SMED30004725

Overview
NameSMED30004725
Smed IDSMED30004725
Length (bp)7852
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30004725 (SMED30004725) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30004725 (SMED30004725) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30004725 (SMED30004725) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30004725 (SMED30004725) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004725

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30004725SMESG000023005.1 Contig4394uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30004725SMESG000023005.1 Contig4394newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30004725SMESG000038746.1 Contig4394uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30004725SMESG000038746.1 Contig4394newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30004725SMESG000023005.1 dd_Smed_v4_1571_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30004725SMESG000023005.1 dd_Smed_v4_1571_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30004725SMESG000023005.1 dd_Smed_v4_1571_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30004725SMESG000023005.1 dd_Smed_v6_1571_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30004725SMESG000023005.1 dd_Smed_v6_1571_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004725SMESG000023005.1 dd_Smed_v6_1571_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004725SMESG000023005.1 dd_Smed_v4_1571_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30004725SMESG000023005.1 dd_Smed_v4_1571_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30004725SMESG000023005.1 dd_Smed_v4_1571_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30004725SMESG000023005.1 dd_Smed_v4_1571_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30004725 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002725:33589..44329 -39188
Homology
BLAST of SMED30004725 vs. Planmine SMEST
Match: SMESG000023005.1 (SMESG000023005.1)

HSP 1 Score: 4613.14 bits (11964), Expect = 0.000e+0
Identity = 2350/2585 (90.91%), Postives = 2436/2585 (94.24%), Query Frame = 1
Query:    1 DDIGVQCETDEFMIEENNEQNLEASLLIDDLIEENIQYSDESSSVTVLSQKEQKRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTEFDWLPDTSAITLVSKDFNQVARKYSLTDLAEKEIQFELIDDSFLRDEKCKKSKKIQVGFSKLSECSEAECQTGCLMDDTGVQYETDKFIIIDFKEDSLETSLRTDNLIHEEIQYDDEDVKMRLSPQAEHKGKIIQAGFSKLGFDLEASCQTGHLIIDSECQTEFDNNNEIISLSLNYQDFSEESSGKIIKYFDDKEIQFDALCD-SIPKLHPIKSKKIQVGHTRLNDYREVECQSGCIMDDVEVQTEVDEFMIMERKERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEIKGKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEIDNEIDTLTITMHSKDYSE-RLFREPIKYFEKEIQFETTENSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQTEFNEQIIITMNSPDFTDLKIQQKKDFMEKEMQCDSLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDVGVQCDXXXXXXXXXXXXXXXASLFIDDLIDETTQYDDLSLNVRIISQKEYKGKKLQVGSPRLELDSDMSCQVGHLVFDSECQTESFDSISITKYRSDFSEVPTERHLKDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVECQAVCMKDDVGVQNEVDEIMIMTERENHFEERFVLDLMIDETTQYGDEIIVYCSLQKDLKNKKLQVGNSRLDIDSEVSCQTGNFIMDSECQTEVEDSTDMILITHQFQNFEEERKPHVREFVEKEIQSEFLSRYNKPSSSQVIQVGLSKLNEYKEVECQSEFIVFEMGVQTEAKESMIIVGTGRNVDQDLLIYDLIEETVQYNEDVNEAFKKLKGKKLQVGNPYLDSDSEVSCQTGHLLIESECQTELGDEFDTIIKTEHTQDFSEELMERPMKEFVEKEIQFETAKSSLSKYNTLENSKEVQVGQSRLVESREVGCQSEYLMNDIGVETEERECWIMEAKYNQENLSVSYEMIEEIIQYFSDDFTDVPXXXXXXXXXLQAGSSRLLGEMDLLCQTGHLMLDNECQTNKMTTNDIMENFQNELNADESFPTKSLSNQESQYDLCEETVLSCQNQALQVGFPKLHQSQEISCQSTVETVDAVVQSESVLTNEEYQLKKQLCQEVMIEETVQYVPDGFGSISMKPNTKDRAIQNGNSRIQKDIDASYQTEGFTNDSICQTDYSEEENQIDLEIALNQYQANEVVVCNSIEIQSDGLDESLVLEVNREECGVQIGPSRINLCRTIDSQTQFHGEDVGVQGALDEALIIETTQQNVHSKLIFEDLIVEEIQFNCLLPRSSIKKDSKGKKLQVGNSRLLDDSDEFTQTELNDSRNIEDLCIQQVQSFQNTNTISFSDKEVEPLFDEEVEFPTTNVFKSHSVQVGYPRLNACVDFEGQYSFDIDFDGSDHFESSEIEDRVFSKEQFDELIDETVQYSIGMQSSTYPSSVKVNKKLQVGSSRLEVDHDQSCQTXXXXXXXXXXXXXXPNEIQYSNKQTEPDYPMVSEFAMFKSAGVGVGKTDAFQNFDHRSRNVFRHNQSERLISVGTATWDYDKNKYKLLTIDLQYGTELVFKSEKQQTEDQFSPQIKTKSVECFETPIPTVNKSVQVETELTDSVTQTSDYSESHSVSIQISPKVSKFENEAHLILNYFNKQVDIRNDNLTSITTPICDLQPTQFISCDIEKDFRTILCDKMIQYSRRHPIYLDKLTDFQLSTDMVEFDQQHNTKLQMCDRLVSYLARKSTSEACFEYDFFAGKSLTDISMIPSSNTKDFINLFESSAIQQERKSSDIENLSKKKSSNYFDEFPDSLEINLVPKLITIDSKSIKLIDEEVMYEDPRSYIEVTVEHDSSIDASYISNLQCGVNKDDSEANLIESETQMKLESLLDDKTMLKSDKSFIEFSMNHDCNSDNLVDSKIILENTLTEAIEISLIPKLISNQSVRKTESILTEVKIPETKFKPISSVDFIQFDNKMTSTPELVEKSNFGTQIYAQPAYDGQTQTNISSSDFGTQVTDSSSISPLTVSIPLYSTDRQSVLASLGTATHNSIATDAYFEDDYIVECVKSRSIVTKKQEVLPKFSHDFTDIKEEPAKLFVTYQEKTKPKLCDTKTQSYHSDHCKDSCSQTHLELCFRDDELMKVYKKLISSKHLKEQGVQESNADGLFEVLAKTKGLRYILNKYQSACTIHDQSNQTEQLITMNSTRTQYDPENVKSLDVKPTNSMPERLSVTSADHDIAGSMISSFNSRPSHKNKRVQRGCSFFKLKDANTNTDESLDDHIEVTYTETILEESVITKRPLSKMDDHYDFXXXXXXXXXXXXXXXIPVSNQTHRYIQTLLYPSQIFIAEENCDQYLTIIKSYHVTAVYDYSSRKYQSLRDAFRTGIIDLENDKYRQSSTEFISIETALEKGFLIMKHD 7749
