLSC+      IS+E++C+ L  Y+++ FSHH   NCYTFE     +   I+   ++V M P         AF +D F QA+GL+++VHEPG  PD++  G+HVEPGKLNEI+Y    W   NTP +PC    +  RY DL+ +YNYTQ  CL   +Q+ I+ EC C+ + NPR V P   +PYCG    + +++    R+ CL  I E+ + K K +  +C  RCTY  Y +S SITKWR   W L+W+R+Q    + L    +N+  +N T+   FKQW  Y    NLT I   ++        E + AN             D+FAY+V++R+S ++V K E+LV+S YVLVSR+GGLCS TVG+TA+FFVE+LEFLYL    ++ +  EK
Sbjct:   34 AFRLFCKCTSVRGMSKLHTGPKALRIMWLTFVLSMTCLLVSSTALLIKDYLNYDVSVHIQVKLDTPAPFPALTVCHQPPFSFEAYELWNRSEILSPSKFNRYMRKLVLDALQRKEIDLANSIWGYDTQSVYYQNLAVKEAIQLGHSPAIFLSCVHFTAQSISFEDDCTLLRNYQLRRFSHHSFMNCYTFEPIDFTEAKDISIFSLVVGMSPRDRDVPMHPAFFIDVFEQARGLRIVVHEPGTMPDLEKDGLHVEPGKLNEIAYESYLWNRLNTPKRPCIVANESHRYQDLDEWYNYTQSSCLLQRQQREIMSECGCMLVMNPRPVEPTDTMPYCGRLRANENMTSFMERLRCLARIMEE-SAKNKHKGTECLPRCTYYEYASSTSITKWRGYPWQLYWLRVQNQASQNLHAYYRNHGNVNLTNHPAFKQWELYLKYDNLTHIPRHQELINLTEGTEEYFANLPKWPPENLNLDSDDFAYVVVKRKSTSTVEKNEKLVLSSYVLVSRVGGLCSLTVGLTAAFFVELLEFLYLLCSGSRATPKEK 575          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Match: asic1c (acid-sensing ion channel 1C-like [Source:NCBI gene;Acc:103034544])

HSP 1 Score: 57.3806 bits (137), Expect = 3.411e-8
Identity = 82/342 (23.98%), Postives = 133/342 (38.89%), Query Frame = 3
Query:  243 TKNVFILFCSTTSMKGMNKITRGPKPL--RFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSTEAY--------KYWRENKILSPSTFNRKMRNLTHSNLMGNRVMEAEGISNYDVISVYYQNIGYNDSMLIGHQ-KDIFLSCMLLRNNMISYEENCSKLEEYEVKMFS--HHEHFNCYTFEAKVDK---ITTLGIIVSMGPPPDYSATEQAFI-----VDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNP 1205
            TK + + F   T + G+  +    K    RFLWL  +     +L   S   +   M Y     I +  A    FP++T+C+ + F   +          YW +   L+ S   + +  L HS     R+M     + Y   + +  +     S L GHQ +D+ L C           ENCS       + F+  +  +  CYTF + +D    +TTL      G        +  ++      D      G+KV +H    PP ID  G  V PG    +S +  +  L+  P  P + D K     D E F  Y+   C    E + +++ C+C  ++ P
Sbjct:   27 TKKITLAFVLRTKVHGLKYVFAPGKSRIHRFLWLLAMFVCLGLLFTWSWNRILYLMSYPAVTKIYMVWAHNMTFPAVTLCNQNLFRVSSLTKADLYHSGYWMDIMHLNHSVNRQSLAMLKHSR-HRERLMRLLDFAGYSPPARHKLSTTEMISRL-GHQLEDMLLECRF-------RGENCS------FRNFTPIYTRYGKCYTFNSGLDGNPLLTTLKGGTGNGLEIMLDIQQDEYLPVWGDTDETSYEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQ--QQLLQYLP--PPWGDCKSTPI-DSEFFSTYSITACRIDCETRYLLENCNCRMVHMP 348          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Match: asic1c (acid-sensing ion channel 1C-like [Source:NCBI gene;Acc:103034544])

HSP 1 Score: 52.7582 bits (125), Expect = 7.984e-7
Identity = 80/343 (23.32%), Postives = 133/343 (38.78%), Query Frame = 3
Query:  240 KTKNVFILFCSTTSMKGMNKITRGPKPL--RFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSTEAY--------KYWRENKILSPSTFNRKMRNLTHSNLMGNRVMEAEGISNYDVISVYYQNIGYNDSMLIGHQ-KDIFLSCMLLRNNMISYEENCSKLEEYEVKMFS--HHEHFNCYTFEAKVDK---ITTLGIIVSMGPPPDYSATEQAFI-----VDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNP 1205
            K+  + + F   T + G+  +    K    RFLWL  +     +L   S   +   M Y     I +  A    FP++T+C+ + F   +          YW +   L+ S   + +  L HS     R+M     + Y   + +  +     S L GHQ +D+ L C           ENCS       + F+  +  +  CYTF + +D    +TTL      G        +  ++      D      G+KV +H    PP  +  G  V PG    +S +  E +L+  P  P + D K     D E F  Y+   C    E + +++ C+C  ++ P
