tRNA (Guanine(10)-N2)-methyltransferase homolog

Overview
NametRNA (Guanine(10)-N2)-methyltransferase homolog
Smed IDSMED30004729
Length (bp)1615
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of tRNA (Guanine(10)-N2)-methyltransferase homolog (SMED30004729) t-SNE clustered cells

Violin plots show distribution of expression levels for tRNA (Guanine(10)-N2)-methyltransferase homolog (SMED30004729) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of tRNA (Guanine(10)-N2)-methyltransferase homolog (SMED30004729) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for tRNA (Guanine(10)-N2)-methyltransferase homolog (SMED30004729) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004729

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30004729h1SMcG0006678 SmedASXL_015185SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30004729h1SMcG0006678 SmedASXL_015185SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymal cellSMED30004729h1SMcG0006678 dd_Smed_v4_13837_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Human
Match: TRMT11 (tRNA methyltransferase 11 homolog [Source:HGNC Symbol;Acc:HGNC:21080])

HSP 1 Score: 253.062 bits (645), Expect = 1.701e-77
Identity = 152/422 (36.02%), Postives = 227/422 (53.79%), Query Frame = 3
Query:   96 LVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKN-FLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLI---EMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDN--TVP--HFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKI 1337
            L+   QE   FR  E  SLL +    F  S      + K+ F I+++ S D  R+L+ R++  K  + +W  G S E +   + ++P E          TY++ I   +K  + EEK+K I   E +    K   +    + +   + GL  N             +P  I +G      QR +++  Y +  R FIGNTSMD  LSF+M N G+V  N ++ DPFVGTGG+LIA AH GA V+GTDIDY  + GLGK+TR +Q WR  +E +R N +QY LE  Y+DV V D+S+     +    FD+I+TDPPYGIRE  R+  + +  P   +     P  H P   SY +S ++ DLL+ +A+ + +GG L+ W+P+    Y  ++ +P H C+E++ NCEQ L+  TSRRL+   K+
Sbjct:   11 LLLMAQEHLEFRLPEIKSLLLLFGGQFASS---QETYGKSPFWILSIPSEDIARNLMKRTVCAKSIFELWGHGQSPEELYSSLKNYPVEKMVPFLHSDSTYKIKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDPN---------CIPENPHNIYFGRWIADGQR-ELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTGGLLIACAHFGAYVYGTDIDYNTVHGLGKATRKNQKWRGPDENIRANLRQYGLEKYYLDVLVSDASKPS--WRKGTYFDAIITDPPYGIRESTRRTGSQKEIPKGIEKWEKCPESHVPVSLSYHLSDMFLDLLNFAAETLVLGGRLVYWLPVYTPEYTEEM-VPWHPCLELVSNCEQKLSSHTSRRLITMEKV 416          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Human
Match: TRMT11 (tRNA methyltransferase 11 homolog [Source:HGNC Symbol;Acc:HGNC:21080])

HSP 1 Score: 252.292 bits (643), Expect = 2.722e-77
Identity = 152/423 (35.93%), Postives = 227/423 (53.66%), Query Frame = 3
Query:   96 LVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKN-FLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMV--LETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDN--TVP--HFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIAD 1343
            L+   QE   FR  E  SLL +    F  S      + K+ F I+++ S D  R+L+ R++  K  + +W  G S E +   + ++P E          TY++ I   +K  + EEK+K I+ +  L    ++           +E     +Y  D         +P  I +G      QR +++  Y +  R FIGNTSMD  LSF+M N G+V  N ++ DPFVGTGG+LIA AH GA V+GTDIDY  + GLGK+TR +Q WR  +E +R N +QY LE  Y+DV V D+S+     +    FD+I+TDPPYGIRE  R+  + +  P   +     P  H P   SY +S ++ DLL+ +A+ + +GG L+ W+P+    Y  ++ +P H C+E++ NCEQ L+  TSRRL+   K  D
Sbjct:   11 LLLMAQEHLEFRLPEIKSLLLLFGGQFASS---QETYGKSPFWILSIPSEDIARNLMKRTVCAKSIFELWGHGQSPEELYSSLKNYPVEKMVPFLHSDSTYKIKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLE-----DYGLDP---NCIPENPHNIYFGRWIADGQR-ELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTGGLLIACAHFGAYVYGTDIDYNTVHGLGKATRKNQKWRGPDENIRANLRQYGLEKYYLDVLVSDASKPS--WRKGTYFDAIITDPPYGIRESTRRTGSQKEIPKGIEKWEKCPESHVPVSLSYHLSDMFLDLLNFAAETLVLGGRLVYWLPVYTPEYTEEM-VPWHPCLELVSNCEQKLSSHTSRRLITMEKNRD 418          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Human
Match: TRMT11 (tRNA methyltransferase 11 homolog [Source:HGNC Symbol;Acc:HGNC:21080])

HSP 1 Score: 132.109 bits (331), Expect = 1.893e-34
Identity = 88/259 (33.98%), Postives = 129/259 (49.81%), Query Frame = 3
Query:   96 LVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKN-FLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMV--LETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKST 863
            L+   QE   FR  E  SLL +    F  S      + K+ F I+++ S D  R+L+ R++  K  + +W  G S E +   + ++P E          TY++ I   +K  + EEK+K I+ +  L    ++           +E     +Y  D         +P  I +G      QR +++  Y +  R FIGNTSMD  LSF+M N G+V  N ++ DPFVGTGG+LIA AH GA V+GTDIDY  + GL  ST
Sbjct:   11 LLLMAQEHLEFRLPEIKSLLLLFGGQFASS---QETYGKSPFWILSIPSEDIARNLMKRTVCAKSIFELWGHGQSPEELYSSLKNYPVEKMVPFLHSDSTYKIKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLE-----DYGLDP---NCIPENPHNIYFGRWIADGQR-ELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTGGLLIACAHFGAYVYGTDIDYNTVHGLACST 257          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Human
Match: TRMT11 (tRNA methyltransferase 11 homolog [Source:HGNC Symbol;Acc:HGNC:21080])

HSP 1 Score: 91.2781 bits (225), Expect = 2.712e-20
Identity = 68/229 (29.69%), Postives = 106/229 (46.29%), Query Frame = 3
Query:   96 LVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKN-FLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMV--LETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTG 773
            L+   QE   FR  E  SLL +    F  S      + K+ F I+++ S D  R+L+ R++  K  + +W  G S E +   + ++P E          TY++ I   +K  + EEK+K I+ +  L    ++           +E     +Y  D         +P  I +G      QR +++  Y +  R FIGNTSMD  LSF+M N G+V  N ++ DPFVGT 
Sbjct:   11 LLLMAQEHLEFRLPEIKSLLLLFGGQFASS---QETYGKSPFWILSIPSEDIARNLMKRTVCAKSIFELWGHGQSPEELYSSLKNYPVEKMVPFLHSDSTYKIKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLE-----DYGLDP---NCIPENPHNIYFGRWIADGQR-ELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTA 227          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Human
Match: TRMT11 (tRNA methyltransferase 11 homolog [Source:HGNC Symbol;Acc:HGNC:21080])

HSP 1 Score: 91.2781 bits (225), Expect = 2.712e-20
Identity = 68/229 (29.69%), Postives = 106/229 (46.29%), Query Frame = 3
Query:   96 LVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKN-FLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMV--LETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTG 773
            L+   QE   FR  E  SLL +    F  S      + K+ F I+++ S D  R+L+ R++  K  + +W  G S E +   + ++P E          TY++ I   +K  + EEK+K I+ +  L    ++           +E     +Y  D         +P  I +G      QR +++  Y +  R FIGNTSMD  LSF+M N G+V  N ++ DPFVGT 
Sbjct:   11 LLLMAQEHLEFRLPEIKSLLLLFGGQFASS---QETYGKSPFWILSIPSEDIARNLMKRTVCAKSIFELWGHGQSPEELYSSLKNYPVEKMVPFLHSDSTYKIKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLE-----DYGLDP---NCIPENPHNIYFGRWIADGQR-ELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTA 227          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Celegans
Match: Y71F9AL.1 (pep chromosome:WBcel235:I:2925212:2928134:1 gene:WBGene00022107.1 transcript:Y71F9AL.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y71F9AL.1)

HSP 1 Score: 228.409 bits (581), Expect = 5.612e-69
Identity = 144/419 (34.37%), Postives = 234/419 (55.85%), Query Frame = 3
Query:   93 LLVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKNFLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFE--EKLKLIEMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDNTVPHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIAD 1343
            +LV   Q   +FR AEF ++  +  I  + S  E  +   +  I+  ES+ +VR L++RSIL+K A  +     S + + E+I + P E   K ++ + ++ +   AI +K   +  E++K    V+  +K         N    EL L+  YE    +       P  + +G+L     R ++ +KY + +R +IGNT+MD +LSF+ +NL  +S   ++LDPFVGTGG+++ AA  GA V GT+I+Y+     G+S+R     R E E ++ NF+QY  E+ ++ V + DSS+   I   + +FD+I+ DPPYG+RE+ RK   V+N+          + QKE Y + + + DLL++SA+ + I G +  W P++   Y  + +LP H  M++I NCEQ L  +TSRRLL+YRKI D
Sbjct:    4 VLVIFSQSHVDFRIAEFEAICSMFSIKVDLS--EKLNTTDHMFIVNFESHLEVRKLLSRSILVKYAIELSIEAESYDIMYEQIDNKP-EIIEKFDKLEESFAIRFFAIGRKKKLDSIERIKAFLDVVPFNKAPICLKSPKN----ELFLVEEYENPSDEA------PKKVYFGKLIG-EGRAELKTKYNLRDRCYIGNTTMDPELSFIQSNLAMISPGDIVLDPFVGTGGLILPAAEFGAFVIGTEINYQTARAQGRSSRQGVGQRGESESIKANFEQYKSESQFLGVLIADSSK-HGIWSCNAKFDAIVADPPYGVREKARK--TVKNKKVDTTEEYVQYQQKEEYDLEAAFCDLLNLSARLLVINGRISFWYPVILENYCAE-NLPNHPAMDLISNCEQPLTRKTSRRLLSYRKIRD 404          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Fly
Match: CG1074 (gene:FBgn0037250 transcript:FBtr0078925)