            DDIGVQCE +E MI  N EQNLE S LIDDLIEE+ QY  E   VT   QKE K KKLQVG P+L+GDLEVSCQTGHLIIDS+CQTEFD L DT  ITL SKD+ +   +  L +  EKE+QFE I++S+ R  K   S K+QVGF +L E  E ECQ+G +MDD  VQ E  + +++D KE SLE     D+LI+E IQY+              KGK +Q GF +L  +LE SCQTGHLI+DS CQT+ D   +   ++ +  DF+E  + + +K F +KE+Q+    D S+      KSKK+QVGH RLN+  +VECQ+GC+MDD+EVQ +++EFMIME K RNLE +LF +DLI+ESTQ+D  NLN+T A+ KE+KGKKLQVG++RL  D EVSCQTGHLI  SECQTE D ++D +T  ++++D+SE +  R   ++  KEIQFE +++++S   K+NKSKKVQVGH +L+E +EVECQSG +MD+IGVQCE++E MIM +KE+NLEAS LI+DLIEESTQYDDENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQTEFNEQIIITMNSPDFTDLKIQQKKDFMEKEMQCDSLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDVGVQCDINESEIIESRERKIEASLFIDDLIDETTQYDDLSLNVRIISQKEYKGKKLQVGSPRLELDSDMSCQVGHLVFDSECQTESFDSISITKYRSDFSEVPTERHLKDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVECQAVCMKDDVGVQNEVDEIMIMTERENHFEERFVLDLMIDETTQYGDEIIVYCSLQKDLKNKKLQVGNSRLDIDSEVSCQTGNFIMDSECQTEVEDSTDMILITHQFQNFEEERKPHVREFVEKEIQSEFLSRYNKPSSSQVIQVGLSKLNEYKEVECQSEFIVFEMGVQTEAKESMIIVGTGRNVDQDLLIYDLIEETVQYNEDVNEAFKKLKGKKLQVGNPYLDSDSEVSCQTGHLLIESECQTELGDEFDTIIKTEHTQDFSEELMERPMKEFVEKEIQFETAKSSLSKYNTLENSKEVQVGQSRLVESREVGCQSEYLMNDIGVETEERECWIMEAKYNQENLSVSYEMIEEIIQYFSDDFTDVPKKKDQKGKKLQAGSSRLLGEMDLLCQTGHLMLDNECQTNKMTTNDIMENFQNELNADESFPTKSLSNQESQYDLCEETVLSCQNQALQVGFPKLHQSQEISCQSTVETVDAVVQSESVLTNEEYQLKKQLCQEVMIEETVQYVPDGFGSISMKPNTKDRAIQNGNSRIQKDIDASYQTEGFTNDSICQTDYSEEENQIDLEIALNQYQANEVVVCNSIEIQSDGLDESLVLEVNREECGVQIGPSRINLCRTIDSQTQFHGEDVGVQGALDEALIIETTQQNVHSKLIFEDLIVEEIQFNCLLPRSSIKKDSKGKKLQVGNSRLLDDSDEFTQTELNDSRNIEDLCIQQVQSFQNTNTISFSDKEVEPLFDEEVEFPTTNVFKSHSVQVGYPRLNACVDFEGQYSFDIDFDGSDHFESSEIEDRVFSKEQFDELIDETVQYSIGMQSSTYPSSVKVNKKLQVGSSRLEVDHDQSCQTIKEEAEKEIKHALEPNEIQYSNKQTEPDYPMVSEFAMFKSAGVGVGKTDAFQNFDHRSRNVFRHNQSERLISVGTATWDYDKNKYKLLTIDLQYGTELVFKSEKQQTEDQFSPQIKTKSVECFETPIPTVNKSVQVETELTDSVTQTSDYSESHSVSIQISPKVSKFENEAHLILNYFNKQVDIRNDNLTSITTPICDLQPTQFISCDIEKDFRTILCDKMIQYSRRHPIYLDKLTDFQLSTDMVEFDQQHNTKLQMCDRLVSYLARKSTSEACFEYDFFAGKSLTDISMIPSSNTKDFINLFESSAIQQERKSSDIENLSKKKSSNYFDEFPDSLEINLVPKLITIDSKSIKLIDEEVMYEDPRSYIEVTVEHDSSIDASYISNLQCGVNKDDSEANLIESETQMKLESLLDDKTMLKSDKSFIEFSMNHDCNSDNLVDSKIILENTLTEAIEISLIPKLISNQSVRKTESILTEVKIPETKFKPISSVDFIQFDNKMTSTPELVEKSNFGTQIYAQPAYDGQTQTNISSSDFGTQVTDSSSISPLTVSIPLYSTDRQSVLASLGTATHNSIATDAYFEDDYIVECVKSRSIVTKKQEVLPKFSHDFTDIKEEPAKLFVTYQEKTKPKLCDTKTQSYHSDHCKDSCSQTHLELCFRDDELMKVYKKLISSKHLKEQGVQESNADGLFEVLAKTKGLRYILNKYQSACTIHDQSNQTEQLITMNSTRTQYDPENVKSLDVKPTNSMPERLSVTSADHDIAGSMISSFNSRPSHKNKRVQRGCSFFKLKDANTNTDESLDDHIEVTYTETILEESVITKRPLSKMDDHYDFSKSSSLTRRSASSTSIPVSNQTHRYIQTLLYPSQIFIAEENCDQYLTIIKSYHVTAVYDYSSRKYQSLRDAFRTGIIDLENDKYRQSSTEFISIETALEKGFLIMKHD
Sbjct: 4070 DDIGVQCEVNEIMIMGNKEQNLEVSRLIDDLIEESTQYDGEVIIVTNAMQKEVKGKKLQVGTPKLEGDLEVSCQTGHLIIDSECQTEFDDLTDTVIITLNSKDYGE-KNENPLKEYLEKEMQFEPIEESYTRLVKTYASMKVQVGFPRLDENREVECQSGSIMDDVEVQTEVVEVMMLDNKERSLEFGFLFDDLINESIQYN-----------VAVKGKKLQIGFPRLDGELEVSCQTGHLILDSHCQTDLDELTDTFIITNHLPDFTERLNREFLKEFAEKEVQYGDFDDYSLIHDEANKSKKVQVGHPRLNESLDVECQTGCLMDDIEVQCKLEEFMIMENKVRNLEANLFIEDLIEESTQYDEGNLNITTAIHKEVKGKKLQVGTSRLDSDLEVSCQTGHLITESECQTEFDEKVDEITFLLNAQDFSEEKPKRSVFEFVNKEIQFEASDDTHSISDKSNKSKKVQVGHAKLHEGVEVECQSGYMMDEIGVQCELDEFMIMENKERNLEASLLIEDLIEESTQYDDENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQTEFNEQIIITMNSPDFTDLKIQQKKDFMEKEMQCDSLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDVGVQCDINESEIIESRERKIEASLFIDDLIDETTQYDDLSLNVRIISQKEYKGKKLQVGSPRLELDSDMSCQVGHLVFDSECQTESFDSISITKYRSDFSEVPTERHLKDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVECQAVCMKDDVGVQNEVDEIMIMTERENHFEERFVLDLMIDETTQYGDEIIVYCSLQKDLKNKKLQVGNSRLDIDSEVSCQTGNFIMDSECQTEVEDSTDMILITHQFQNFEEERKPHVREFVEKEIQSEFLSRYNKPSSSQVIQVGLSKLNEYKEVECQSEFIVFEMGVQTEAKESMIIVGTGRNVDQDLLIYDLIEETVQYNEDVNEAFKKLKGKKLQVGNPYLDSDSEVSCQTGHLLIESECQTELGDEFDTIIKTEHTQDFSEELMERPMKEFVEKEIQFETAKSSLSKYNTLENSKEVQVGQSRLVESREVGCQSEYLMNDIGVETEERECWIMEAKYNQENLSVSYEMIEEIIQYFSDDFTDVPKKKDQKGKKLQAGSSRLLGEMDLLCQTGHLMLDNECQTNKMTTNDIMENFQNELNADESFPTKSLSNQESQYDLCEETVLSCQNQALQVGFPKLHQSQEISCQSTVETVDAVVQSESVLTNEEYQLKKQLCQEVMIEETVQYVPDGFGSISMKPNTKDRAIQNGNSRIQKDIDASYQTEGFTNDSICQTDYSEEENQIDLEIALNQYQANEVVVCNSIEIQSDGLDESLVLEVNREECGVQIGPSRINLCRTIDSQTQFHGEDVGVQGALDEALIIETTQQNVHSKLIFEDLIVEEIQFNCLLPRSSIKKDSKGKKLQVGNSRLLDDSDEFTQTELNDSRNIEDLCIQQVQSFQNTNTISFSDKEVEPLFDEEVEFPTTNVFKSHSVQVGYPRLNACVDFEGQYSFDIDFDGSDHFESSEIEDRVFSKEQFDELIDETVQYSIGMQSSTYPSSVKVNKKLQVGSSRLEVDHDQSCQTIKEEAEKEIKHALEPNEIQYSNKQTEPDYPMVSEFAMFKSAGVGVGKTDAFQNFDHRSRNVFRHNQSERLISVGTATWDYDKNKYKLLTIDLQYGTELVFKSEKQQTEDQFSPQIKTKSVECFETPIPTVNKSVQVETELTDSVTQTSDYSESHSVSIQISPKVSKFENEAHLILNYFNKQVDIRNDNLTSITTPICDLQPTQFISCDIEKDFRTILCDKMIQYSRRHPIYLDKLTDFQLSTDMVEFDQQHNTKLQMCDRLVSYLARKSTSEACFEYDFFAGKSLTDISMIPSSNTKDFINLFESSAIQQERKSSDIENLSKKKSSNYFDEFPDSLEINLVPKLITIDSKSIKLIDEEVMYEDPRSYIEVTVEHDSSIDASYISNLQCGVNKDDSEANLIESETQMKLESLLDDKTMLKSDKSFIEFSMNHDCNSDNLVDSKIILENTLTEAIEISLIPKLISNQSVRKTESILTEVKIPETKFKPISSVDFIQFDNKMTSTPELVEKSNFGTQIYAQPAYDGQTQTNISSSDFGTQVTDSSSISPLTVSIPLYSTDRQSVLASLGTATHNSIATDAYFEDDYIVECVKSRSIVTKKQEVLPKFSHDFTDIKEEPAKLFVTYQEKTKPKLCDTKTQSYHSDHCKDSCSQTHLELCFRDDELMKVYKKLISSKHLKEQGVQESNADGLFEVLAKTKGLRYILNKYQSACTIHDQSNQTEQLITMNSTRTQYDPENVKSLDVKPTNSMPERLSVTSADHDIAGSMISSFNSRPSHKNKRVQRGCSFFKLKDANTNTDESLDDHIEVTYTETILEESVITKRPLSKMDDHYDFSKSSSLTRRSASSTSIPVSNQTHRYIQTLLYPSQIFIAEENCDQYLTIIKSYHVTAVYDYSSRKYQSLRDAFRTGIIDLENDKYRQSSTEFISIETALEKGFLIMKHD 6642          