Sbjct:    8 KSIKITLAFVLRTKVHGLKYVFAPGKSRIHRFLWLLAMFVCLGLLFTWSWNRILYLMSYPAVTKIYMVWAHNMTFPAVTLCNQNLFRVSSLTKADLYHSGYWMDIMHLNHSVNRQSLAMLKHSR-HRERLMRLLDFAGYSPPARHKLSTTEMISRL-GHQLEDMLLECRF-------RGENCS------FRNFTPIYTRYGKCYTFNSGLDGNPLLTTLKGGTGNGLEIMLDIQQDEYLPVWGDTDETSYEAGIKVQLHSQSEPPFPNELGFWVTPGFQTFVSTQ--EQRLQYLP--PPWGDCKSTPI-DSEFFSTYSITACRIDCETRYLLENCNCRMVHMP 330          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 51.6026 bits (122), Expect = 3.852e-7
Identity = 89/451 (19.73%), Postives = 161/451 (35.70%), Query Frame = 3
Query:  252 VFILFCSTTSMKGMNKITRGPK-PLRFLWLSFVMTMSTVLIV-SSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSTEA-------------------YKY-----------------WRENKIL---SPSTFNRKMRNLTHSNLM----GNRVMEAEGISNYDVISVYYQNIGYNDSMLIGHQKDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFEAKVDKITTLGIIVSMGPPPDYSA-----TEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKW---RATEWHLHWIRLQ 1445
            +F  FC  T++ G  ++    +  L+  + S + T++ +L   +S L+   +  Y V + + + +  Q+ FP+IT+C  +P+  E                    Y Y                      +L    P T   K+ N T  +      G+ V        +  +++  Q   Y       + +D   SCM   + M      CS   + E   F H  + NCYTF +      +  +  +  P  DY       TEQ   +       G +++VH+   PP ++ GG  + PG    +  R +E      P   C  D       +L     YT  +   S  Q  +++ C C + + P        LP   ++   ++ +   H   C   +       +    +KC Q CT   +  +     W    + +W  + + LQ
Sbjct:   22 MFEFFCDNTTIHGTIRLVCSKRNKLKTAFWSLLFTVTVILFYYTSALVFLQYYSYTVAVTMGL-MFQQSTFPAITVCSLNPYRYEVVQSSLSQLDSMTGQALQQLYGYQPPATKAAGTAAAPGIRLDTGVVLERTGPDTVGFKLCNATGGDCFYQSYGSGVQAVTEWYTFQYVNIMSQVPSYIKQSDDANIEDFIFSCMF--SGM-----PCS---DSEYSRFHHPTYGNCYTFNSA----NSSKLWQASKPGRDYGLSLILRTEQNDYIPFLSTVAGARIMVHDQESPPFMEEGGFDMRPGFETSLGIRMLEATRMPDPYGNCTEDGSNVPVLNLYS-SAYTVQVPECSCFQLALVEACGCGYYFYP--------LPPNASYCSYNNTAWAGH---CYYKLYRQFISDELGCVDKCAQPCTTKRFAVTPGYAAWPDSSSEKWIFNLLSLQ 445          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO42137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2F2])

HSP 1 Score: 58.151 bits (139), Expect = 6.821e-9
Identity = 113/566 (19.96%), Postives = 220/566 (38.87%), Query Frame = 3
Query:  264 FCSTTSMKGMNKI--TRGPKPLRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSTEAYKYWRENKI--LSPSTFNRKMRNLTHSN--LMGNRVMEAEGISNYDVISVYYQNIGYNDSMLIGHQ-KDIFLSCMLLRNNMISYEENCSKLEEYEVKMF---SHHEHF-NCYTFEA-KVDKITTLGIIVSMGPPPDYSAT-----EQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLER---FYNYTQD----MCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHR-IECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRATEWHL----HWIRLQLLTFRQLKNNPQINATDSTYFKQWLKYWNATNLTVIDEDRKERFLANDNFAYIVLRRESDNSVRKYERLVISPYVLVSRIGGLCSFTVGITASFFVEILEF--LYLYYQSNKTSKLEKSEDNIYEKTQFSPKRVLKKSSLKKI 1868
            F   T+  G  ++  T G K  R  W+ F +    V +     LV  +    +    +++ A +  FP +TIC+ +             K   +  +T     RN ++S    +  + +  E    ++++     +  Y + +   HQ +DI LSC     N +    NC   ++  +  +   + +++F NCY F + K      + +  S  P      T     EQ   ++   +  G+KV + + GV P     G+ + PG+   I       KL+     P F +   E  N++     F+ Y        C  S    R I+ C C     P +    + +P C         + LN   I+CL    +   F+      +C   C+ ++++ ++S  +W A  + +    +++R+++L         +I ++ S YF             V  E+  +  +      Y++++          E L  +   L+S IGG     +GI+A    E++E   + L   SN++ K+     N +   +      ++K  +K+I