HSP 1 Score: 214.542 bits (545), Expect = 6.145e-63
Identity = 147/457 (32.17%), Postives = 233/457 (50.98%), Query Frame = 3
Query:   78 NIMEFLLVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKNFLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEE---KLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDNT----VPHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIADTNITSDPVSS--GLVNTTEYLRNCYFNS 1421
            N  +F+L FA QE  +FR  EF SL+ +  +   +  L  H   K F ++     D      +RS+ ++  + ++A    +    +++ +      + + E      ++++ +E  +K +S  EK++ IE +           ++L  P VE   I  +  D         +P  I +G L  + QR  ++ +  + +RKFIGNTSMD +LS LM N   V +  L+ DPFVGTG +L++AA  G  V G DIDY ++    + +R  Q  R ++E +R N +QY   + YMDV V D S  + +  S   FD I+TDPPYGIRE   K   VE +  +  NT    + H+P    Y + S+Y DLL  SA+ +K+GG L+ WIP     Y+  + LP+H  + +I N EQ L   T+RRLL Y K  + + T   + S   +   ++  R+ YFN+
Sbjct:    3 NWRKFILWFA-QEHVDFRVQEFDSLVKMFGLQVRR--LTEHT-RKPFWLVEFRDTDTALLYASRSVSLRAMFELYAHSNKLPEFHQRLRNHVTANWHSLAEYFRVDASFKIVVETYNKHFSQREKVEKIESM---DYLPIEGTVNLEKPVVEWWYIEFWGLDPT---AVPPEPEDILFGRLMAHGQR-HLIKELSLKHRKFIGNTSMDAQLSLLMANQAMVRNGDLVFDPFVGTGSLLVSAAKWGGYVLGADIDYMMVHARCRPSRITQKVREKDESIRANLKQYGCADRYMDVVVADFS--NPVWHSRISFDCIITDPPYGIREATEK---VEKKASVKANTRSDSMVHYPSTSHYSLQSLYGDLLEFSARHLKLGGRLVCWIPFHSEDYDPKM-LPQHQHLSLIANSEQQLTGNTARRLLTYEKCFEYSPTEPLLCSIKQVPTPSQDFRDRYFNN 442          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Zebrafish
Match: trmt11 (tRNA methyltransferase 11 homolog [Source:ZFIN;Acc:ZDB-GENE-040426-953])

HSP 1 Score: 257.299 bits (656), Expect = 2.124e-79
Identity = 145/421 (34.44%), Postives = 235/421 (55.82%), Query Frame = 3
Query:   87 EFLLVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKNFLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVEN--RPYMNDNTVPHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIAD 1343
            ++LL  A    + FR AE  +LL +    F     E       F  +   S DD+RS+++R++  K A+ +W  G + E +   +  +P E      ++  TY++N+   +K   F++++K I+ +          +  +N  + E    L  +Y      +   +P ++ +G      QR +++  Y +  R FIGNTSMD  LSF+M N  +V +N L+ DPFVGTG +L+A +H GA V GTDIDY  I G+GK++R +Q WR  +E +R N +QY  EN Y+DV V D+S+L  + + + QFD+I+TDPPYGIRE  R+  + ++  +P  + +   H P   +Y +S ++ DLL+ +A  + +GG L+ W+P+ R  Y  ++ +P H C+ +I NCEQ L+  TSRRL+   K  D
Sbjct:   11 QYLLHLAHDNVD-FRLAEIKALLSLRDRPFETP--ETFKEKSPFWHLNGLSEDDIRSVMSRTVCGKSAFELWGHGKTTEELRRSLLEYPSENMAPYLQQNSTYKINVYTFNKTLEFKDRIKKIDAL-----DFLPFEGTVNLKDPEHIFCLLEDYGTDPNDIP-EEPVYVYFGRWIADGQR-ELIRSYSVKKRHFIGNTSMDAGLSFIMANHAKVKANDLVYDPFVGTGSLLVACSHFGAYVCGTDIDYNTIHGIGKASRKNQKWRGPDENIRANLRQYGAENLYVDVMVSDASKL--VWRRNAQFDAIITDPPYGIRESTRRTGSHKDIIKPPEDFSGESHVPVSMAYHLSDIFADLLNFAAHHLVLGGRLVYWLPIYRPEYCEEM-VPLHPCLTLISNCEQTLSSHTSRRLITMEKTKD 418          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Zebrafish
Match: trmt11 (tRNA methyltransferase 11 homolog [Source:ZFIN;Acc:ZDB-GENE-040426-953])

HSP 1 Score: 225.328 bits (573), Expect = 3.834e-68
Identity = 128/380 (33.68%), Postives = 211/380 (55.53%), Query Frame = 3
Query:   87 EFLLVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKNFLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVEN--RPYMNDNTVPHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVR 1220
            ++LL  A    + FR AE  +LL +    F     E       F  +   S DD+RS+++R++  K A+ +W  G + E +   +  +P E      ++  TY++N+   +K   F++++K I+ +          +  +N  + E    L  +Y      +   +P ++ +G      QR +++  Y +  R FIGNTSMD  LSF+M N  +V +N L+ DPFVGTG +L+A +H GA V GTDIDY  I G+GK++R +Q WR  +E +R N +QY  EN Y+DV V D+S+L  + + + QFD+I+TDPPYGIRE  R+  + ++  +P  + +   H P   +Y +S ++ DLL+ +A  + +GG L+ W+P+ R
Sbjct:   11 QYLLHLAHDNVD-FRLAEIKALLSLRDRPFETP--ETFKEKSPFWHLNGLSEDDIRSVMSRTVCGKSAFELWGHGKTTEELRRSLLEYPSENMAPYLQQNSTYKINVYTFNKTLEFKDRIKKIDAL-----DFLPFEGTVNLKDPEHIFCLLEDYGTDPNDIP-EEPVYVYFGRWIADGQR-ELIRSYSVKKRHFIGNTSMDAGLSFIMANHAKVKANDLVYDPFVGTGSLLVACSHFGAYVCGTDIDYNTIHGIGKASRKNQKWRGPDENIRANLRQYGAENLYVDVMVSDASKL--VWRRNAQFDAIITDPPYGIRESTRRTGSHKDIIKPPEDFSGESHVPVSMAYHLSDIFADLLNFAAHHLVLGGRLVYWLPIYR 378          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Xenopus
Match: acp5 (acid phosphatase 5, tartrate resistant [Source:Xenbase;Acc:XB-GENE-957094])

HSP 1 Score: 258.455 bits (659), Expect = 9.398e-80
Identity = 148/426 (34.74%), Postives = 239/426 (56.10%), Query Frame = 3
Query:   87 EFLLVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKNFLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMV--LETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDNTVP--HFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIADTNI 1352
            ++LL+ A QE   FR  E  SLL +   +FN   L++      F I+ L S +  R L+ R++  K  + +W  G +     + + S+P E      +   TY++ I   +K ++ +EK++ I  +  L    ++   + +     +E     +Y  D  K      +P  I +G      QR ++++ Y +  R FIGNTSMD  LSF+M N  RV  N ++ DPFVGTGG+L+++AH GA V GT+IDY  + GLGK+TR +Q WR  +E +R N +QY LE  Y+DV + D+S+   + + +  FD+I+TDPPYGIRE  RK      +  +  +  P  H P + +Y +S ++ DLL+ +A+ +  GG L+ W+P+ +  Y  ++ LP+H C+++I NCEQ+L+  TSRRL+   K+ D  +
Sbjct:   13 KYLLLLA-QENCEFRMPEIKSLLSVYGGHFNN--LQDAHGKSPFCILNLPSEEMARKLMKRTVCAKSVFELWGHGKTFTEFQQSVLSYPLEKMMPYLQPNSTYKIIIHTFNKTFTQKEKVEKINAMEFLPFQGKVNLQNAENIFYVLE-----DYGSDPNKAP---KEPFEIFFGRWIADGQR-ELINSYSVKKRHFIGNTSMDAGLSFIMANHARVKPNDMVFDPFVGTGGLLVSSAHFGAYVCGTEIDYNTVHGLGKATRMNQKWRGPDENIRANLRQYGLEKYYLDVLLSDASK--PVWRKAPLFDAIITDPPYGIRESTRKTGT--QKEIIKTDLFPESHVPVQLNYHLSEIFSDLLAFAAEFLVTGGRLVYWLPVYKPEYTEEV-LPRHPCLKLISNCEQMLSSHTSRRLITMEKVKDFEV 421          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Xenopus
Match: acp5 (acid phosphatase 5, tartrate resistant [Source:Xenbase;Acc:XB-GENE-957094])