HSP 2 Score: 1719.13 bits (4451), Expect = 0.000e+0
Identity = 1010/1709 (59.10%), Postives = 1220/1709 (71.39%), Query Frame = 1
Query:    1 DDIGVQCETDEFMIEENNEQNLEASLLIDDLIEENIQYSDESSSVTVLSQKEQKRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTEFDWLPDTSAITLVSKDFNQVARKYSLTDLAEKEIQFELIDDSFLRDEKCKKSKKIQVGFSKLSECSEAECQTGCLMDDTGVQYETDKFIIIDFKEDSLETSLRTDNLIHEEIQYDDEDVKMRLSPQAEHKGKIIQAGFSKLGFDLEASCQTGHLIIDSECQTEFDNNNEIISLSLNYQDFSEESSGKIIKYFDDKEIQFDALCDSIPKLHPIKSKKIQVGHTRLNDYREVECQSGCIMDDVEVQTEVDEFMIMERKERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEIKGKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEIDNEIDTLTITMHSKDYSERLFREPIKYFEKEIQFETTENSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQTEFN---EQIIITMNSPDFTDLKIQQKKDFMEKEMQCDSLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDVGVQCDXXXXXXXXXXXXXXXASLFIDDLIDETTQYDDLSLNVRIISQKEYKGKKLQVGSPRLELDSDMSCQVGHLVFDSECQTE---SFDSISITKYRSDFSEVPTERHLKDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVECQAVCMKDDVGVQNEVDEIMIMTERENHFEERFVLDLMIDETTQYGDE-IIVYCSLQKDLKNKKLQVGNSRLDIDSEVSCQTGNFIMDSECQTEVEDSTDMILITHQFQNFEEERKPHVREFVEKEIQSEF----LSRYNKPSSSQVIQVGLSKLNEYKEVECQSEFIVFEMGVQTEAKESMIIVGTGRNVDQDLLIYDLIEETVQYNEDVN-----EAFKKLKGKKLQVGNPYLDSDSEVSCQTGHLLIESECQTELGDEFDTIIKTEHTQDFS-EELMERPMKEFVEKEIQFETAKSSLSKYNTLENSKEVQVGQSRLVESREVGCQSEYLMNDIGVETEERECWIMEAKYNQENLSVSY---EMIEEIIQYFSDDFTDV-PXXXXXXXXXLQAGSSRLLGEMDLLCQTGHLMLDNECQT--NKMTTNDIMENFQNELNADESFPTKSLSNQESQYDLCEET----VLSCQNQALQVGFPKLHQSQEISCQSTVETVDAVVQSES----VLTNEEYQLKKQLCQEVMIEETVQYVPDGFGSISMKPNTKDRAIQNGNSRIQKDIDASYQTEGFTNDSICQTDYSEEENQI-------DLEIALNQYQANEVVVCNSIEIQSDGLDE-SLVLEVNREECGVQIGPSRINLCRTIDSQTQFHGEDVGVQGALDEALIIETTQQNVHSKLIFEDLIVEEIQFN--CLLPRSSIKKDSKGKKLQVGNSRLLDD-----------SDEFTQTELNDSRNIEDLCIQQVQSFQ----NTNTISFSDKEVEPLFDEEVEFPTTNVFKSHSVQVGYPRLNACVDFEGQYSFDIDFDGS----DHFESSEIEDRVFSKEQF-DELIDETVQY---SIGMQSSTYPSSVKVNKKLQVGSSRLEVDHDQSCQT 4935
            DDIGVQCETDEFMIEENNEQNLEASLLIDDLIEENIQYSDESSSVTVLSQKEQKRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTEFDWLPDTSAITLVSKDFNQVARKYSLTDLAEKEIQFELIDDSFLRDEKCKKSKKIQVGFSKLSECSEAECQTGCLMDDTGVQYETDKFIIIDFKEDSLETSLRTDNLIHEEIQYDDEDVKMRLSPQAEHKGKIIQAGFSKLGFDLEASCQTGHLIIDSECQTEFDNNNEIISLSLNYQDFSEESSGKIIKYFDDKEIQFDALCDSIPKLHPIKSKKIQVGHTRLNDYREVECQSGCIMDDVEVQTEVDEFMIMERKERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEIKGKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEIDNEIDTLTITMHSKDYSERLFREPIKYFEKEIQFETTENSYSEHVKA+KSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDE + VT ++ KE KGKKLQVG SKL+ DLEVSCQTG LI++SECQTEF+   + + IT+NS DF + K    K+++EKE+Q ++ ++S  +  K  KS KVQ+G  R+NE  EVECQSGC+MDD+GVQC++ E  I+E +ER +E SLF DDLIDE+TQ+D  +LNV +   KE KGKKLQVGS RL  D ++SCQ GHL+ +SECQTE     D+++IT +  D+SE      +K F EKEIQFE  E+  S       SK VQVG  RL E  +VECQ+ C+ DD+GVQ EV+EIMIM  +E + E   ++D +I+E+TQY DE IIV  ++QK++K KKLQVG S+L+ D EVSCQTG+ I+DSECQTE +D +D + IT   ++F E ++  ++E++EKEIQ E      S + K + S+ +QVG  +LNE  EVECQS  ++ ++GVQ E  E MI+    RN++  L + DLI+E  QY+ D N      A K +KGKKLQVG P LD+D EVSCQTGHL+++S  QT++ D  D II T   +DFS E+ + +  K   +KEIQFET + S S++     SK+VQVG  RL E+ EV CQS  LM+DIGV+ E  E  IM  K  ++NL VS    ++IEE  QY  +        +K+ KGKKLQ G+ +L G++++ CQTGHL++D+ECQT  + +T   I+     +       P K    +E Q++  EE+    V +  +  +QVGFP+L +++E+ CQS     D  VQ+E     +L N+E  L+     + +I E++QY              K + +Q G  R+  +++ S QT     DS CQTD  E  +         D    LN+    E       E+Q    D+ SL+ +   +   VQ+G  R+N    ++ QT    +D+ VQ  L+E +I+E   +N+ + L  EDLI E  Q++   L   ++I K+ KGKKLQVG SRL  D           ++   QTE  D +  E   +   Q F       +   F +KE++    ++    +    KS  VQVG+ +L+  V+ E Q  + +D  G     D F   E ++R        ++LI+E+ QY   ++ +  S    +    KKLQVG S+L+ D + SCQT
Sbjct: 2933 DDIGVQCETDEFMIEENNEQNLEASLLIDDLIEENIQYSDESSSVTVLSQKEQKRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTEFDWLPDTSAITLVSKDFNQVARKYSLTDLAEKEIQFELIDDSFLRDEKCKKSKKIQVGFSKLSECSEAECQTGCLMDDTGVQYETDKFIIIDFKEDSLETSLRTDNLIHEEIQYDDEDVKMRLSPQAEHKGKIIQAGFSKLGFDLEASCQTGHLIIDSECQTEFDNNNEIISLSLNYQDFSEESSGKIIKYFDDKEIQFDALCDSIPKLHPIKSKKIQVGHTRLNDYREVECQSGCIMDDVEVQTEVDEFMIMERKERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEIKGKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEIDNEIDTLTITMHSKDYSERLFREPIKYFEKEIQFETTENSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDEVIIVTNAMQKEVKGKKLQVGTSKLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVEEFMIMERKERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEIKGKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEIDNEIDTLTITMHSKDYSERLFREPIKYF-EKEIQFETTENSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDEVIIVTNAMQKEVKGKKLQVGTSKLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVDEFMIMETKERNLEASLFVEDLIDEATQYD-DKNLHFTIAAHKDVKGKKLQVGTPRLDADPEVSCQTGHLIMDSGDQTDIDDIKDKIIITAQPRDFSVEDKLFQEKKIVFDKEIQFETTEDSYSEHGKSSKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGNK--EQNLEVSRLIDDLIEESTQYDGEVIIVTNAMQKEVKGKKLQVGTPKLEGDLEVSCQTGHLIIDSECQTEFDDLTDTVIITLNSKDYGEKNENPLKEYLEKEMQFEPIEESYTRLVKTYASMKVQVGFPRLDENREVECQSGSIMDDVEVQTEVVEVMMLDNKERSLEFGFLFDDLINESIQY----------NVAVKGKKLQIGFPRLDGELEVSCQTGHLILDSHCQTDLDELTDTFIITNHLPDFTERLNREFLKEFA---EKEVQYGDFDDYSLIHDEANKSKKVQVGHPRLNESLDVECQTGCLMDDIEVQCKLEEFMIMENKVRNLEANLFIEDLIEESTQYDEGNLNITTAIHKEVKGKKLQVGTSRLDSDLEVSCQTGHLITESECQTEF-DEKVDEITFLLNAQDFSEEKPKRSVFEFVNKEIQFEASDDTHSISDKSNKSKKVQVGHAKLHEGVEVECQSGYMMDEIGVQCELDEFMIMENKERNLEASLLIEDLIEESTQYDDENLNVTISVLKET--KGKKLQVGCSKLDEDLEVSCQT 4621          

HSP 3 Score: 1185.63 bits (3066), Expect = 0.000e+0
Identity = 771/1715 (44.96%), Postives = 1073/1715 (62.57%), Query Frame = 1
Query:    1 DDIGVQCETDEFMIEENNEQNLEASLLIDDLIEENIQYSDESSSVTVLSQKEQKRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTEFDWLPDTSAITLVSKDFNQVARKYSLTDLAEKEIQFELIDDSFLRDEKCKKSKKIQVGFSKLSECSEAECQTGCLMDDTGVQYETDKFIIIDFKEDSLETSLRTDNLIHEEIQYDDEDVKMRLSPQAEHKGKIIQAGFSKLGFDLEASCQTGHLIIDSECQTEFDNNNEIISLSLNYQDFSEESSGKIIKYFDDKEIQFDALCDSIPKLHPI-KSKKIQVGHTRLNDYREVECQSGCIMDDVEVQTEVDEFMIMERKERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEIKGKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEIDNEIDTLTITMHSKDYSERLFREPIKYFEKEIQFETTENSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQTEFN---EQIIITMNSPDFTDLKIQQK-KDFMEKEMQCDSLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDVGVQCDXXXXXXXXXXXXXXXASLFIDDLIDETTQYDDLSLNVRIISQKEYKGKKLQVGSPRLELDSDMSCQVGHLVFDSECQTESFDS----ISITKYRSDFSEVPTERHLKDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVECQAVCMKDDVGVQNEVDEIMIMTERENHFEERFVLDLMIDETTQY-GDEIIVYCSLQKDLKNKKLQVGNSRLDIDSEVSCQTGNFIMDSECQTEVEDSTDMILITHQFQNFEEERKPHVREFVEKEIQSEF----LSRYNKPSSSQVIQVGLSKLNEYKEVECQSEFIVFEMGVQTEAKESMIIVGTGRNVDQDLLIYDLIEETVQYNEDV----NEAFKKLKGKKLQVGNPYLDSDSEVSCQTGHLLIESECQTELGDEFDTIIKTEHTQDFSEELMERPMKEFVEKEIQFETAKSSLSKYNTLENSKEVQVGQSRLVESREVGCQSEYLMNDIGVETEERECWIMEAKYNQENLSVSY---EMIEEIIQYFSDDF-TDVPXXXXXXXXXLQAGSSRLLGEMDLLCQTGHLMLDNECQT---NKMTTNDIMENFQNELNADESFPTKSLSNQESQYDLCE----ETVLSCQNQALQVGFPKLHQSQEISCQSTVETVDAVVQSE----SVLTNEEYQLKKQLCQEVMIEETVQYVPDG-FGSISMKPNTKDRAIQNGNSRIQKDIDASYQTEGFTNDSICQTDYSEEENQIDL-----------EIALNQYQANEVVVCNSIEIQSDGLDESLVLEVNREECGVQIGPSRINLCRTIDSQTQFHGEDVGVQGALDEALIIETTQQNVHSKLIFEDLIVEEIQFN--CLLPRSSIKKDSKGKKLQVGNSRLLDDSDEFTQTE--LNDSRNIEDLCIQQVQSFQNTNTISFS--DK---EVEPLFDEEVEFPTT--------NVFKSHSVQVGYPRLNACVDFEGQYSFDIDFDGSDHFESSEI------EDRVFSKEQFDELIDETVQY--SIGMQSSTYPSSVKVNKKLQVGSSRLEVDHDQSCQT 4935
            DDIGVQCE DEFMIEEN EQNLEAS  I+DLI+E  QY DE   +T++S K+  ++                  T HL+IDS+ QT+ +   D    T  SK F++      + D  +KEIQ E  DDS     K  KSKK+QVG  +L+E  + ECQ+GC+MDD GVQ E D+F+I + KE +LE SL  ++LI E  QYDDE VK+ ++ Q E KGK +Q G  +L  D E SCQTG +I DSECQT+ +++ E ++++++ +DFSE+   + +K + +KEIQ +    SI + +   KSKK+QVGH RLN+  +VECQSGCIMDD+ VQ EVDEFMI ERKE+NLEE LF +DLI+E+TQ+D ENLNVT+    E KGKKLQVG  RL  DFEVSCQTGHLI++SECQTEIDNEIDTLTITMHSKD+SE+LF+EP  Y EKEIQFET E S S+ VK  KSKK+QVGHPRLN++LE ECQSGC+MDDIGVQCE +E MI  + EQNLEAS LIDDLIEE+ QY DE+ +VT+   KE K KKLQVG  +LD DLEVSCQTG LI++S+CQTEF+   +   IT+ S DF  +  +    D  EKE+Q + +D+S L++ K  KS K+Q+G ++++EC E ECQ+GC+MDD GVQ + ++  II+ +E  +E SL  D+LI E  QYDD  + +R+  Q E+KGK +Q G  +L  D + SCQ GHL+ DSECQTE FD+    IS++    DFSE  + + +K F +KEIQF+ L D    ++ +K SK +QVG  RL + R+VECQ+ C+ DDV VQ EVDE MIM  +E + EE    D +IDE+TQ+ G+ + V  ++ K++K KKLQVG++RL  D EVSCQTG+ IM+SECQTE+++  D + IT   +++ E       ++ EKEIQ E      S + K S S+ +QVG  +LNE  EVECQS  ++ ++GVQ E  E MI+    +N++   LI DLIEE+ QY+++V    N   K++KGKKLQVG   L+ D EVSCQTGHL+I+SECQTE  D  DT+  T +++DF E   E  +KE++EKEIQFET + S S++     SK+VQVG  RL E+ EV CQS  LM+DIGV+ E  E  IME K  + NL  S    ++I+E  Q+  ++    V   K+ KGKKLQ GS+RL  + ++ CQTGHL++++ECQT   N++ T  I  + ++        P K    +E Q++  E    E V + +++ +QVG P+L+++ E+ CQS     D  VQ E     ++ ++E  L+     + +IEE+ QY  +    + +M+   K + +Q G S+++ D++ S QT     DS CQT++ +  + + +           E +L +Y   E+      E   D   E +    +++   VQ+G  R+N    ++ Q+    +D+GVQ  +DE +I+ET ++N+ + L  EDLI E  Q++   L    +  KD KGKKLQVG  RL  D +   QT   + DS +  D+   + +         FS  DK   E + +FD+E++F TT           KS  VQVG+PRLN  ++ E Q    +D D     E +EI      E  +      D+LI+E+ QY   + + ++     VK  KKLQVG+ +LE D + SCQT