Sbjct:   18 FLQETTAHGFGRLGATAGSK-WRLYWVMFCLAAYCVFVWQLVGLVNQYNSKPIKTRTQLKHAQKLDFPVVTICNMNVLRASRLPPKLRTKFDQIINNTNKTSPRNSSNSRNAFVDPQDLSFEETKKFEILHAVTAHDDYRELVSAAHQLEDILLSCNF---NGV----NCRNSKDPTIPTYWTQTWNDNFGNCYMFNSVKTHNGEKVDLYSSSVPGESNGLTLQLNLEQNEYLEGITEVAGMKVTISDQGVLPFPGQQGIRIMPGQSTGIQMT----KLQTRRIDP-FKNRSCESSNEMSDKNLFFGYNMTYSIMACKYSCLNARKIERCGCTNYNTPEM--QKRNIPLC---------NRLNSTIIDCLNKAYD--TFEDGSCDRECPPSCSEVSFDLTVSSARWPARSFEVTKYAYFLRVRVLN--------KIASSSSKYF-------------VNSENIAQVHVYYGELDYLLVQ----------ETLAYTFMSLLSDIGGQMGMWIGISALTCAELIELVCVILANMSNRSKKI--VHINSFRPEKLGGVETIEKGGVKRI 524          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO37452 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFR0])

HSP 1 Score: 57.7658 bits (138), Expect = 1.366e-8
Identity = 77/319 (24.14%), Postives = 122/319 (38.24%), Query Frame = 3
Query:  672 MLIGHQ-KDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFEAKVD-KITTLGIIVSMGPPPDYSAT-----EQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVE-WKLENTPTKPCFNDIKKERYNDLERFYN--YTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRATEWHLHWIRLQLLTFRQLKNNPQI----NATDSTYFKQWLKYWNATNLTVIDEDRKERFLAN 1586
            M  GHQ  D+ LSC        +Y EN           F H+ + NCY F +  D +     I+ S  P P    T     EQ   V       G++V++   G  P     G+ V PG       R     + +    K C +    +  N  ++ YN  Y++  C+ S    + +D C C+    P   I N+ +          D+ +++  I CL  +Q      K   S+KC   C    ++ SIS  +W   ++  H++        +LK +       NA    YF +   ++   N  VI+E R    L N
Sbjct:  282 MEAGHQFYDMVLSCTYRGIPCTNYTENL-------WSRFWHYRYGNCYVFNSGKDWQGEPKPILRSNKPGPASGLTLELNAEQHEYVGQLSHEAGMRVLISTQGEMPSPLEKGISVSPGFSTTTGIRMTNILRADPFNNKSCLSSDDIDPENLYKKRYNVSYSRTTCMDSCLAHKQLDMCGCLEYRFPN--IDNRTV---------CDILDID-VIRCLNKVQSLYQDNKLGCSDKCRPPCNEEVFKLSISSARWPTDDYEAHFL-------DELKEDKGFVLPANADARAYFVKLQIFYEELNHEVIEEYRSYEVLNN 574          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO30894 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZH6])

HSP 1 Score: 47.7506 bits (112), Expect = 9.013e-6
Identity = 66/290 (22.76%), Postives = 108/290 (37.24%), Query Frame = 3
Query:  333 WLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSTEAYKYWRENKILSPSTFNRKMRNLTHSNLMGNRVMEAEGISNYDVISVYYQNIGYNDSMLIGHQKDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFEAKVD---KITTLGIIVSMGPPPDYSATEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFY--NYTQDMCLSSEEQKRIIDECHC 1187
            WL  V+      I  S L +  F  + V+  +      +  FP++TIC+ +P S   Y     N + + ST  +   N+ +  +     M  + + +Y                   H  D  LS   L     S +E C K        F H  + +C+TF +      K+ ++G I   G     +  E+  + + +    G KV+VH+P   P I+  G  ++PG     S R     L+      C      E   D  R++  NYT  +C         I +C C
Sbjct:    1 WLFVVLAGFAGFIYQSFLSITSFYSWPVSTVMMTEWHKEMNFPAVTICNFNPISKSRYAQNYGN-LFNLST--QDSNNIINGIIFLIGPMLGKSLRSY------------------AHSIDGILSLKWLEPCKYSGKE-CGK---NSFSTFEHLRYGSCHTFNSDGQFGLKVDSIGPIS--GLQLRLNVEEKDHVSNLYGLQAGFKVLVHDPREHPMIEETGFALQPGTHTFCSVRMKYVNLKAPYRTEC-----GENITDFNRYFNVNYTMAICSKQCLHDYGIKKCGC 258          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000039581.1 (SMESG000039581.1)

HSP 1 Score: 1289.25 bits (3335), Expect = 0.000e+0