HSP 1 Score: 257.684 bits (657), Expect = 3.638e-79
Identity = 148/423 (34.99%), Postives = 238/423 (56.26%), Query Frame = 3
Query:   87 EFLLVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKNFLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMV--LETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDNTVP--HFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIAD 1343
            ++LL+ A QE   FR  E  SLL +   +FN   L++      F I+ L S +  R L+ R++  K  + +W  G +     + + S+P E      +   TY++ I   +K ++ +EK++ I  +  L    ++   + +     +E     +Y  D  K      +P  I +G      QR ++++ Y +  R FIGNTSMD  LSF+M N  RV  N ++ DPFVGTGG+L+++AH GA V GT+IDY  + GLGK+TR +Q WR  +E +R N +QY LE  Y+DV + D+S+   + + +  FD+I+TDPPYGIRE  RK      +  +  +  P  H P + +Y +S ++ DLL+ +A+ +  GG L+ W+P+ +  Y  ++ LP+H C+++I NCEQ+L+  TSRRL+   K+ D
Sbjct:   13 KYLLLLA-QENCEFRMPEIKSLLSVYGGHFNN--LQDAHGKSPFCILNLPSEEMARKLMKRTVCAKSVFELWGHGKTFTEFQQSVLSYPLEKMMPYLQPNSTYKIIIHTFNKTFTQKEKVEKINAMEFLPFQGKVNLQNAENIFYVLE-----DYGSDPNKAP---KEPFEIFFGRWIADGQR-ELINSYSVKKRHFIGNTSMDAGLSFIMANHARVKPNDMVFDPFVGTGGLLVSSAHFGAYVCGTEIDYNTVHGLGKATRMNQKWRGPDENIRANLRQYGLEKYYLDVLLSDASK--PVWRKAPLFDAIITDPPYGIRESTRKTGT--QKEIIKTDLFPESHVPVQLNYHLSEIFSDLLAFAAEFLVTGGRLVYWLPVYKPEYTEEV-LPRHPCLKLISNCEQMLSSHTSRRLITMEKVKD 418          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Xenopus
Match: acp5 (acid phosphatase 5, tartrate resistant [Source:Xenbase;Acc:XB-GENE-957094])

HSP 1 Score: 247.669 bits (631), Expect = 5.386e-76
Identity = 134/380 (35.26%), Postives = 217/380 (57.11%), Query Frame = 3
Query:  216 FLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMV--LETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDNTVP--HFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIAD 1343
            F I+ L S +  R L+ R++  K  + +W  G +     + + S+P E      +   TY++ I   +K ++ +EK++ I  +  L    ++   + +     +E     +Y  D  K      +P  I +G      QR ++++ Y +  R FIGNTSMD  LSF+M N  RV  N ++ DPFVGTGG+L+++AH GA V GT+IDY  + GLGK+TR +Q WR  +E +R N +QY LE  Y+DV + D+S+   + + +  FD+I+TDPPYGIRE  RK      +  +  +  P  H P + +Y +S ++ DLL+ +A+ +  GG L+ W+P+ +  Y  ++ LP+H C+++I NCEQ+L+  TSRRL+   K+ D
Sbjct:   12 FCILNLPSEEMARKLMKRTVCAKSVFELWGHGKTFTEFQQSVLSYPLEKMMPYLQPNSTYKIIIHTFNKTFTQKEKVEKINAMEFLPFQGKVNLQNAENIFYVLE-----DYGSDPNKAP---KEPFEIFFGRWIADGQR-ELINSYSVKKRHFIGNTSMDAGLSFIMANHARVKPNDMVFDPFVGTGGLLVSSAHFGAYVCGTEIDYNTVHGLGKATRMNQKWRGPDENIRANLRQYGLEKYYLDVLLSDASK--PVWRKAPLFDAIITDPPYGIRESTRKTGT--QKEIIKTDLFPESHVPVQLNYHLSEIFSDLLAFAAEFLVTGGRLVYWLPVYKPEYTEEV-LPRHPCLKLISNCEQMLSSHTSRRLITMEKVKD 377          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Xenopus
Match: acp5 (acid phosphatase 5, tartrate resistant [Source:Xenbase;Acc:XB-GENE-957094])

HSP 1 Score: 247.669 bits (631), Expect = 7.951e-76
Identity = 134/380 (35.26%), Postives = 217/380 (57.11%), Query Frame = 3
Query:  216 FLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMV--LETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDNTVP--HFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIAD 1343
            F I+ L S +  R L+ R++  K  + +W  G +     + + S+P E      +   TY++ I   +K ++ +EK++ I  +  L    ++   + +     +E     +Y  D  K      +P  I +G      QR ++++ Y +  R FIGNTSMD  LSF+M N  RV  N ++ DPFVGTGG+L+++AH GA V GT+IDY  + GLGK+TR +Q WR  +E +R N +QY LE  Y+DV + D+S+   + + +  FD+I+TDPPYGIRE  RK      +  +  +  P  H P + +Y +S ++ DLL+ +A+ +  GG L+ W+P+ +  Y  ++ LP+H C+++I NCEQ+L+  TSRRL+   K+ D
Sbjct:   12 FCILNLPSEEMARKLMKRTVCAKSVFELWGHGKTFTEFQQSVLSYPLEKMMPYLQPNSTYKIIIHTFNKTFTQKEKVEKINAMEFLPFQGKVNLQNAENIFYVLE-----DYGSDPNKAP---KEPFEIFFGRWIADGQR-ELINSYSVKKRHFIGNTSMDAGLSFIMANHARVKPNDMVFDPFVGTGGLLVSSAHFGAYVCGTEIDYNTVHGLGKATRMNQKWRGPDENIRANLRQYGLEKYYLDVLLSDASK--PVWRKAPLFDAIITDPPYGIRESTRKTGT--QKEIIKTDLFPESHVPVQLNYHLSEIFSDLLAFAAEFLVTGGRLVYWLPVYKPEYTEEV-LPRHPCLKLISNCEQMLSSHTSRRLITMEKVKD 377          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Xenopus
Match: acp5 (acid phosphatase 5, tartrate resistant [Source:Xenbase;Acc:XB-GENE-957094])

HSP 1 Score: 231.876 bits (590), Expect = 1.133e-69
Identity = 126/357 (35.29%), Postives = 204/357 (57.14%), Query Frame = 3
Query:  285 CAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMV--LETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDNTVP--HFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIAD 1343
              + +W  G +     + + S+P E      +   TY++ I   +K ++ +EK++ I  +  L    ++   + +     +E     +Y  D  K      +P  I +G      QR ++++ Y +  R FIGNTSMD  LSF+M N  RV  N ++ DPFVGTGG+L+++AH GA V GT+IDY  + GLGK+TR +Q WR  +E +R N +QY LE  Y+DV + D+S+   + + +  FD+I+TDPPYGIRE  RK      +  +  +  P  H P + +Y +S ++ DLL+ +A+ +  GG L+ W+P+ +  Y  ++ LP+H C+++I NCEQ+L+  TSRRL+   K+ D
Sbjct:   52 SVFELWGHGKTFTEFQQSVLSYPLEKMMPYLQPNSTYKIIIHTFNKTFTQKEKVEKINAMEFLPFQGKVNLQNAENIFYVLE-----DYGSDPNKAP---KEPFEIFFGRWIADGQR-ELINSYSVKKRHFIGNTSMDAGLSFIMANHARVKPNDMVFDPFVGTGGLLVSSAHFGAYVCGTEIDYNTVHGLGKATRMNQKWRGPDENIRANLRQYGLEKYYLDVLLSDASK--PVWRKAPLFDAIITDPPYGIRESTRKTGT--QKEIIKTDLFPESHVPVQLNYHLSEIFSDLLAFAAEFLVTGGRLVYWLPVYKPEYTEEV-LPRHPCLKLISNCEQMLSSHTSRRLITMEKVKD 394          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Mouse
Match: Trmt11 (tRNA methyltransferase 11 [Source:MGI Symbol;Acc:MGI:1920931])

HSP 1 Score: 254.603 bits (649), Expect = 2.800e-78
Identity = 151/418 (36.12%), Postives = 226/418 (54.07%), Query Frame = 3
Query:   96 LVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKN-FLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPY-MNDNTVPHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIAD 1343
            L+   QE   FR  E  SLL +    F  S      + K+ F I+ + S D  R+L+ R++  K  + +W  G S E +   + S+P E          TY++ I   +K  + EEK+K I+ +     Q   N     +      ++ +Y  D         DP  I +G      QR +++  Y +  R FIGNTSMD  LSF+MTN  +V  N L+ DPFVGTGG+LIA+AH GA V GTDIDY  + GLGK++R +Q WR  +E +R N +QY LE  Y+DV V D+S+     +    FD+I+TDPPYGIRE  R+  + ++ P  +      H P   SY +S ++ DLL+ +A+ + +GG L+ W+P+    Y  ++ +P H C+ +I NCEQ L+  T+RRL+   K+ +
Sbjct:   11 LLLMAQEHLEFRLPEIKSLLSVFGGQFTNS---QETYGKSPFWILNIPSEDIARNLMKRTVCAKSIFELWGHGKSPEELYTSLKSYPVEKMVPYLHSDSTYKIKIHTFNKTLTQEEKVKRIDALEFLPFQGKVNLKKPQHV---FSILEDYGLDP---NSIPKDPHNIYFGRWIADGQR-ELIESYSVKKRHFIGNTSMDAGLSFIMTNHAKVKENDLVFDPFVGTGGLLIASAHFGAYVCGTDIDYNTVHGLGKASRKNQKWRGPDENIRANLRQYGLEKFYLDVLVSDASKPS--WRKGTYFDAIITDPPYGIRESTRRSGSQKDIPKGIEKCPESHVPVSLSYHLSDMFFDLLNFAAETLVLGGRLVYWLPVYTPEYTEEM-VPWHPCLRLISNCEQKLSSHTARRLITMEKVKE 415          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Mouse
Match: Trmt11 (tRNA methyltransferase 11 [Source:MGI Symbol;Acc:MGI:1920931])

HSP 1 Score: 64.6994 bits (156), Expect = 2.415e-12
Identity = 31/64 (48.44%), Postives = 39/64 (60.94%), Query Frame = 3
Query:  582 DPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTG 773
            DP  I +G      QR +++  Y +  R FIGNTSMD  LSF+MTN  +V  N L+ DPFVGT 
Sbjct:   20 DPHNIYFGRWIADGQR-ELIESYSVKKRHFIGNTSMDAGLSFIMTNHAKVKENDLVFDPFVGTA 82          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. UniProt/SwissProt
Match: sp|Q5R962|TRM11_PONAB (tRNA (guanine(10)-N2)-methyltransferase homolog OS=Pongo abelii OX=9601 GN=TRMT11 PE=2 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 1.345e-77
Identity = 153/422 (36.26%), Postives = 227/422 (53.79%), Query Frame = 3
Query:   96 LVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKN-FLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLI---EMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDN--TVP--HFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKI 1337
            L+   QE   FR  E  SLL +    F  S      + K+ F I+++ S D  R+L+ R++  K  + +W  G S E +   + ++P E          TY++ I   +K  + EEK+K I   E +    K   +    + +   + GL  N             +P  I +G      QR +++  Y +  R FIGNTSMD  LSF+M N G+V  N ++ DPFVGTGG+LIA AH GA V+GTDIDY  + GLGK+TR +Q WR  +E +R N +QY LE  Y+DV V D+S+     +    FD+I+TDPPYGIRE  R+  + +  P   +     P  H P   SY +S ++ DLL+ +A+ + +GG L+ W+P+    Y  ++ +P H C+E+I NCEQ L+  TSRRL+   K+
Sbjct:   11 LLLMAQEHLEFRLPEIKSLLSLFGGQFGSS---QETFGKSPFWILSIPSEDIARNLMKRTVCAKSIFELWGHGQSPEELYSSLKNYPVEKMVPFLHSDSTYKIKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDPN---------CIPENPHNIYFGRWIADGQR-ELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTGGLLIACAHFGAYVYGTDIDYNTVHGLGKATRKNQKWRGPDENIRANLRQYGLEKYYLDVLVSDASKPS--WRKGTYFDAIITDPPYGIRESTRRTGSQKEIPKGIEKWEKCPESHVPVSLSYHLSDMFLDLLNFAAETLVLGGRLVYWLPVYTPEYTEEM-VPWHPCLELISNCEQKLSSHTSRRLITMEKV 416          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. UniProt/SwissProt
Match: sp|Q05B63|TRM11_BOVIN (tRNA (guanine(10)-N2)-methyltransferase homolog OS=Bos taurus OX=9913 GN=TRMT11 PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 1.502e-77
Identity = 151/427 (35.36%), Postives = 230/427 (53.86%), Query Frame = 3
Query:   78 NIMEFLLVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKN-FLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLI---EMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPY-MNDNTVPHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIAD 1343
             I+   L+   QE   FR  E  SLL +    F   I     + K+ F I+++ S D  R+L+ R++  K  + +W  G   E +   + ++P E          TY++ I   +K  + EEK+K I   E +    K   +    + +   + GL  N+            +P  I +G      QR +++  Y +  R FIGNTSMD  LSF+M N G+V  N ++ DPFVGTGG+LIA+AH GA V+GTDIDY  + GLGK++R +Q WR  +E +R N +QY LE  Y+DV V D+S+     +    FD+I+TDPPYGIRE  R+  + +  P  +      H P   SY +S ++ DLL+ SA+ + +GG L+ W+P+    Y  ++ +P H C+++I NCEQ L+  TSRRL+   K+ +
Sbjct:    5 GILNRYLLLMAQEHLEFRLPEIKSLLSLFGGQF---ISSQETYGKSPFWILSIPSEDIARNLMKRTVCAKSIFELWGHGKCPEELYSSLKNYPVEKMVPFLHSDSTYKIKIHTFNKTLTQEEKVKRIDALEFLPFEGKVNLKKPQHVFSILEDYGLDPNH---------IPENPHNIYFGRWIADGQR-ELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKKNDIVFDPFVGTGGLLIASAHFGAYVYGTDIDYNTVHGLGKASRKNQKWRGPDENIRANLRQYGLEKYYLDVLVSDASKPS--WRKGTYFDAIITDPPYGIRESTRRTGSQKEIPKGIEKCPESHVPVSLSYHLSDMFFDLLNFSAETLVLGGRLVYWLPVYTPEYTEEM-VPWHPCLKLISNCEQKLSSHTSRRLITMEKVKE 415          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. UniProt/SwissProt
Match: sp|Q9CWH5|TRM11_MOUSE (tRNA (guanine(10)-N2)-methyltransferase homolog OS=Mus musculus OX=10090 GN=Trmt11 PE=1 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 1.818e-77
Identity = 151/418 (36.12%), Postives = 226/418 (54.07%), Query Frame = 3
Query:   96 LVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKN-FLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPY-MNDNTVPHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIAD 1343
            L+   QE   FR  E  SLL +    F  S      + K+ F I+ + S D  R+L+ R++  K  + +W  G S E +   + S+P E          TY++ I   +K  + EEK+K I+ +     Q   N     +      ++ +Y  D         DP  I +G      QR +++  Y +  R FIGNTSMD  LSF+MTN  +V  N L+ DPFVGTGG+LIA+AH GA V GTDIDY  + GLGK++R +Q WR  +E +R N +QY LE  Y+DV V D+S+     +    FD+I+TDPPYGIRE  R+  + ++ P  +      H P   SY +S ++ DLL+ +A+ + +GG L+ W+P+    Y  ++ +P H C+ +I NCEQ L+  T+RRL+   K+ +
Sbjct:   11 LLLMAQEHLEFRLPEIKSLLSVIGGQFTNS---QETYGKSPFWILNIPSEDIARNLMKRTVCAKSIFELWGHGKSPEELYTSLKSYPVEKMVPYLHSDSTYKIKIHTFNKTLTQEEKVKRIDALEFLPFQGKVNLKKPQHV---FSILEDYGLDP---NSIPKDPHNIYFGRWIADGQR-ELIESYSVKKRHFIGNTSMDAGLSFIMTNHAKVKENDLVFDPFVGTGGLLIASAHFGAYVCGTDIDYNTVHGLGKASRKNQKWRGPDENIRANLRQYGLEKFYLDVLVSDASKPS--WRKGTYFDAIITDPPYGIRESTRRSGSQKDIPKGIEKCPESHVPVSLSYHLSDMFFDLLNFAAETLVLGGRLVYWLPVYTPEYTEEM-VPWHPCLRLISNCEQKLSSHTARRLITMEKVKE 415          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. UniProt/SwissProt
Match: sp|Q6NS23|TRM11_XENLA (tRNA (guanine(10)-N2)-methyltransferase homolog OS=Xenopus laevis OX=8355 GN=trmt11 PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 3.168e-77
Identity = 150/421 (35.63%), Postives = 235/421 (55.82%), Query Frame = 3
Query:   87 EFLLVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKNFLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDNTVP--HFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIAD 1343
            ++LL+ A QE   FR  E  SLL +   +FN   L++      F I+ L S +  R L+ R++  K  + +W  G +     + + S+P E      +   TY++ I + +K  + +EKL+ I  +     Q   N  +  N      L+ +Y  D  K      +P  I +G      QR ++++ Y +  R FIGNTSMD  LSF+M N  RV  N ++ DPFVGTGG+L+++AH GA V GT+IDY  + GLGK+TR +Q WR  +E +R N +QY LE  Y+DV V D+S+   + + +  FD+I+TDPPYGIRE  RK      +  +     P  H P + +Y +S ++ DL + +++ +  GG L+ W+P+ R  Y  ++ LP+H C+++I NCEQ+L+  TSRRL+   K+ +
Sbjct:   13 KYLLLLA-QENCEFRLPEIKSLLSLYGGHFNN--LQDEHGKSPFCILNLPSEEMARKLMKRTVCAKSVFELWGHGKTFMEFQQSVLSYPLENMMSYLQPNSTYKIIIHSFNKTLTQKEKLEKINTMEFIPFQGKVNLQNAENIFY---LLEDYGSDPNKAP---NEPFEIFFGRWIADGQR-ELINSYSVKKRHFIGNTSMDAGLSFIMANHARVKPNDVVFDPFVGTGGLLVSSAHFGAYVCGTEIDYNTVHGLGKATRMNQKWRGPDENIRANLRQYGLEKYYLDVLVSDASK--PVWRKAPLFDAIITDPPYGIRESTRKTGT--QKEIIKTELFPESHVPVQLNYHLSDIFSDLFAFASEFLVTGGRLVYWLPVYRPEYTEEV-LPRHPCLKLISNCEQMLSSHTSRRLITMEKVKE 418          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. UniProt/SwissProt
Match: sp|Q7Z4G4|TRM11_HUMAN (tRNA (guanine(10)-N2)-methyltransferase homolog OS=Homo sapiens OX=9606 GN=TRMT11 PE=1 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 8.169e-77
Identity = 152/422 (36.02%), Postives = 227/422 (53.79%), Query Frame = 3
Query:   96 LVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKN-FLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLI---EMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDN--TVP--HFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKI 1337
            L+   QE   FR  E  SLL +    F  S      + K+ F I+++ S D  R+L+ R++  K  + +W  G S E +   + ++P E          TY++ I   +K  + EEK+K I   E +    K   +    + +   + GL  N             +P  I +G      QR +++  Y +  R FIGNTSMD  LSF+M N G+V  N ++ DPFVGTGG+LIA AH GA V+GTDIDY  + GLGK+TR +Q WR  +E +R N +QY LE  Y+DV V D+S+     +    FD+I+TDPPYGIRE  R+  + +  P   +     P  H P   SY +S ++ DLL+ +A+ + +GG L+ W+P+    Y  ++ +P H C+E++ NCEQ L+  TSRRL+   K+
Sbjct:   11 LLLMAQEHLEFRLPEIKSLLLLFGGQFASS---QETYGKSPFWILSIPSEDIARNLMKRTVCAKSIFELWGHGQSPEELYSSLKNYPVEKMVPFLHSDSTYKIKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDPN---------CIPENPHNIYFGRWIADGQR-ELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTGGLLIACAHFGAYVYGTDIDYNTVHGLGKATRKNQKWRGPDENIRANLRQYGLEKYYLDVLVSDASKPS--WRKGTYFDAIITDPPYGIRESTRRTGSQKEIPKGIEKWEKCPESHVPVSLSYHLSDMFLDLLNFAAETLVLGGRLVYWLPVYTPEYTEEM-VPWHPCLELVSNCEQKLSSHTSRRLITMEKV 416          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. TrEMBL
Match: A0A0X3QA54 (tRNA (Guanine(10)-N2)-methyltransferase homolog OS=Schistocephalus solidus OX=70667 GN=TRM11 PE=4 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 7.262e-83
Identity = 168/521 (32.25%), Postives = 267/521 (51.25%), Query Frame = 3
Query:   84 MEFLLVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKNFLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRIL--------------------QSSFQ-----------FDSILTDPPYGIRERGRKLM--AVENRP------YMNDNT--------------------VPHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKI----ADTNITSDPVSSGLVNTTEY-----------LRNCYFNSK 1424
            M++LL F+ QEF NFRE E  SLL+++ ++    I ++ DWN+ ++++  ++++    LI RS+LIK  Y +WA  ++ E +  KI   P +            ++N+ +++KK S E++L  I  +L THK +       +    E  L L ++Y ++           + YG L   S R ++MSK+ +S R ++GNT+MDV+L+ ++ N        L+ DPF+GTGG+++A +  GA   G DIDY ++ G G+S +A Q  R E ECLR N++QY LE  Y+DV + D++ L R+L                    QS  Q           FD+I+TDPPYG+RER  ++   A E  P      ++ + T                    +PHFP KE Y +   + +LL++S + +K  G L+ W+P+ R+ Y+G  SLP H  +++I  CEQ LN R SR L+   K+    AD  +TS   ++    +TE             RN YF  K
Sbjct:    1 MQYLLSFSAQEFVNFRELEVRSLLELNGLD-QDCIADDVDWNEPYILVNCQNDEQAHKLIERSVLIKSVYSIWAQASTFEKLLNKIDLVPKKLMEPFISGPAPIKVNVTSVNKKTSQEDRLDYINRLLGTHKDITAPVSLKSP---EYELYLLFDYTRSLTNQKDQKLKRVFYGRLVGESSRRRLMSKFDLSKRTYLGNTTMDVRLAGIIANACLARRGDLVWDPFLGTGGMVLATSVWGAYGAGCDIDYALVHGKGRSPKAGQGKRMEGECLRANYRQYGLEPYYLDVIIADAATLGRLLRVPEERLLLATAIPTAADANQSPEQKQEPQVPSVGLFDAIITDPPYGVRERSCRIAGKAAEREPTFVTPEFLEEITGGAHHPVVVNQDGLVPVTHDLPHFPHKEVYPLQESFSNLLTISVRLLKPHGRLVFWVPIDRNTYKGPESLPSHPRLKLITVCEQALNNRVSRFLMVMEKLPLCAADFELTSVRSTAADDTSTESWGKGVPFHLDNFRNAYFKPK 517          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. TrEMBL
Match: A0A5J4NE36 (tRNA (Guanine10-N2)-methyltransferase OS=Paragonimus westermani OX=34504 GN=DEA37_0004832 PE=4 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 2.616e-81
Identity = 160/470 (34.04%), Postives = 252/470 (53.62%), Query Frame = 3
Query:   84 MEFLLVFAGQEFENFREAEFLSLLDISRINFNKSILE--NHDWNKNFLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPT---FICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQ----------------FDSILTDPPYGIRERGRKL--MAVENRP--------------------YMNDNT---------VPHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKI 1337
            M+F+L FA  EF NFR+ E+LSL  +  I  + SI E   + W++ ++++ L+S     +L+ RS+LIK  Y VW   + +  +  KI   P + T+K      +YRL I ++++K   EEKL++IE VL  H  +       +    +L ++L+YE  +  GK  LT       + YG L   S+R  +++ Y++++R ++GNTSMDV+L+ +M N G      LI DPF+GTG I++AA+  GA   G+DIDY ++ G+G S +A               QQYNL++ Y+DV V D++ L R+L+   +                FD+ILTDPPYG RE  R++   AVE  P                     MN +          +PH P KESY ++  Y+DLL+++   +K GG L+ WIP+ R +  G   +P H+ + ++  CEQ+LN R +R ++  RK+
Sbjct:    1 MKFVLSFAASEFVNFRQTEYLSLCQLCGIPSDLSISEWSRNYWSQPYIVVDLQSESAAVNLVERSVLIKAVYEVWCEASDLSDLQAKIPKIPAQLTDKYLNGGGSYRLIISSVNRKLPHEEKLQIIEDVLNAHPSVNATVCLKHPNQ-QLNVLLDYE-PRNWGKRPLTSQVNLRHVYYGRLVGTSRRRDLINSYRLADRAYLGNTSMDVRLAGIMANAGLCEQGSLIWDPFLGTGSIVLAASIWGALGAGSDIDYALLHGMGMSPKAG--------------QQYNLQSRYLDVVVADAASLGRLLRLPGENKRANGYSSVTCDMGLFDAILTDPPYGFRESSRRVAGQAVERSPSLVTPERLSEITGVPLRDVVQMNSDEQALIKVPHDLPHIPHKESYPLTETYNDLLNLAVHFLKPGGRLVFWIPVNRLISCGPCVVPSHARLRVLAACEQILNVRNARYMIVMRKL 454          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. TrEMBL
Match: A0A504YNM1 (tRNA guanosine-2'-O-methyltransferase TRM11 OS=Fasciola gigantica OX=46835 GN=FGIG_09962 PE=4 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 4.838e-81
Identity = 159/491 (32.38%), Postives = 255/491 (51.93%), Query Frame = 3
Query:   84 MEFLLVFAGQEFENFREAEFLSLLDISRINFNKSILENHD--WNKNFLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQXXXXXXXXXXXXV-------------ELGLILNYE---YDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQ-----------------FDSILTDPPYGIRERGRKLM--AVENRPYM-------------NDNTV--------------------PHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIADT 1346
            M+++L F   EF NFR+AEF +L+ +  + F++ I ++    W + +L++ L+S+    +LI RS+LIK  Y  W    S   +  +I++ P + T++      TY++ I + +KK S E KL +IE VL +H +L       N                  L ++L+Y    + K     +      + YG     S+R ++++ Y++S+R ++GNTSMDV+LS +M N+G      L+ DPF+GTG I++ A+  GA   G+DIDY ++ G+G S +A Q  R ++ECLR ++ QY LE  +MDV V D + L R+L+S                    FD+ILTDPPYG RER  ++   A+E  P +               N V                    PHFP KE+Y +S  Y DL++++ + ++ GG L+ WIP+ R +  G   LP H  + ++  CEQ+L+ R SR ++A  K+  T
Sbjct:    1 MKYVLAFVASEFVNFRQAEFSALVQLQGLKFDEVITDSSPDYWLRPYLMVNLDSDAQAEALIERSVLIKSIYHCWCDAPSFPQLLSEIATIPTQVTDQYLSRSCTYKVVISSANKKISHETKLGMIEDVLNSHPKLDATVCLSNPQASSTICASLTSLSNHHLHILLDYAPKNWPKLPPDASKDHLRHLYYGRWVATSKRCELINSYRLSDRNYLGNTSMDVRLSGIMANVGLCRPGTLVWDPFLGTGSIVLVASIWGAYGAGSDIDYALLHGMGMSPKAGQGKRLDDECLRNSYAQYGLEKRFMDVVVADVTTLHRLLRSPGVDCVVPIHEASCRDPVGLFDAILTDPPYGFRERSCRVAEKAIEREPSLVTPDRLVEITGQSTPNPVGQGEDISENQSILIPVPHDLPHFPHKEAYPLSETYRDLINLADRFLRPGGRLVFWIPVKREMNFGLNRLPTHPRLRLLCACEQILSGRNSRYMVAMEKLKPT 491          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. TrEMBL
Match: A0A5K4EGK6 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 1.034e-80
Identity = 160/472 (33.90%), Postives = 261/472 (55.30%), Query Frame = 3
Query:   57 FSKNNKHNIMEFLLVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKNFLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFIC---YGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQ--FDSILTDPPYGIRERGRKL--MAVENRPYM--------------------NDNT--------------VPHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIADTN 1349
            +   +K  + +++  FA  EF NFR  EF SL ++ +++++ S  ++ DW + F++I +E++D V S+I RS+LIK A+ +W    ++  + E++++ P E  +       T+++ + + HKK   EEK+ +IE +L+ HK++       +  + ++ ++L Y   K  GK T++    +C   YG L   S R  +M+ Y++S R  +GNT+M+V L+ +M N+G    +  + DPF+GTG  +IAA+  G+   G+DIDY V+ G+G S +A Q  R   E LR N++QY LE+ Y+DV V D   L + L+      FD+I+TDPPYG RER  K+    VE +P +                    N N               +PHFP KE Y ++ +Y DL+ ++A  +   G L+ W+P++RS + G  SLP H    ++  CEQ LN RTSR L+   K+ DTN
Sbjct:   26 YVSQSKAKMKKYVFSFAASEFVNFRWIEFKSLAEMEQLSYSVSESKD-DWLRPFVVIEMENDDSVLSIIKRSVLIKSAFHLWCDAATLSELIEQVANLPSELVDPYLNGCDTFKIVLSSAHKKLKQEEKIPIIETILDAHKRIDAQVSLSSPDH-QINILLEYT-PKNLGKNTVSSGGHLCRLLYGRLIGGSIRRIMMNDYRLSERAHLGNTTMNVTLAAIMANVGLCRKSSFVWDPFIGTGSTVIAASVWGSFGGGSDIDYSVLHGIGMSPKAGQEKRC-GETLRSNYEQYKLESRYLDVMVADIVSLRKFLRIPHGGLFDAIITDPPYGFRERSCKVSDQPVERKPTLVTKHRLAEIMGNMHIGDENRNGNKDEVDGESLVLVPHDLPHFPHKEVYPVNKIYKDLMELAADLLYPNGRLVFWVPVLRSEFIGVKSLPHHLNFRLLAACEQTLNTRTSRYLVVMVKL-DTN 492          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. TrEMBL
Match: A0A3Q0KI36 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 1.869e-80
Identity = 159/462 (34.42%), Postives = 257/462 (55.63%), Query Frame = 3
Query:   87 EFLLVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKNFLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFIC---YGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQ--FDSILTDPPYGIRERGRKL--MAVENRPYM--------------------NDNT--------------VPHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIADTN 1349
            +++  FA  EF NFR  EF SL ++ +++++ S  ++ DW + F++I +E++D V S+I RS+LIK A+ +W    ++  + E++++ P E  +       T+++ + + HKK   EEK+ +IE +L+ HK++       +  + ++ ++L Y   K  GK T++    +C   YG L   S R  +M+ Y++S R  +GNT+M+V L+ +M N+G    +  + DPF+GTG  +IAA+  G+   G+DIDY V+ G+G S +A Q  R   E LR N++QY LE+ Y+DV V D   L + L+      FD+I+TDPPYG RER  K+    VE +P +                    N N               +PHFP KE Y ++ +Y DL+ ++A  +   G L+ W+P++RS + G  SLP H    ++  CEQ LN RTSR L+   K+ DTN
Sbjct:    3 KYVFSFAASEFVNFRWIEFKSLAEMEQLSYSVSESKD-DWLRPFVVIEMENDDSVLSIIKRSVLIKSAFHLWCDAATLSELIEQVANLPSELVDPYLNGCDTFKIVLSSAHKKLKQEEKIPIIETILDAHKRIDAQVSLSSPDH-QINILLEYT-PKNLGKNTVSSGGHLCRLLYGRLIGGSIRRIMMNDYRLSERAHLGNTTMNVTLAAIMANVGLCRKSSFVWDPFIGTGSTVIAASVWGSFGGGSDIDYSVLHGIGMSPKAGQEKRC-GETLRSNYEQYKLESRYLDVMVADIVSLRKFLRIPHGGLFDAIITDPPYGFRERSCKVSDQPVERKPTLVTKHRLAEIMGNMHIGDENRNGNKDEVDGESLVLVPHDLPHFPHKEVYPVNKIYKDLMELAADLLYPNGRLVFWVPVLRSEFIGVKSLPHHLNFRLLAACEQTLNTRTSRYLVVMVKL-DTN 459          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Cavefish
Match: trmt11 (tRNA methyltransferase 11 homolog [Source:NCBI gene;Acc:103030151])