Sbjct: 2462 DDIGVQCEVDEFMIEENKEQNLEASQFIEDLIDEATQYDDEPVKLTIVSNKKDWKEI-----------------TRHLVIDSESQTQLEEPNDKLTTTTYSKVFSEEILIGPIKDYFDKEIQCETTDDSISEHNKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASLFIEDLIDEATQYDDEPVKVIINSQREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSVETLTITMHSKDFSEKLFKEPMKEYYEKEIQCETPNYSISEHNKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEERKEKNLEERLFVEDLIEEATQYDEENLNVTIGAQIETKGKKLQVGIPRLDVDFEVSCQTGHLIIDSECQTEIDNEIDTLTITMHSKDFSEKLFKEPKNYLEKEIQFETAEVSDSQLVKTKKSKKIQVGHPRLNKSLEGECQSGCIMDDIGVQCETDEFMIEENNEQNLEASLLIDDLIEENIQYSDESSSVTVLSQKEQKRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTEFDWLPDTSAITLVSKDFNQVARKYSLTDLAEKEIQFELIDDSFLRDEKCKKSKKIQVGFSKLSECSEAECQTGCLMDDTGVQYETDKFIIIDFKEDSLETSLRTDNLIHEEIQYDDEDVKMRLSPQAEHKGKIIQAGFSKLGFDLEASCQTGHLIIDSECQTE-FDNNNEIISLSLNYQDFSEESSGKIIKYFDDKEIQFDALCDSIPKLHPIK-SKKIQVGHTRLNDYREVECQSGCIMDDVEVQTEVDEFMIMERKERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEIKGKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEIDNEIDTLTITMHSKDYSERLFREPIKYFEKEIQFETTENSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDEVIIVTNAMQKEVKGKKLQVGTSKLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGEN-KEDSLKEYLEKEIQFETTEDSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVEEFMIMERK--ERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEIKGKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEIDNEIDTLTITMHSKDYSERLFREPIKYFE-KEIQFETTENSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDEVIIVTNAMQKEVKGKKLQVGTSKLEGDLEVSCQTGHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEI----QFETTEDSYSEHVKANKSKK---VQVGHPRLNENLEVECQSGCLMDDIGVQCEVDEFMIMETKERNLEASLFVEDLIDEATQYDDKNLHFTIAAHKDVKGKKLQVGTPRLDADPEVSCQTGHLIMDSGDQTDIDDIKDKIIITAQPRDFSVEDKLFQEKKIVFDKEIQFETTEDSYSEHGKSSKSKKVQVGHPRLNENLEVECQSGCLMD-DIGVQCEVNEIMIMGNKEQNLEVSRLIDDLIEESTQYDGEVIIVTNAMQKEVK-GKKLQVGTPKLEGDLEVSCQT 4144          

HSP 4 Score: 1161.75 bits (3004), Expect = 0.000e+0
Identity = 756/1708 (44.26%), Postives = 1070/1708 (62.65%), Query Frame = 1
Query:    1 DDIGVQCETDEFMIEENNEQNLEASLLIDDLIEENIQYSDESSSVTVLSQKEQKRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTEFDWLPDTSAITLVSKDFNQVARKYSLTDLAEKEIQFELIDDSFLRDEKCKKSKKIQVGFSKLSECSEAECQTGCLMDDTGVQYETDKFIIIDFKEDSLETSLRTDNLIHEEIQYDDEDVKMRLSPQAEHKGKIIQAGFSKLGFDLEASCQTGHLIIDSECQTEFDNNNEIISLSLNYQDFSEESSGKIIKYFDDKEIQFDALCDSIPKLHPI-KSKKIQVGHTRLNDYREVECQSGCIMDDVEVQTEVDEFMIMERKERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEIKGKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEIDNEIDTLTITMHSKDYSERLFREPIK-YFEKEIQFETTENSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQTEF---NEQIIITMNSPDFT-DLKIQQKKDFMEKEMQCDSLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDVGVQCDXXXXXXXXXXXXXXXASLFIDDLIDETTQYDDLSLNVRIISQKEYKGKKLQVGSPRLELDSDMSCQVGHLVFDSECQT---ESFDSISITKYRSDFSEVPTERHLKDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVECQAVCMKDDVGVQNEVDEIMIMTERENHFEERFVLDLMIDETTQYGDE-IIVYCSLQKDLKNKKLQVGNSRLDIDSEVSCQTGNFIMDSECQTEVEDSTDMILITHQFQNFEEERKPHVREFVEKEIQSEFL----SRYNKPSSSQVIQVGLSKLNEYKEVECQSEFIVFEMGVQTEAKESMIIVGTGRNVDQDLLIYDLIEETVQYNEDVNEAF----KKLKGKKLQVGNPYLDSDSEVSCQTGHLLIESECQTELGDEFDTIIKTEHTQDFSEELMERPMKEFVEKEIQFETAKSSLSKYNTLENSKEVQVGQSRLVESREVGCQSEYLMNDIGVETEERECWIMEAKYNQENLSVSYE-MIEEIIQYFSDDF-TDVPXXXXXXXXXLQAGSSRLLGEMDLLCQTGHLMLDNECQTNKMTTNDIME---NFQNELNADESFPTKSLSNQESQYD-LCEET--VLSCQNQALQVGFPKLHQSQEISCQSTVETVDAVVQSE----SVLTNEEYQLKKQLCQEVMIEETVQYVPDGFG-SISMKPNTKDRAIQNGNSRIQKDIDASYQTEGFTNDSICQTDYSEEENQID-LEIALNQYQANEVVVCNSI-----EIQSDGLDESLVLEVNREEC-GVQIGPSRINLCRTIDSQTQFHGEDVGVQGALDEALIIETTQQNVHSKLIFEDLIVEEIQFN--CLLPRSSIKKDSKGKKLQVGNSRLLDDSDEFTQTELNDSRNIEDLCIQQVQSFQNTNTISFSDKE--------VEPLFDEEVEFPTT--------NVFKSHSVQVGYPRLNACVDFEGQYSFDIDFDG----SDHFESSEIEDRVFSKEQ-FDELIDETVQYSIGMQSST--YPSSVKVNKKLQVGSSRLEVDHDQSCQT 4935
            DDIGVQCE DEFMIEEN EQNLEASL I+DLI+E  QY DE     + S +EQK KKLQVG PRLDGD EVSCQTG +I DS+CQT+ +   +T  IT+ SKDF++   K  + +  EKEIQ E  DDS     K  KSKK+QVG  +L+E  + ECQ+GC+MDD GVQ E D+F+I + KE +LE S   ++LI E  QYDDE VK+ +  Q +  GK +Q G SK+  DLE SCQTGHL+IDSE QT+ +  N+ ++ +   + FSEE     IK + DKEIQ +   DSI + +   KSKK+QVGH RLN+  +VECQSG IMDD+ VQ EVDEFMI E KE+NLE SLF +DLIDE+TQ+D E +   +   +E KGKKLQVG  RL  DFEVSCQTG +I +SECQT++++ ++TL ITMHSKD+SE+LF+EP+K Y+EKEIQ ET ++S S+ +KANKSKKVQVGHPRLNE L+VECQSGC+MDDIGVQCEV+E MI  +KEQNLEAS+ I+DLI+E+TQYDDE + +TI V  +   K++                T  L+++SE QT+    N+++  T  S  F+ ++ I   KD+ +KE+QC++ D+S+ + NK  KS KVQ+G  R+NE  +VECQSGC+MDD+GVQC+++E  I E++E+ +EASLFI+DLIDE TQYDD  + V I SQ+E KGKKLQVG PRL+ D ++SCQ G ++ DSECQT   +S ++++IT +  DFSE   +  +K++ EKEIQ E      S  N    SK VQVG  RL E  DVECQ+ C+ DD+GVQ EVDE MI   +E + EER  ++ +I+E TQY +E + V    Q + K KKLQVG  RLD+D EVSCQTG+ I+DSECQTE+++  D + IT   ++F E+     + ++EKEIQ E      S+  K   S+ IQVG  +LN+  E ECQS  I+ ++GVQ E  E MI     +N++  LLI DLIEE +QY+++ +       K+ K KKLQVGNP LD D EVSCQTGHL+I+S+CQTE     DT   T  ++DF++   +  + +  EKEIQFE    S  +    + SK++QVG S+L E  E  CQ+  LM+D GV+ E  +  I++ K +    S+  + +I E IQY  +D    +  + + KGK +QAG S+L  +++  CQTGHL++D+ECQT     N+I+    N+Q+          K   ++E Q+D LC+    +   +++ +QVG  +L+  +E+ CQS     D  VQ+E     ++  +E  L++ L  + +I+E+ Q+  +    ++++    K + +Q G++R+  D + S QT     +S CQT   E +N+ID L I ++    +E +    I     EIQ +  + S    V   +   VQ+G  R+N    ++ Q+    +D+GVQ  ++E +I+ + +QN+ +  + +DLI E  Q++   ++  ++++K+ KGKKLQVG S+L  D +   QT       I+  C  +     +T TI+ + K+        ++   ++E++F TT           KS  VQVG+PRLN  ++ E Q    +D  G     + F   E ++R   +   FD+LIDE+ Q+     + T   P  +K  KKLQVGS+RL  D + SCQT