Identity = 616/622 (99.04%), Postives = 618/622 (99.36%), Query Frame = 3
Query:   21 MDNPWIIKSTDHTQRPENDTVATILPPRYAIPVGREYNDLTTETTLHHQHSNSCRRFRARMSIYALRDRLRNPKTKNVFILFCSTTSMKGMNKITRGPKPLRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSTEAYKYWRENKILSPSTFNRKMRNLTHSNLMGNRVMEAEGISNYDVISVYYQNIGYNDSMLIGHQKDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFEAKVDKITTLGIIVSMGPPPDYSATEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRATEWHLHWIRLQLLTFRQLKNNPQINATDSTYFKQWLKYWNATNLTVIDEDRKERFLANDNFAYIVLRRESDNSVRKYERLVISPYVLVSRIGGLCSFTVGITASFFVEILEFLYLYYQSNKTSKLEKSEDNIYEKTQFSPKRVLKKSSLKKIPNTKKQ 1886
            MDNPWIIKSTDHTQRPENDTVATILPPRYAIPVGREYNDLTTETTLHHQHSNSCRRFRARMSIYALRDRLRNPKTKNVFILFCSTTSMKGMNKITRGPKPLRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFS EAYKYWRENKILSPSTFNRKMRNLTHSNLMGNRVMEAEGISNYDVISVYYQNIGYNDSMLIGHQKDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFEAKVDKITTLGIIVSMGPPPDYSATEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRL IP KKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRATEWHLHWIRLQLLTFRQLKNNPQINAT+STYFKQWLKYWNATNLTVIDEDRKERFLANDNFAYIVLRRESDNSVRKYERLVISPYVLVSRIGGLCSFTVGITASFFVEILEFLYLYYQSNKTSKLEKSEDNIYEKTQFSPKRVLKKSSLKKIPNTK +
Sbjct:    1 MDNPWIIKSTDHTQRPENDTVATILPPRYAIPVGREYNDLTTETTLHHQHSNSCRRFRARMSIYALRDRLRNPKTKNVFILFCSTTSMKGMNKITRGPKPLRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSMEAYKYWRENKILSPSTFNRKMRNLTHSNLMGNRVMEAEGISNYDVISVYYQNIGYNDSMLIGHQKDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFEAKVDKITTLGIIVSMGPPPDYSATEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLQIPTKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRATEWHLHWIRLQLLTFRQLKNNPQINATESTYFKQWLKYWNATNLTVIDEDRKERFLANDNFAYIVLRRESDNSVRKYERLVISPYVLVSRIGGLCSFTVGITASFFVEILEFLYLYYQSNKTSKLEKSEDNIYEKTQFSPKRVLKKSSLKKIPNTKNK 622          

HSP 2 Score: 75.485 bits (184), Expect = 6.410e-14
Identity = 37/41 (90.24%), Postives = 37/41 (90.24%), Query Frame = 1
Query: 1861 KKYQTQKNKPNLLKCEFKDFSEPTHDVKKLDLSNNSSDQIR 1983
            KK    KNKPNLLKCEFKDFSEPTHDVKKLDLSNNSSDQIR
Sbjct:  614 KKIPNTKNKPNLLKCEFKDFSEPTHDVKKLDLSNNSSDQIR 654          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000043119.1 (SMESG000043119.1)

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 299/535 (55.89%), Postives = 386/535 (72.15%), Query Frame = 3
Query:  246 KNVFILFCSTTSMKGMNKITRGPKPLRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSTEAYKYWRENKILSPSTFNRKMRNLTHSNLMGNRVMEAEGISNYDVISVYYQNIGYNDSMLIGHQKDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFEAKVDKITT----LGIIVSMGPPPDYSATEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRATEWHLHWIRLQLLTFRQ----LKNNPQINATDSTYFKQWLKYWNATNLTVIDEDRKERFLANDNFAYIVLRRESDNSVRKYERLVISPYVLVSRIGGLCSFTVGITASFFVEILEFLYLYYQSNKTSKLEKSEDNIYEKTQF 1826
            KN FILFCST S++G+NKI +GP+PLR LWL FV+ MS +LI SSCLLVRDFMLYDVNIN ++ + S TPFP++T+CHHHPFS   Y+ W+  K +SPS FNRKMRNLT   L+ N V  AE IS YD IS+YYQN+ Y  ++ +GH   IFL+CM L  N I + ENC+KLE Y +K+ SHHEHFNCYTFE     +++    LGIIVS+GP P +   EQ+FI+DTFRQAQGLKVIVHE G  PDID  G+HVEPGK+NEI YRP +W+L NTP KPC ND  +  Y DL   YNYT+ +CL   EQ+ I+++CHC+FIYNPR ++PN+ +PYCG+ L+D +LS +   ++CL+++    + +++ E EKCF RC YMT++++ISITKWRATEWHL+W+R Q+ +  +    LK NP  N T+S  FK WL Y N  +L        E  L +DNFAYIVLRRES +SV+KYERLVI+ YVLVSRIGGLCS TVGIT +F VE++EF YL + + +T K ++   N  E  + 