HSP 1 Score: 236.113 bits (601), Expect = 1.620e-71
Identity = 132/396 (33.33%), Postives = 209/396 (52.78%), Query Frame = 3
Query:  237 SNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFI-C--------------------YGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVE--NRPYMNDNTVPHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIADTNIT 1355
            S +DVRS+++R++  K  + +W  G +   +   +  +P E      +++ TY++N+   +K   F +++K I+ +                           +Y   +GKV L DP  I C                    +G      QR +++  + +  R FIGNTSMD  LSF+M N  +V    L+ DPFVGTG +L+A +H GA V GTDIDY  I G+GK++R +Q WR  +E +R N +QY  E +Y+DV V D+S+   + + +  FD+I+TDPPYGIRE  R+  + +    P  + +   H P   +Y +S ++ DLL+ +A  + IGG L+ W+P+ R  Y  ++ +P H C+ +I NCEQ L+  TSRRL+   KI    +T
Sbjct:   38 SEEDVRSVMSRTVCAKSVFELWGHGRTATELKSSLMEYPRESMATFLQDQSTYKINVYTFNKTLLFNDRIKKIDAL---------------------------DYLPFQGKVNLKDPDHIFCLFEDYGLDPNDIPEEPLYLYFGRWISDGQR-ELIRSHSVKKRHFIGNTSMDAGLSFIMANHAKVKPLDLVYDPFVGTGSLLVACSHFGAYVCGTDIDYNTIHGVGKASRKNQKWRGPDENIRANLRQYGTEFSYVDVMVSDASK--PVWRRAELFDAIITDPPYGIRESTRRTGSHKEVTSPPDDFSGESHVPVSMAYHLSDIFADLLNFAANHLAIGGRLVYWLPVYRPEYCEEM-VPLHPCLTLISNCEQTLSSHTSRRLITMEKIKQPEVT 402          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Cavefish
Match: trmt11 (tRNA methyltransferase 11 homolog [Source:NCBI gene;Acc:103030151])