Sbjct: 1973 DDIGVQCEVDEFMIEENKEQNLEASLFIEDLIDEATQYDDEPVKGIINSLREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSVETLMITMHSKDFSEKLFKEPMKEYYEKEIQCETPDDSTSDQIKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASQFIEDLIDEATQYDDEPVKLTIVSQTKKIGKKLQVGISKMNGDLEVSCQTGHLVIDSESQTQLEEPNDKLTTTTYSKVFSEEILIGPIKDYFDKEIQCETTDDSISEHNKANKSKKVQVGHPRLNEILDVECQSGYIMDDIGVQCEVDEFMIEENKEQNLEASLFIEDLIDEATQYDDEPVKGIINSLREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSVETLMITMHSKDFSEKLFKEPMKEYYEKEIQCETPDDSTSDQIKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASQFIEDLIDEATQYDDEPVKLTI-VSNKKDWKEI----------------TRHLVIDSESQTQLEEPNDKLTTTTYSKVFSEEILIGPIKDYFDKEIQCETTDDSISEHNKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASLFIEDLIDEATQYDDEPVKVIINSQREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSVETLTITMHSKDFSEKLFKEPMKEYYEKEIQCETPNYSISEHNKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEERKEKNLEERLFVEDLIEEATQYDEENLNVTIGAQIETKGKKLQVGIPRLDVDFEVSCQTGHLIIDSECQTEIDNEIDTLTITMHSKDFSEKLFKEPKNYLEKEIQFETAEVSDSQLVKTKKSKKIQVGHPRLNKSLEGECQSGCIMDDIGVQCETDEFMIEENNEQNLEASLLIDDLIEENIQYSDESSSVTVLSQKEQKRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTEFDWLPDTSAITLVSKDFNQVARKYSLTDLAEKEIQFELIDDSFLRDEKCKKSKKIQVGFSKLSECSEAECQTGCLMDDTGVQYETDKFIIIDFKEDSLETSLRTDNLIHEEIQYDDEDVKMRLSPQAEHKGKIIQAGFSKLGFDLEASCQTGHLIIDSECQTEFDNNNEIISLSLNYQDFSEESSGKIIKYFDDKEIQFDALCDSIPKLHPIKSKKIQVGHTRLNDYREVECQSGCIMDDVEVQTEVDEFMIMERKERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEIKGKKLQVGSARLYDDFEVSCQTGHLIMNSECQT---EIDNEIDTLTITMHSKDYSERLFREPIKYFEKEIQFETTENSYSEHVKASKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDEVIIVTNAMQKEVKGKKLQVGTSKLEGDLEVSCQT---GHLIIDSECQTEFDDLSDTVTITLNSKDFGENKEDSLKEYLEKEIQFETTEDSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVEEFMIMERKERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEIK-GKKLQVGSARLYDDFEVSCQT 3656          

HSP 5 Score: 992.645 bits (2565), Expect = 0.000e+0
Identity = 709/1738 (40.79%), Postives = 1032/1738 (59.38%), Query Frame = 1
Query:    1 DDIGVQCETDEFMIEENNEQNLEASLLIDDLIEENIQYSDESSSVTVLSQKEQKRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTEFDWLPDT--SAITLVSKDFNQVARKYSLTDLAEKEIQFELID--DSFLRDEKCKKSKKIQVGFSKLSECSEAECQTGCLMDDTGVQYETDKFIIIDFKEDSLETSLRTDNLIHEEIQYDDEDVKMRLSPQAEHKGKIIQAGFSKLGFDLEASCQTGHLIIDSECQTEFDN--NNEIISLSLNYQDFSEESSGKIIKYFDDKEIQFDALCD-SIPKLHPIKSKKIQVGHTRLNDYREVECQSGCIMDDVEVQTEVDEFMIMERKERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEIKGKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEIDNEIDTLTITMHSKDYSERLFREPIK-YFEKEIQFETTENSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQTEF---NEQIIITMNSPDFT-DLKIQQKKDFMEKEMQCDSLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDVGVQCDXXXXXXXXXXXXXXXASLFIDDLIDETTQYDDLSLNVRIISQKEYKGKKLQVGSPRLELDSDMSCQVGHLVFDSECQTESFDSIS---ITKYRSDFSEVPTERHLKDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVECQAVCMKDDVGVQNEVDEIMIMTERENHFEERFVLDLMIDETTQYGDEIIVYCSLQKDLKNKKLQVGNSRLDIDSEVSCQTGNFIMDSECQTEVEDSTDMILITHQFQNFEEE-RKPHVREFVEKEIQSEF----LSRYNKPSSSQVIQVGLSKLNEYKEVECQSEFIVFEMGVQTEAKESMIIVGTGRNVDQDLLIYDLIEETVQYNED----VNEAFKKLKGKKLQVGNPYLDSDSEVSCQTGHLLIESECQTELGDEFDTIIKTEHTQDFSEELMERPMKEFVEKEIQFETAKSSLSKYNTLENSKEVQVGQSRLVESREVGCQSEYLMNDIGVETEERECWIMEAK-YNQENLSVSYEMIEEIIQYFSDDF-TDVPXXXXXXXXXLQAGSSRLLGEMDLLCQTGHLMLDNECQTN----------KMTTNDIMENF----QNELNADESFPTKSLSNQESQYDLCEETVLSCQNQALQVGFPKLHQSQEISCQSTVETVDAVVQSES----VLTNEEYQLKKQLCQEVMIEETVQYVPDGFGSISM--KPNTKDRAIQNGNSRIQKDIDASYQTEGFTNDSICQTDY------------SEEENQIDLEIALNQYQANEVVVCNSIEIQSDGLDESLVLEVNREEC----GVQIGPSRINLCRTIDSQTQFHGEDVGVQGALDEALIIETTQQNVHSKLIFEDLIVEEIQFN--CLLPRSSIKKDSKGKKLQVGNSRL---LDDS--------DEFTQTELNDSRNIEDLCIQQVQSFQNTNTIS----FSDKEVEPLFDEEVE-FPTTNVFKSHSVQVGYPRLN---------ACV--DFEGQYSFDIDFDGSDHFESSEIEDRVFSKEQFDELIDETVQYSIGMQSST--YPSSVKVNKKLQVGSSRLEVDHDQSCQT 4935