Sbjct:   58 KNFFILFCSTISIRGINKIIKGPRPLRLLWLCFVLIMSAILITSSCLLVRDFMLYDVNINTKLEIDSMTPFPALTVCHHHPFSHRGYRMWKSGKAMSPSYFNRKMRNLTLDQLLLNDVESAETISYYDGISIYYQNLPYEQAIQMGHNSSIFLTCMYLLENQIYFAENCTKLEFYRIKLLSHHEHFNCYTFEPTQPHVSSNLDMLGIIVSLGPEPKHFDMEQSFIIDTFRQAQGLKVIVHESGTLPDIDEAGLHVEPGKMNEIIYRPNQWQLTNTPAKPCINDTSRIAYVDLANTYNYTKHLCLKYAEQEDIMNQCHCMFIYNPRPMMPNESMPYCGSILKDFNLSNIYSYVKCLSDVLNQKSKRQQWEKEKCFHRCNYMTFDSTISITKWRATEWHLYWLRQQITSLGEMKQFLKANPNRNVTESQAFKTWLIYGNKKDLRKTGLKANEFLLKDDNFAYIVLRRESKDSVKKYERLVITQYVLVSRIGGLCSLTVGITLAFIVELVEFCYL-FSAKETEKRKRKYSNSVENVKL 591          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000000150.1 (SMESG000000150.1)

HSP 1 Score: 473.011 bits (1216), Expect = 2.814e-159
Identity = 233/573 (40.66%), Postives = 359/573 (62.65%), Query Frame = 3
Query:  174 NSCRRFRARMSIYALRDRLRNPKTKNVFILFCSTTSMKGMNKITRGPKPLRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSTEAYKYWRENKILSPSTFNRKMRNLTHSNLMGNRVMEAEGISNYDVISVYYQNIGYNDSMLIGHQKDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFEAKVDKIT----TLGIIVSMGPPPDYSATEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRATEWHLHWIRL--QLLTFRQLKNNPQINATDSTYFKQWLKYWNATNLTVIDEDRKERFLANDNFAYIVLRRESDNSVRKYERLVISPYVLVSRIGGLCSFTVGITASFFVEILEFLYLYYQSNKTSKLEKSEDNIYEKTQFSPKRVLKKS--SLKKI 1868
            N   R+  R        R +     ++F LFC+TTS++GMNK+ +GP  LR LWLSFV+ M+T L V++  +V +F+ YDVN+  ++ L S + FP++TICHHHPFS +A+  W  + ++SP+ +NR +R +++ +   N+       S  D +S+YYQN+  N+S +IGH K+ +L+CM      I++E++CSKL        S HE+FNC+TF+ +   ++    ++ I+VS+ P PDY   EQAFIV+TF++A+GL+V+VHE G  PDI   G+HVEPGK+NEI Y+P++ K  NTPTKPC        + DL++ +   +  C+  ++Q+ I+  C CIF+  PR + P   LPYCG  +++ + + +  RI C+ +I  D +++K+LE   CF RC  +T+E++ISITKW AT WHL+WIR   + L   +   N     T++  +K WL Y N  NL+ ++  +   FL  +NFAY+VL+R+S N+V K E+LV +PYVL+SRIGG+CS T+G+TA+F VE +EF+Y +   +             E+ QF   R+  KS  +L+KI
Sbjct:   40 NLLMRYSWRRKDSVQSQRKKKSSISHIFYLFCTTTSIRGMNKVPKGPIFLRLLWLSFVLIMTTGLTVATTFMVLEFLQYDVNVYTKIILDSNSSFPALTICHHHPFSIKAHDLWNRSIVMSPAKYNRYLRKMSNDSFQKNQYGHGSVSSYLDTMSMYYQNLQMNESFMIGHDKETYLTCMNQLGFNINFEDDCSKLFNTSFHRLSLHEYFNCHTFQPENINVSYLFESINIVVSLEPKPDYREHEQAFIVETFQRAEGLRVVVHETGSFPDIAQDGLHVEPGKMNEIKYQPIQHKRVNTPTKPCVERDDLMTFKDLDQTFMSDKKNCILLKKQELIMKNCKCIFVSFPRPIEPTLDLPYCGK-IQNDNFTVIEDRISCIGDIVSDADYQKELERTICFPRCDILTFESTISITKWGATAWHLYWIRETNKALNLLKANVNNSTRVTETKGYKMWLDYANKENLSDVESTKVNHFLQGENFAYVVLQRKSKNTVIKQEKLVTTPYVLLSRIGGVCSLTIGLTAAFVVEFIEFIYRFCNHSN------------EEKQFCQNRISTKSDRNLRKI 599          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000060702.1 (SMESG000060702.1)

HSP 1 Score: 412.149 bits (1058), Expect = 2.974e-136
Identity = 217/528 (41.10%), Postives = 326/528 (61.74%), Query Frame = 3
Query:  240 KTKNVFILFCSTTSMKGMNKITRGPKPLRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSTEAYKYWRENKILSPSTFNRKMR-NLTHSNLMGNRVMEAEGISNYDVISVYYQNIGYNDSMLIGHQKDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFEAKVDKITT----LGIIVSMG-PPPDYSATEQAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTYMTYETSISITKWRATEWHLHWIRLQLLTFRQLKNNPQI----NATDSTYFKQWLKYWNATNLTVIDEDRKERFLANDNFAYIVLRRESDNSVRKYERLVISPYVLVSRIGGLCSFTVGITASFFVEILEFLYLY-----YQSNKT 1778