HSP 1 Score: 235.728 bits (600), Expect = 3.318e-71
Identity = 132/396 (33.33%), Postives = 209/396 (52.78%), Query Frame = 3
Query:  237 SNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFI-C--------------------YGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVE--NRPYMNDNTVPHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIADTNIT 1355
            S +DVRS+++R++  K  + +W  G +   +   +  +P E      +++ TY++N+   +K   F +++K I+ +                           +Y   +GKV L DP  I C                    +G      QR +++  + +  R FIGNTSMD  LSF+M N  +V    L+ DPFVGTG +L+A +H GA V GTDIDY  I G+GK++R +Q WR  +E +R N +QY  E +Y+DV V D+S+   + + +  FD+I+TDPPYGIRE  R+  + +    P  + +   H P   +Y +S ++ DLL+ +A  + IGG L+ W+P+ R  Y  ++ +P H C+ +I NCEQ L+  TSRRL+   KI    +T
Sbjct:   58 SEEDVRSVMSRTVCAKSVFELWGHGRTATELKSSLMEYPRESMATFLQDQSTYKINVYTFNKTLLFNDRIKKIDAL---------------------------DYLPFQGKVNLKDPDHIFCLFEDYGLDPNDIPEEPLYLYFGRWISDGQR-ELIRSHSVKKRHFIGNTSMDAGLSFIMANHAKVKPLDLVYDPFVGTGSLLVACSHFGAYVCGTDIDYNTIHGVGKASRKNQKWRGPDENIRANLRQYGTEFSYVDVMVSDASK--PVWRRAELFDAIITDPPYGIRESTRRTGSHKEVTSPPDDFSGESHVPVSMAYHLSDIFADLLNFAANHLAIGGRLVYWLPVYRPEYCEEM-VPLHPCLTLISNCEQTLSSHTSRRLITMEKIKQPEVT 422          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Sea Lamprey
Match: trmt11 (tRNA methyltransferase 11 homolog [Source:ZFIN;Acc:ZDB-GENE-040426-953])

HSP 1 Score: 239.195 bits (609), Expect = 8.512e-74
Identity = 138/381 (36.22%), Postives = 213/381 (55.91%), Query Frame = 3
Query:  216 FLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEM--VLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDP--PYGIRERGRKLMAV-ENRPYMNDNTVPHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIAD 1343
            FL++   S + +R ++ R++  K A  +W +G + + +   +     E   ++   + ++++ I   +K   + E+L+ IE   VL  + ++   + D N   +E     +Y  D        TDP  + +G      QR  ++  Y +  R FIGNTSMD  L+F+M N  RV    L+ DPFVGTG +L+A A  GA V G+DIDY  I GLGK++R +Q WR  +E +R N +QY LE  Y DV V D+SR   I +    FD+ILTDP  PYGIRE  RK+ +  EN    +D    H P    Y +S ++ DLL+ +A+ +  GG L+ W+P+ R  Y  +I +P+H C++++ NCEQ+LN ++ RRLL  +KI D
Sbjct:    2 FLVVLGTSEETIRKVMERTVSAKSAIELWGMGKTHQELLASLKP-QSEHIRQLCHPESSFKITIHTFNKTLQYNERLQRIESLDVLPFNGRVDLKNPDHNFFLLE-----DYGLDPNN---VPTDPLCLYFGRWLVDGQR-DLLRSYSVKTRHFIGNTSMDAGLAFIMANHARVQPGHLVCDPFVGTGSLLVACARFGAFVMGSDIDYNTIHGLGKASRKNQKWRGPDENIRANLRQYGLEQLYADVLVSDASR--PIWRPHQLFDAILTDPTAPYGIRESTRKIGSYGENGKVPDDVADNHIPDSREYHLSDIFVDLLNFAAEYLVNGGRLVYWLPVFRPDYTEEI-VPRHPCLKLVSNCEQMLNSQSGRRLLTMQKIKD 369          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Yeast
Match: TRM11 (Catalytic subunit of adoMet-dependent tRNA methyltransferase complex; required for the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs; contains a THUMP domain and a methyltransferase domain; another complex member is Trm112p [Source:SGD;Acc:S000005484])