            +++ +Q E DEF+IE+  + N   +   +++IEE +QY  E+     L +   K KKLQ G+ RL+ D + SCQTGHL+ +S+ QTE D         I L ++   Q   +    +  ++E+Q ++ D      R+ KCKK   +QVG+ +L+    AECQ+  ++ +  +Q E D+ +     + +LE  L    +I+E  Q +  D+      +    GK +Q G S+L +D +ASCQTGH++ D   QTE +    + +I   L   +F E +S   I    + EIQ D     S+  ++  KSKK+QVGH RLN+  +VECQSGCIMDD+ VQ EVDEFMI E KE+NLE SLF +DLIDE+TQ+D E +   +   +E KGKKLQVG  RL  DFEVSCQTG +I +SECQT++++ ++TL ITMHSKD+SE+LF+EP+K Y+EKEIQ ET ++S S+ +KANKSKKVQVGHPRLNE L+VECQSGC+MDDIGVQCEV+E MI  +KEQNLEAS+ I+DLI+E+TQYDDE + +TI    +  GKKLQVG SK++ DLEVSCQTG L+++SE QT+    N+++  T  S  F+ ++ I   KD+ +KE+QC++ D+S+ + NK  KS KVQ+G  R+NE  +VECQSG +MDD+GVQC+++E  I E++E+ +EASLFI+DLIDE TQYDD  +   I S +E KGKKLQVG PRL+ D ++SCQ G ++ DSECQT+  DS+    IT +  DFSE   +  +K++ EKEIQ E  +D +S       SK VQVG  RL E  DVECQ+ C+ DD+GVQ EVDE MI   +E + E    ++ +IDE TQY DE +            KL + +++ D   E+   T + ++DSE QT++E+  D +  T   + F EE     ++++ +KEIQ E     +S +NK + S+ +QVG  +LNE  +VECQS  I+ ++GVQ E  E MI     +N++  L I DLI+E  QY+++    +  + ++ KGKKLQVG P LD D EVSCQTG ++ +SECQT+L D  +T+  T H++DFSE+L + PMKE+ EKEIQ ET   S+S++N    SK+VQVG  RL E  +V CQS  +M+DIGV+ E  E  I E K  N E      ++IEE  QY  ++    +  + + KGKKLQ G  RL  + ++ CQTGHL++D+ECQT            M + D  E      +N L  +  F T  +S+         + V + +++ +QVG P+L++S E  CQS     D  VQ E+    +  N E  L+  L  + +IEE +QY  D   S+++  +   K + +Q GN R+  D++ S QT     DS CQT++            S++ NQ+  + +L              EIQ + +D+S + +   E+C     +Q+G S+++ C   + QT    +D GVQ   D+ +II+  + ++ + L  ++LI EEIQ++   +  R S + + KGK +Q G S+L   L+ S        D   QTE +++  I  L +   Q F   ++      F DKE++  FD   +  P  +  KS  +QVG+ RLN          C+  D E Q   D +F   +  E + +E+ +F    FD+LIDE+ Q+     + T   P  +K  KKLQVGS+RL  D + SCQT
Sbjct: 1648 NEMEIQTELDEFIIEQTTQINENLTQSSEEMIEELVQYESENLRPITL-KTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQ-TQFQNELLFKEYVDQEVQLDIDDFTGPIPRNTKCKK---VQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVIDRNLEAFLVNKEMINEATQCN-FDLMQPHDGKLMGIGKKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSIS-LREIEIQTDDFPGFSVNIINMNKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASLFIEDLIDEATQYDDEPVKGIINSLREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSVETLMITMHSKDFSEKLFKEPMKEYYEKEIQCETPDDSTSDQIKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASQFIEDLIDEATQYDDEPVKLTIVSQTKKIGKKLQVGISKMNGDLEVSCQTGHLVIDSESQTQLEEPNDKLTTTTYSKVFSEEILIGPIKDYFDKEIQCETTDDSISEHNKANKSKKVQVGHPRLNEILDVECQSGYIMDDIGVQCEVDEFMIEENKEQNLEASLFIEDLIDEATQYDDEPVKGIINSLREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSVETLMITMHSKDFSEKLFKEPMKEYYEKEIQCETPDDSTSDQIKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASQFIEDLIDEATQYDDEPV------------KLTIVSNKKDW-KEI---TRHLVIDSESQTQLEEPNDKLTTTTYSKVFSEEILIGPIKDYFDKEIQCETTDDSISEHNKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASLFIEDLIDEATQYDDEPVKVIINSQREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSVETLTITMHSKDFSEKLFKEPMKEYYEKEIQCETPNYSISEHNKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEERKEKNLEERLFVEDLIEEATQYDEENLNVTIGAQIETKGKKLQVGIPRLDVDFEVSCQTGHLIIDSECQTEIDNEIDTLTITMHSKDFSEKLFKEPKNYLEKEIQFETAEVSDS--------QLVKTKKSKKIQVGHPRLNKSLEGECQSGCIMDDIGVQCETDEFMIEENNEQNLEASLLIDDLIEENIQY-SDESSSVTVLSQKEQKRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTEFDWLPDTSAITLVSKDFNQVARKYSLTDLAEK--------EIQFELIDDSFLRD---EKCKKSKKIQVGFSKLSECSEAECQTGCLMDDTGVQYETDKFIIIDFKEDSLETSLRTDNLIHEEIQYDDEDVKMRLSPQAEHKGKIIQAGFSKLGFDLEASCQTGHLIIDSECQTEFDNNNEIISLSL-NYQDFSEESSGKIIKYFDDKEIQ--FDALCDSIPKLHPIKSKKIQVGHTRLNDYREVECQSGCIMDDVEVQTEVD-EFMIMERKERN-LEESLF----FDDLIDESTQFDGENLNVTVAVPKEIK-GKKLQVGSARLYDDFEVSCQT 3332          

HSP 6 Score: 888.256 bits (2294), Expect = 0.000e+0
Identity = 659/1725 (38.20%), Postives = 993/1725 (57.57%), Query Frame = 1
Query:    1 DDIGVQCETDEFMIEENNEQNLEASLLIDDLIEENIQYSDESSSVTVLSQKEQKRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTE---FDWLPDTSAITLVSKDFNQVARKYSLTDLAEKEIQFELIDDSFLRDEKCKKSKKIQVGFSKLSECSEAECQTGCLMDDTGVQYETDKFIIIDFKEDSLETSLRTDNLIHEEIQYDDEDVKMRLSPQAEHKGKIIQAGFSKLGFDLEASCQTGHLIIDSECQTEFDNNNEIISLSLNYQDFSEESSGKII-KYFDDKEIQFDALCDSIPKLHPIKSKKIQVGHTRLNDYREVECQSGCIMDDVEVQTEVDEFMIMERKERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEIK----GKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEIDNEIDTLTI--TMHSKDYSERLFREPIKYFEKEIQFETTENSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQTEFN---EQIIITMNSPDFTD-LKIQQKKDFMEKEMQCDSLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDVGVQCDXXXXXXXXXXXXXXXASLFIDDLIDETTQYDDLSLNVRIISQKEYKGKKLQVGSPRLELDSDMSCQVGHLVFDSECQT---ESFDSISITKYRSDFSEVPTERHLKDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVECQAVCMKDDVGVQNEVDEIMIMTERENHFEERFVLDLMIDETTQYGDEII--VYCSLQKDLKNKKLQVGNSRLDIDSEVSCQTGNFIMDSECQTEVEDSTDMILITHQFQNFEEER-KPHVREFVEKEIQSEF----LSRYNKPSSSQVIQVGLSKLNEYKEVECQSEFIVFEMGVQTEAKESMIIVGTGRNVDQDLLIYDLIEETVQYNEDVNEAFKKLKGKKLQVGNPYLDSDSEVSCQTGHLLIESECQTELGDEFDTIIKTEHTQDFSEELMERPMKEFVEKEIQFETAKSSLSKYNTLENSKEVQVGQSRLVESREVGCQSEYLMNDIGVETEERECWIMEAKYNQENLSVSY---EMIEEIIQYFSDDF-TDVPXXXXXXXXXLQAGSSRLLGEMDLLCQTGHLMLDNECQTNKMTTNDIMENFQNELNADE------SFPTKSLSNQESQ-----YDLCEETVLSCQNQALQVGFPKLHQSQEISCQSTVETVDAVVQSE----SVLTNEEYQLKKQLCQEVMIEETVQYVPDGFG-SISMKPNTKDRAIQNGNSRIQKDIDASYQTEGFTNDSICQTDYSEEENQID-LEIALNQYQANEVV-------VCNSIEIQSDGLDESLVLEVNREECGVQIGPSRINLCRTIDSQTQFHGEDVGVQGALDEALIIETTQQNVHSKLIFEDLIVEEIQFNCLLPRSSI--KKDSKGKKLQVGNSRLLDDSDEFTQTELNDSRNIEDLCIQQVQSFQNTNTISFSDKE---------VEPLFDEEVEFPTTN--------VFKSHSVQVGYPRLNACVDFEGQYSFDIDFDGSDHFESSEI------EDRVFSKEQFDELIDETVQY---SIGMQSSTYPSSVKVNKKLQVGSSRLEVDHDQSCQT 4935