            K +++  LFC   +++G+NK+T     LR+LW  FV+ M+ +L+ ++CLL+ D+  YDV ++ +  L   + FP+ITICHHHPFS +AYK W   K+LSPS FN  MR N  H     ++   A     +D I +YYQN+ YN+S+ +GH+  I L C+   +  I +E +C + + Y +K  SH +HFNCYTFE +   ++       +IVS+G P PDY+  EQAF++D F QA+GL+ +VHEPG  PDI+  G+HVEPGKLNEI+++PV     +TP +PC  D +  +  DL+  YNYT    ++ E+Q  I+  C C++I  PR + P K++PYCG      DL E   RI C++N  + ++  +++E +KC  RC+Y TYE ++SITKWRA +W LHW+ LQ    + L  N       NA +S  +K +L+  + +N+ + D  RK   L  D+FAY+VL+++S     + E+ V+S  VL+SRIGG CS  +G+T +  VE +EF+YL      YQ+N T
Sbjct:   38 KDESILELFCRCMTIRGVNKMTSASSFLRYLWSVFVLLMTIILVGATCLLILDYFKYDVTLH-QRDLQKNSTFPAITICHHHPFSKDAYKLWDSKKVLSPSLFNLYMRQNALHYLNQDDKF--ANNFYYFDSIDIYYQNLLYNESIALGHKYTIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTFEPRNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYEYINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLK-MSLTEEIE-KKCRPRCSYYTYEATVSITKWRAKQWQLHWLSLQSNAQKALNANISAESYQNAKNS--WKSYLERRDLSNVNIADS-RKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYLLILKTVYQNNPT 557          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000062815.1 (SMESG000062815.1)

HSP 1 Score: 324.709 bits (831), Expect = 7.122e-102
Identity = 198/591 (33.50%), Postives = 327/591 (55.33%), Query Frame = 3
Query:  228 LRNPKTKNVFIL---FCSTTSMKGMNKITRGPKP-LRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSITICHHHPFSTEAYKYWRENKILSPSTFNRKMRNLT---HSNLMGNRVMEAEGISNY--------DVISVYYQNIGYNDSMLIGHQKDIFLSCMLLRNNMISYEENCSKLEEYEVKMFSHHEHFNCYTFEAK---VDKITTLGIIVSMGPPPDYSATE-QAFIVDTFRQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKPCFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIPNKKLPYCGNFLEDSDLSELNHRIECLTNI-QEDVNFKKKLESE-KCFQRCTYMTYETSISITKWRATEWHLHWIRLQLLTFRQLKN---------NPQINATDSTYFKQWLK----YWNATNLTVIDEDRKERFLANDNFAYIVLRRESDNSVRKYERLVISPYVLVSRIGGLCSFTVGITASFFVEILEFLY-LYYQSNKTSKLEKSEDNIYEKTQFSPKRVLKKSSLKKIPNTKKQTKS 1895
            + N K K  F +   F + TS++G ++I +     LR LW+ FV++  T LIVS   +V D+  Y VNI   +++ + TPFP++T C+H PFS  AY+ W E+K++SP+ FN   R+       +++  ++   +   N+        D +SVYYQN+    S  +GH   I  +C+      ++++ +C   +   VK  SH  +FNC+T E         + LG+I+ +GP    +    Q F+ D F QA GL+VI+HEP   P+I++ GV +EPG+LNE++Y+P      +T  KPC N+  +  Y DL+  + Y  D+C + E Q+RII EC CI+ Y PR + P+K+LPYCG +LE     +L  R  C+T I  E  + K  L+++ KC   C+ + Y T+ S+TKWR T+W L+W++  L  + Q  N         +  +  TD    +        ++   NL+    +  E+ L N+ + ++V++R+++N+  K ERLV+S   LVSR+GGLCS  +G+T +FF+E+++FLY + +     S+    ED++ +  +   KR  +   LK +  T ++ K+
Sbjct:    5 IGNKKNKQCFEVIRKFFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTINDRLSVYYQNLPTTVSSELGHNISIIKNCVWSYGQHMAFDNHCQD-DMLIVKNISHPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDR-IYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCG-YLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNINIPSNNMTTTDRIMLQNLTSRIETFFTRKNLSEFIPE-SEKLLFNERYTFVVVKRKANNTFIKEERLVLSFNALVSRVGGLCSLYIGLTFAFFIELIDFLYTIIFLRKPLSR----EDSVEKNERTGQKRTSQTLFLKNVRETDQKLKT 587          
The following BLAST results are available for this feature:
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SCNN1A4.953e-825.00sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A5.779e-824.46sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A6.846e-824.46sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A1.011e-725.13sodium channel epithelial 1 alpha subunit [Source:... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