HSP 1 Score: 164.851 bits (416), Expect = 6.841e-46
Identity = 137/461 (29.72%), Postives = 215/461 (46.64%), Query Frame = 3
Query:   84 MEFLLVFAGQEFENFREAEFLSLLDISRINFNKSI-LENHDWNKNFLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKI---SSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDNTVP-----------HFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIADTNITSDPVSSGLVNTTEYLRNCYFNS 1421
            M+  L++  Q   NFR AE  SL D+    +N SI    +D N  F I+ LE++   +  I RSIL +  Y  W  GT+++ + + I   S+F  +   K      T++   E     Y    K K +E + ET + L            E+  ++  EY      V    PT I +G     S R   M KY +  R + G TS + +LS +  N+ +V    ++ DPF GTG  L+A  H G+ V G+DID ++I G G               +  NF++Y   + ++DV   D +  +  L+++   D+IL DPPYGIRE  + L A +   ++    +            + P K+ Y + S+ DDLL  S++R+ IGG L  W+P         I +P H  +E+ +NC Q  N + SRRLL Y  I   +  +   + G+  + +  R  YFN+
Sbjct:    1 MKKYLLYMVQVHLNFRRAELESLADL----YNLSIDFSQYDANSPFFIVELENDQQAKDWIKRSILTRGIYEYWGQGTTLDELHKDIQRQSNFEQDLQLKFKHS--TFKFEFEC----YKGNSKAKRVEQI-ETFRYLGFEGKIDMKHPQEVFTVIE-EYTPISENVGGKTPTRIYFGRQVQMSNR-SAMEKYDLKKRPYKGTTSFEAELSLVSANIAQVKPGTIMYDPFAGTGSFLVAGGHFGSLVIGSDIDGRMIRGKGAQVN-----------ISANFKKYGESSQFLDVLTMDFT--NNALRNNLVIDTILCDPPYGIRESIKVLGAKDPERFLGKEDMEIDGEKAYLRRDYIPTKKPYALDSLLDDLLQYSSERLPIGGRLAFWMPTANDANIETI-VPMHENLELKYNCVQEFN-KWSRRLLVY--INRGSTFNGSSNHGIKRSKDNFRERYFNN 431          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Nematostella
Match: EDO46342 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQD1])

HSP 1 Score: 218.009 bits (554), Expect = 2.784e-65
Identity = 149/451 (33.04%), Postives = 239/451 (52.99%), Query Frame = 3
Query:  108 GQEFENFREAEFLSLLDISRINFNKSILENHDWNKN----FLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMN-EEKLTYRLNIEAIHKKYSFEEKLKLIEMV--LETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLG-KSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDNTVPHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKI--ADTNITSDPVSS---GLVNTTEYLRNCYFNS 1421
             QE   FR  E  S+  I  IN +      HD +      FL + + +    + ++ RS+ ++    +W  G+SV+ +   ++ +P +   KM      T+R+NIE  +KK S  +K + I+++  L    ++  N+ +      E  L+L++  D          P  + +G L    QR  ++ K+ +  R FIGNTSMD  LSFLM N G+     LI DPFVGTG IL+A AH G  V G+DID  ++ G G KS+RA+  W+A +E +R NF+Q  LE  ++D  + D+SR   +L+++  FD+I+TDPPYG+RE  RKL A       N++    +P  +  ++S V   LL  ++  + + G L+ W+P+ R  Y+ D  LP H C+ ++ N EQ L    SRRL+   KI    T++T + ++    G  +  +  R+ YF+S
Sbjct:   10 AQEHVKFRIPELHSIASIHGINLS------HDGSSEKISPFLKLKMPNLSCCQQILERSMTVRYILELWGSGSSVDELVRSLNQYPPD---KMELYGNTTFRINIETYNKKISQGQKQEYIKVLSFLPLDGKVNLNNPEH-----EFSLLLDFGDDN---NAATDKPCQLFFGRLIGQGQR-HLLKKFSLKTRHFIGNTSMDPLLSFLMANQGKARPGTLIFDPFVGTGNILLACAHFGGHVIGSDIDKNLVQGRGCKSSRANCKWKARDEVMRTNFRQAGLEQLFVDAIIADASR--SVLRATPIFDAIITDPPYGVREGVRKLKAD------NNSVDTPYPAIKLGRLSDVIISLLHFASCYLTLHGRLVFWLPVHRQSYD-DGLLPLHPCLALVANSEQTLFRHISRRLITMEKIRPHQTDVTLETLTGQNIGFQSMCDRFRDNYFSS 433          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Medaka
Match: trmt11 (tRNA methyltransferase 11 homolog [Source:NCBI gene;Acc:101166247])

HSP 1 Score: 257.299 bits (656), Expect = 2.247e-79
Identity = 143/418 (34.21%), Postives = 233/418 (55.74%), Query Frame = 3
Query:   96 LVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKNFLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDNTV--PHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIAD 1343
            L+    +  +FR  E  +LL +    F+    EN +    F  +   S +DVRS++ RS+  K A+ +W  G +  ++   + ++P +  +    +  TYR+N+   +K   F++++K I+ +          +  ++    +    L  +Y      +   DP +I +G      QR +++  + + NR FIGNTSMD  LS +MTN  +V  N LI DPFVGTG +L+A +H GA V GTDIDY  I G G+S+R +Q WR  +E +R N +QY  E  ++DV V D+S+   + +++  FD+I+TDPPYGIRE  RK  + +    + D T    H P  ++Y +S ++ DLL+ SA  + +GG L+ W+P+ R  Y  D  +P H C+++I NCEQ+L+ +TSRRL+   K+ +
Sbjct:   13 LIHLAHDNVDFRLPEIKALLALRGKPFHP--CENFNEQSPFWCLEGLSEEDVRSVMARSVCAKSAFELWGHGQTDGNLRSSLLNYPPQSMSPFMHKDSTYRINVYTFNKTLQFQDRIKKIDAL-----DYLPFEGTVSLKTPQHIFCLLEDYGTDPNNIP-EDPNYIYFGRWIADGQR-ELIRTHSVKNRHFIGNTSMDAGLSLIMTNHAKVKENDLIFDPFVGTGSLLVACSHFGAYVCGTDIDYNTIHGKGRSSRKNQKWRGPDENIRANLRQYGTEKMFVDVMVSDASK--PVWRNAALFDAIITDPPYGIRESTRKTGSYKENTKLPDCTYVESHVPVSQAYHLSDIFTDLLNFSAHHLVLGGRLVYWLPIYRPEY-CDEMVPVHPCLQIISNCEQMLSSQTSRRLITMEKVKE 418          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Planmine SMEST
Match: SMESG000033819.1 (SMESG000033819.1)

HSP 1 Score: 886.33 bits (2289), Expect = 0.000e+0
Identity = 443/447 (99.11%), Postives = 445/447 (99.55%), Query Frame = 3
Query:   84 MEFLLVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKNFLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDNTVPHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIADTNITSDPVSSGLVNTTEYLRNCYFNSK 1424
            MEFLLVFAGQEFENFREAEFLSLLDISRINFNKSILE+HDWNKNFLIITLES DDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMN+EKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQLPRNDLDLNNPNVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQ SFQFDSILTDPPYGIRERGRKLMAVENRPYMNDNTVPHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIADTNITSDPVSSGLVNTTEYLRNCYFNSK
Sbjct:    1 MEFLLVFAGQEFENFREAEFLSLLDISRINFNKSILESHDWNKNFLIITLESYDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNKEKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQLPRNDLDLNNPNVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQPSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDNTVPHFPQKESYQISSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIADTNITSDPVSSGLVNTTEYLRNCYFNSK 447          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Planmine SMEST
Match: SMESG000033819.1 (SMESG000033819.1)

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 341/348 (97.99%), Postives = 345/348 (99.14%), Query Frame = 3
Query:   84 MEFLLVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKNFLIITLESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEEKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQXXXXXXXXXXXXVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQSSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDNTVPHFPQKESY 1127
            MEFLLVFAGQEFENFREAEFLSLLDISRINFNKSILE+HDWNKNFLIITLES DDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMN+EKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQLPRNDLDLNNPNVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQ SFQFDSILTDPPYGIRERGRKLMAVENRPYMNDNTVPHFPQK ++
Sbjct:    1 MEFLLVFAGQEFENFREAEFLSLLDISRINFNKSILESHDWNKNFLIITLESYDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNKEKLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQLPRNDLDLNNPNVELGLILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNTSMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDYKVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRILQPSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDNTVPHFPQKLTH 348          
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Planmine SMEST
Match: SMESG000033819.1 (SMESG000033819.1)