delm-26.816e-820.19DEgenerin Linked to Mechanosensation [Source:UniP... [more]
del-43.302e-622.85DEgenerin Like [Source:UniProtKB/TrEMBL;Acc:P9183... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ppk81.375e-624.37gene:FBgn0052792 transcript:FBtr0307180[more]
ppk81.421e-624.37gene:FBgn0052792 transcript:FBtr0307179[more]
ppk284.820e-627.95gene:FBgn0030795 transcript:FBtr0074335[more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
foxe31.767e-624.26forkhead box E3 [Source:Xenbase;Acc:XB-GENE-480592... [more]
copg24.858e-623.31coatomer protein complex subunit gamma 2 [Source:X... [more]
copg26.409e-622.80coatomer protein complex subunit gamma 2 [Source:X... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Scnn1a6.153e-923.11sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a6.220e-923.11sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a9.883e-923.11sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a9.883e-923.11sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a1.166e-823.11sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25011|FANA_CORAP8.805e-1721.14FMRFamide-activated amiloride-sensitive sodium cha... [more]
sp|O97741|SCNNA_RABIT2.739e-924.44Amiloride-sensitive sodium channel subunit alpha O... [more]
sp|Q61180|SCNNA_MOUSE8.366e-823.11Amiloride-sensitive sodium channel subunit alpha O... [more]
sp|P55270|SCNNA_BOVIN1.034e-725.59Amiloride-sensitive sodium channel subunit alpha O... [more]
sp|P37088|SCNNA_HUMAN2.379e-725.00Amiloride-sensitive sodium channel subunit alpha O... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3TLF46.643e-16144.61Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A0R3U2C41.513e-16043.59Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4S2JQK41.357e-15943.49Uncharacterized protein OS=Opisthorchis felineus O... [more]
H2KNG08.695e-15941.81FMRFamide-activated amiloride-sensitive sodium cha... [more]
A0A504Z5C88.742e-15942.73FMRFamide-activated amiloride-sensitive sodium cha... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
asic1c3.411e-823.98acid-sensing ion channel 1C-like [Source:NCBI gene... [more]
asic1c7.984e-723.32acid-sensing ion channel 1C-like [Source:NCBI gene... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SCNN1A3.852e-719.73sodium channel epithelial 1 alpha subunit [Source:... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO421376.821e-919.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374521.366e-824.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308949.013e-622.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039581.16.410e-1499.04SMESG000039581.1[more]
SMESG000043119.10.000e+055.89SMESG000043119.1[more]
SMESG000000150.12.814e-15940.66SMESG000000150.1[more]
SMESG000060702.12.974e-13641.10SMESG000060702.1[more]
SMESG000062815.17.122e-10233.50SMESG000062815.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004731 ID=SMED30004731|Name=FMRFamide-activated amiloride-sensitive sodium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=1984bp
TATTGAAAAATTAATATAAAATGGATAACCCATGGATAATAAAATCGACG
GATCACACTCAAAGACCAGAAAATGACACCGTTGCCACTATATTACCTCC
TCGTTATGCCATACCGGTTGGAAGGGAGTATAATGACCTCACCACAGAAA
CTACATTGCATCATCAGCATTCCAATAGTTGTAGACGCTTTAGAGCCAGA
ATGAGTATATATGCTCTTAGAGATAGATTAAGAAATCCAAAAACAAAAAA
TGTATTCATTTTGTTTTGTTCAACGACATCAATGAAAGGCATGAACAAAA
TAACTCGTGGCCCCAAACCATTAAGGTTTTTGTGGCTTTCCTTTGTTATG
ACAATGAGTACCGTACTAATAGTTTCCAGTTGCTTGTTGGTAAGAGATTT
CATGCTTTACGATGTAAACATCAACATAGAAGTGCGCCTAGCTTCTCAAA
CCCCATTCCCGTCAATCACCATATGTCATCATCACCCATTCTCCACGGAA
GCTTATAAATATTGGAGGGAAAACAAAATTTTATCTCCTAGTACGTTTAA
TAGGAAAATGAGGAACTTGACGCATTCAAACCTAATGGGAAATAGAGTAA
TGGAAGCAGAAGGAATTAGCAACTATGACGTAATAAGTGTTTATTATCAA
AACATAGGCTACAACGACTCAATGCTTATAGGCCACCAAAAGGATATATT
TCTCTCATGCATGCTTCTGAGAAATAATATGATTTCATATGAAGAAAATT
GCTCTAAATTAGAGGAGTATGAAGTAAAAATGTTTTCTCACCATGAGCAT
TTTAATTGCTACACATTTGAAGCTAAAGTTGATAAAATAACGACGCTAGG
AATAATAGTGTCAATGGGACCACCACCTGATTATAGTGCAACAGAACAGG
CTTTTATAGTGGACACATTTCGTCAGGCTCAAGGTTTAAAAGTAATTGTT
CACGAACCTGGCGTACCACCTGATATTGATAATGGTGGAGTTCATGTTGA
ACCAGGTAAATTAAATGAAATAAGTTACAGACCCGTTGAATGGAAATTAG
AAAATACTCCAACCAAACCTTGTTTTAATGACATCAAGAAAGAACGTTAT
AATGACCTCGAACGGTTTTATAATTATACACAGGATATGTGTTTAAGTTC
AGAAGAGCAAAAACGAATCATCGATGAATGCCATTGTATTTTTATTTACA
ATCCAAGATTAGTAATCCCAAATAAAAAACTGCCATATTGTGGAAACTTT
CTTGAAGATTCTGATTTATCCGAGTTGAATCATCGAATTGAGTGTTTGAC
AAACATTCAAGAGGATGTAAATTTCAAAAAAAAACTTGAAAGTGAAAAAT
GCTTTCAAAGATGCACTTACATGACATACGAAACGTCTATTTCAATAACA
AAATGGCGGGCAACTGAATGGCATTTGCACTGGATCCGACTTCAGCTTCT
TACTTTTCGGCAACTGAAGAACAACCCGCAGATAAACGCAACAGATTCAA
CTTATTTCAAGCAGTGGCTTAAATATTGGAACGCCACAAACCTTACTGTG
ATTGACGAGGATAGAAAAGAGCGATTTCTCGCCAACGATAATTTTGCTTA
CATCGTTTTGCGTCGAGAATCAGACAACAGTGTACGAAAATATGAGAGAT
TAGTTATATCTCCTTATGTGCTAGTCAGTCGTATTGGAGGTCTCTGTTCC
TTTACCGTTGGAATAACTGCTTCGTTTTTTGTGGAAATATTAGAATTTTT
ATATCTATACTATCAAAGCAACAAGACATCTAAACTAGAGAAATCCGAAG
ATAATATCTACGAAAAAACTCAATTTTCTCCAAAGCGCGTTCTAAAGAAA
TCCTCACTGAAAAAAATACCAAACACAAAAAAACAAACCAAATCTGCTCA
AATGCGAATTCAAAGACTTTTCCGAACCAACTCACGATGTAAAGAAATTA
GATTTGTCTAATAATAGTTCAGATCAAATAAGAG
back to top

protein sequence of SMED30004731-orf-1

>SMED30004731-orf-1 ID=SMED30004731-orf-1|Name=SMED30004731-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=647bp
MDNPWIIKSTDHTQRPENDTVATILPPRYAIPVGREYNDLTTETTLHHQH
SNSCRRFRARMSIYALRDRLRNPKTKNVFILFCSTTSMKGMNKITRGPKP
LRFLWLSFVMTMSTVLIVSSCLLVRDFMLYDVNINIEVRLASQTPFPSIT
ICHHHPFSTEAYKYWRENKILSPSTFNRKMRNLTHSNLMGNRVMEAEGIS
NYDVISVYYQNIGYNDSMLIGHQKDIFLSCMLLRNNMISYEENCSKLEEY
EVKMFSHHEHFNCYTFEAKVDKITTLGIIVSMGPPPDYSATEQAFIVDTF
RQAQGLKVIVHEPGVPPDIDNGGVHVEPGKLNEISYRPVEWKLENTPTKP
CFNDIKKERYNDLERFYNYTQDMCLSSEEQKRIIDECHCIFIYNPRLVIP
NKKLPYCGNFLEDSDLSELNHRIECLTNIQEDVNFKKKLESEKCFQRCTY
MTYETSISITKWRATEWHLHWIRLQLLTFRQLKNNPQINATDSTYFKQWL
KYWNATNLTVIDEDRKERFLANDNFAYIVLRRESDNSVRKYERLVISPYV
LVSRIGGLCSFTVGITASFFVEILEFLYLYYQSNKTSKLEKSEDNIYEKT
QFSPKRVLKKSSLKKIPNTKKQTKSAQMRIQRLFRTNSRCKEIRFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 380..397
score: 28.0
coord: 142..158
score: 35.29
coord: 251..267
score: 31.29
coord: 305..323
score: 32.21
coord: 369..380
score: 40.33
coord: 444..464
score: 28.38
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 82..576
e-value: 2.5E-57
score: 194.8
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 76..593
NoneNo IPR availableTMHMMTMhelixcoord: 101..123