HSP 1 Score: 186.808 bits (473), Expect = 1.865e-57
Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 3
Query: 1161 MSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIADTNITSDPVSSGLVNTTEYLRNCYFNSK 1424
            MSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIADTNITSDPVSSGLVNTTEYLRNCYFNSK
Sbjct:    1 MSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNCEQVLNERTSRRLLAYRKIADTNITSDPVSSGLVNTTEYLRNCYFNSK 88          
The following BLAST results are available for this feature:
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRMT111.701e-7736.02tRNA methyltransferase 11 homolog [Source:HGNC Sym... [more]
TRMT112.722e-7735.93tRNA methyltransferase 11 homolog [Source:HGNC Sym... [more]
TRMT111.893e-3433.98tRNA methyltransferase 11 homolog [Source:HGNC Sym... [more]
TRMT112.712e-2029.69tRNA methyltransferase 11 homolog [Source:HGNC Sym... [more]
TRMT112.712e-2029.69tRNA methyltransferase 11 homolog [Source:HGNC Sym... [more]
back to top
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y71F9AL.15.612e-6934.37pep chromosome:WBcel235:I:2925212:2928134:1 gene:W... [more]
back to top
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG10746.145e-6332.17gene:FBgn0037250 transcript:FBtr0078925[more]
back to top
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trmt112.124e-7934.44tRNA methyltransferase 11 homolog [Source:ZFIN;Acc... [more]
trmt113.834e-6833.68tRNA methyltransferase 11 homolog [Source:ZFIN;Acc... [more]
back to top
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acp59.398e-8034.74acid phosphatase 5, tartrate resistant [Source:Xen... [more]
acp53.638e-7934.99acid phosphatase 5, tartrate resistant [Source:Xen... [more]
acp55.386e-7635.26acid phosphatase 5, tartrate resistant [Source:Xen... [more]
acp57.951e-7635.26acid phosphatase 5, tartrate resistant [Source:Xen... [more]
acp51.133e-6935.29acid phosphatase 5, tartrate resistant [Source:Xen... [more]
back to top
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Trmt112.800e-7836.12tRNA methyltransferase 11 [Source:MGI Symbol;Acc:M... [more]
Trmt112.415e-1248.44tRNA methyltransferase 11 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R962|TRM11_PONAB1.345e-7736.26tRNA (guanine(10)-N2)-methyltransferase homolog OS... [more]
sp|Q05B63|TRM11_BOVIN1.502e-7735.36tRNA (guanine(10)-N2)-methyltransferase homolog OS... [more]
sp|Q9CWH5|TRM11_MOUSE1.818e-7736.12tRNA (guanine(10)-N2)-methyltransferase homolog OS... [more]
sp|Q6NS23|TRM11_XENLA3.168e-7735.63tRNA (guanine(10)-N2)-methyltransferase homolog OS... [more]
sp|Q7Z4G4|TRM11_HUMAN8.169e-7736.02tRNA (guanine(10)-N2)-methyltransferase homolog OS... [more]
back to top
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3QA547.262e-8332.25tRNA (Guanine(10)-N2)-methyltransferase homolog OS... [more]
A0A5J4NE362.616e-8134.04tRNA (Guanine10-N2)-methyltransferase OS=Paragonim... [more]
A0A504YNM14.838e-8132.38tRNA guanosine-2'-O-methyltransferase TRM11 OS=Fas... [more]
A0A5K4EGK61.034e-8033.90Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A3Q0KI361.869e-8034.42Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trmt111.620e-7133.33tRNA methyltransferase 11 homolog [Source:NCBI gen... [more]
trmt113.318e-7133.33tRNA methyltransferase 11 homolog [Source:NCBI gen... [more]
back to top
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trmt118.512e-7436.22tRNA methyltransferase 11 homolog [Source:ZFIN;Acc... [more]
back to top
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TRM116.841e-4629.72Catalytic subunit of adoMet-dependent tRNA methylt... [more]
back to top
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO463422.784e-6533.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trmt112.247e-7934.21tRNA methyltransferase 11 homolog [Source:NCBI gen... [more]
back to top
BLAST of tRNA (Guanine(10)-N2)-methyltransferase homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000033819.10.000e+099.11SMESG000033819.1[more]
SMESG000033819.10.000e+097.99SMESG000033819.1[more]
SMESG000033819.11.865e-57100.00SMESG000033819.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004729 ID=SMED30004729|Name=tRNA (Guanine(10)-N2)-methyltransferase homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1615bp
GTAAATTTGAACATAATTCATTGTTTAAATATTCATAATTTATTTTCAAA
TTAACATTTTCTAAAAACAATAAGCATAATATTATGGAATTTTTATTAGT
CTTTGCAGGCCAAGAATTTGAAAATTTTAGGGAAGCTGAGTTTTTATCAT
TGTTGGACATTAGCAGAATAAATTTTAACAAATCAATTTTGGAAAATCAT
GATTGGAATAAAAATTTTCTTATTATTACACTTGAATCAAATGACGATGT
TAGAAGCTTAATTAATAGAAGCATTCTAATTAAATGTGCATATAGAGTAT
GGGCTATAGGAACTTCTGTTGAATCAATCTGTGAAAAAATATCTTCTTTT
CCAGACGAATTTACCAATAAAATGAATGAAGAAAAATTAACATACCGGTT
AAATATTGAAGCTATTCACAAAAAATACTCATTTGAAGAAAAGCTTAAAC
TTATTGAAATGGTTCTGGAGACACATAAACAATTACCAAGAAATGATTTG
GACTTGAATAATCCAAATGTTGAGCTGGGATTAATTTTAAACTATGAATA
TGATAAAGCAAAAGGAAAAGTTACACTAACCGATCCAACATTTATCTGTT
ACGGTGAACTTGCATGTTACAGCCAACGGTTGAAAATAATGAGCAAATAC
AAAATGTCTAATCGAAAATTTATTGGAAACACGAGCATGGATGTGAAATT
ATCATTCTTAATGACAAATCTTGGTCGAGTGTCATCGAATCAATTGATTC
TCGATCCATTTGTCGGCACAGGTGGCATTCTTATTGCTGCTGCGCATAAC
GGAGCAAAAGTGTTTGGAACTGATATCGATTATAAAGTGATTTTTGGTCT
TGGTAAATCAACTCGAGCTGATCAAATTTGGCGAGCCGAGGAGGAATGTT
TGCGCCTCAATTTCCAGCAATATAACCTGGAGAATAATTACATGGATGTA
TTTGTTGGGGATTCATCACGACTCGACAGGATACTCCAGTCGTCATTCCA
ATTTGATTCCATATTAACCGATCCACCTTATGGGATTCGAGAGCGCGGAA
GGAAGTTAATGGCTGTTGAAAATCGTCCGTATATGAATGACAATACTGTT
CCACATTTCCCACAGAAAGAATCATATCAGATATCTTCAGTGTATGATGA
TCTGTTGTCTATGTCAGCAAAACGGATAAAAATCGGTGGATATTTGATTA
TGTGGATTCCACTGGTTCGCAGTCTTTATGAAGGTGACATTAGTCTTCCG
AAGCATAGTTGTATGGAAATGATTCACAATTGTGAGCAGGTTCTCAATGA
ACGCACTAGTAGGAGACTGCTAGCTTATCGGAAAATTGCAGATACAAATA
TCACTAGCGATCCGGTTTCATCTGGATTGGTAAACACAACTGAATATCTT
CGAAATTGTTATTTCAATTCCAAATAAATTACACTTCTATCTTTATCCGA
CCTTTGGCGTTTTATGCATTTTAATGTTTGATTGGCTGGTTTGTGTGCGA
TGTGGAGGTTTCAAGTGGACGACTTATTTTTAACTCAAGATGAAGTTTTC
GATTGATTATTCACATGTTTTGTTAAACGACTTGTTTTTTACAATAAATT
TGTTTGTAAAAGATC
back to top

protein sequence of SMED30004729-orf-1

>SMED30004729-orf-1 ID=SMED30004729-orf-1|Name=SMED30004729-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=448bp
MEFLLVFAGQEFENFREAEFLSLLDISRINFNKSILENHDWNKNFLIITL
ESNDDVRSLINRSILIKCAYRVWAIGTSVESICEKISSFPDEFTNKMNEE
KLTYRLNIEAIHKKYSFEEKLKLIEMVLETHKQLPRNDLDLNNPNVELGL
ILNYEYDKAKGKVTLTDPTFICYGELACYSQRLKIMSKYKMSNRKFIGNT
SMDVKLSFLMTNLGRVSSNQLILDPFVGTGGILIAAAHNGAKVFGTDIDY
KVIFGLGKSTRADQIWRAEEECLRLNFQQYNLENNYMDVFVGDSSRLDRI
LQSSFQFDSILTDPPYGIRERGRKLMAVENRPYMNDNTVPHFPQKESYQI
SSVYDDLLSMSAKRIKIGGYLIMWIPLVRSLYEGDISLPKHSCMEMIHNC
EQVLNERTSRRLLAYRKIADTNITSDPVSSGLVNTTEYLRNCYFNSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR029063SAM-dependent_MTases
IPR000241RNA_methylase_dom
IPR002052DNA_methylase_N6_adenine_CS
IPR016691tRNA_mtfrase_TRM11
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0008168methyltransferase activity
GO:0000049tRNA binding
GO:0003723RNA binding
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0032259methylation
GO:0008033tRNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.150coord: 190..383
e-value: 1.8E-26
score: 94.8
NoneNo IPR availablePIRSFPIRSF017259tRNA_Mtase_TRM11coord: 1..436
e-value: 6.2E-106
score: 352.6
NoneNo IPR availablePANTHERPTHR13370:SF3TRNA (GUANINE(10)-N2)-METHYLTRANSFERASE HOMOLOGcoord: 1..422
NoneNo IPR availablePANTHERPTHR13370RNA METHYLASE-RELATEDcoord: 1..422
NoneNo IPR availableCDDcd02440AdoMet_MTasescoord: 222..316
e-value: 1.04982E-4
score: 39.3355
IPR000241Putative RNA methylase domainPFAMPF01170UPF0020coord: 194..319
e-value: 5.7E-11
score: 42.5
IPR002052DNA methylase, N-6 adenine-specific, conserved sitePROSITEPS00092N6_MTASEcoord: 310..316
IPR016691tRNA guanosine-2'-O-methyltransferase, TRM11PROSITEPS51627SAM_MT_TRM11coord: 1..426
score: 82.144
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseSUPERFAMILYSSF53335S-adenosyl-L-methionine-dependent methyltransferasescoord: 118..375