            ++I VQ E DEF+IEE   +N  A+L ++++IEE++QY  +    T+   KE + K  QVGNPR++ D + SCQ GHL+ + + QT+   FD     + IT+V           + T+  EKE+Q + +       EK +KSKK+QVG  +L++  + ECQ+G L+++  +Q E D+FII    + +   +  ++ +I E +QY+ E+++  ++ +   KGK +Q G S+L  D ++SCQTGHL+ +SE QTE D     I   +   +   +   +++ K + D+E+Q D    + P     K KK+QVG+ RLN     ECQS  ++ + ++QTE DE +     +RNLE  L   ++I+E+TQ      N  +  P + K    GKKLQVG++RL  DF+ SCQTGH++ +   QTEI+  + ++ I   +   ++ E   ++ I   E EIQ +         +  NKSKKVQVGHPRLNE L+VECQSGC+MDDIGVQCEV+E MI  +KEQNLEAS  I+DLI+E+TQYDDE +   I+ L+E KGKKLQVG  +LD D EVSCQTGR+I +SECQT+ N   E ++ITM+S DF++ L  +  K++ EKE+QC++ D+S   + K  KS KVQ+G  R+NE  +VECQSGC+MDD+GVQC+++E  I E++E+ +EAS FI+DLIDE TQYDD  + + I+SQ +  GKKLQVG  ++  D ++SCQ GHLV DSE QT   E  D ++ T Y   FSE      +KD+ +KEIQ E  +D  S  N    SK VQVG  RL E  DVECQ+  + DD+GVQ EVDE MI   +E + E    ++ +IDE TQY DE +  +  SL ++ K KKLQVG  RLD D EVSCQTG  I DSECQT++ DS + ++IT   ++F E+  K  ++E+ EKEIQ E      S   K + S+ +QVG  +LNE  +VECQS  I+ ++GVQ E  E MI     +N++    I DLI+E  QY+++           KL + +   D   E+   T HL+I+SE QT+L +  D +  T +++ FSEE++  P+K++ +KEIQ ET   S+S++N    SK+VQVG  RL E  +V CQS  +M+DIGV+ E  E  I E K  ++NL  S    ++I+E  QY  +     +  +++QKGKKLQ G  RL G+ ++ CQTG ++ D+ECQT+    ND +E     +++ +        P K    +E Q     Y + E    + +++ +QVG P+L++  ++ CQS     D  VQ E     +   +E  L+++L  E +IEE  QY  +    +I  +  TK + +Q G  R+  D + S QT     DS CQT   E +N+ID L I ++    +E +       +   I+ ++  + +S +++  + +  +Q+G  R+N     + Q+    +D+GVQ   DE +I E  +QN+ + L+ +DLI E IQ++      ++  +K+ K KKLQVGN RL  D +   QT       I+  C  +     +T+ I+   K+         +  L ++E++F   +          KS  +QVG+ +L+ C + E Q    +D D    +E+ +       ED + +  + D LI E +QY    + M+ S  P +    K +Q G S+L  D + SCQT
Sbjct: 1491 EEIAVQTEIDEFVIEEIRNKNELAALFVEEMIEESVQYMAD-DIFTIQYPKETQEKNFQVGNPRIEIDYDTSCQAGHLVRELEIQTDQEPFDGFE--TQITMVKDQLESQNIVRTTTEFIEKEVQPDFV------SEKSRKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFIIEQTTQINENLTQSSEEMIEELVQYESENLR-PITLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQNELLFKEYVDQEVQLDIDDFTGPIPRNTKCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVIDRNLEAFLVNKEMINEATQ-----CNFDLMQPHDGKLMGIGKKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSISLREIEIQTDDFPGFSVNIINMNKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASLFIEDLIDEATQYDDEPVKGIINSLREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSVETLMITMHSKDFSEKLFKEPMKEYYEKEIQCETPDDSTSDQIKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASQFIEDLIDEATQYDDEPVKLTIVSQTKKIGKKLQVGISKMNGDLEVSCQTGHLVIDSESQTQLEEPNDKLTTTTYSKVFSEEILIGPIKDYFDKEIQCETTDDSISEHNKANKSKKVQVGHPRLNEILDVECQSGYIMDDIGVQCEVDEFMIEENKEQNLEASLFIEDLIDEATQYDDEPVKGIINSL-REQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSVETLMITMHSKDFSEKLFKEPMKEYYEKEIQCETPDDSTSDQIKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASQFIEDLIDEATQYDDE---------PVKLTIVSNKKDW-KEI---TRHLVIDSESQTQLEEPNDKLTTTTYSKVFSEEILIGPIKDYFDKEIQCETTDDSISEHNKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENK--EQNLEASLFIEDLIDEATQYDDEPVKVIINSQREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTD---LNDSVETLTITMHSKDFSEKLFKEPMKEYYEKEIQCETPNYSISEHNKAN-KSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEERKEKNLEERLFVEDLIEEATQYDEENLNVTIGAQIETKGKKLQVGIPRLDVDFEVSCQTGHLIIDSECQT---EIDNEIDTLTITMHSKDFSEKLFKEPKNYLEKEIQFETAEVSDSQLVKTKKSK-KIQVGHPRLNKSLEGECQSGCIMDDIGVQCETDEFMIEENNEQNLEASLLIDDLIEENIQYSDESSSVTVLSQKEQKRKKLQVGNPRLDGDLEVSCQT---GHLIIDSQCQTEFDWLPDTSAITLVSKDFNQVARKYSLTDLAEKEIQFELIDDSFLRDEKCKKSKKIQVGFSKLSECSEAECQTGCLMD-DTGVQYETDKFIIIDFKEDSLETSLRTDNLIHEEIQYDDEDVKMRLS--PQAEHKGKIIQAGFSKLGFDLEASCQT 3170          

HSP 7 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 611/1703 (35.88%), Postives = 921/1703 (54.08%), Query Frame = 1
Query:  160 KRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTEFDWLPDTSAITLVSKDFNQVARKYSLTDLAEKEIQFELIDDSFLRDEKCKKSKKIQVGFSKLSECSEAECQTGCLMDDTGVQYETDKFI----IIDFKEDSLETSLRTDNLIHEEIQYDDEDVKMRLSPQAEHKGKIIQAGFSKLGFDLEASCQTGHLIIDSECQT--EFDNNNEIIS---LSLNYQDFSEESSGKIIKYFDDKEIQFDALCDSIPKLHPI--------KSKKIQVGHTRLNDYREVECQSGCIMDDVEVQTEVDEFMIMERKERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEIKGKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEID--NEIDTLTITMHSKDYSERLFREPIKYFEKEIQFETTENSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQTEFNE-------QIIITMNSPDFTDLKIQQKKDFMEKEMQCDSLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDVGVQCDXXXXXXXXXXXXXXXASLFIDDLIDETTQYDDLSLNVRIISQKEYK----GKKLQVGSPRLELDSDMSCQVGHLVFDSECQTESFDSISITKYRS-----DFSEVPTERHLKDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVECQAVCMKDDVGVQNEVDEIMIMTERENHFEERFVLDLMIDETTQYGDEII--VYCSLQKDLKNKKLQVGNSRLDIDSEVSCQTGNFIMDSECQTEVEDSTDMILITHQFQNFEEER-KPHVREFVEKEIQSEF----LSRYNKPSSSQVIQVGLSKLNEYKEVECQSEFIVFEMGVQTEAKESMIIVGTGRNVDQDLLIYDLIEETVQYNED-----VNEAFKKLKGKKLQVGNPYLDSDSEVSCQTGHLLIESECQTELGDEFDTIIKTEHTQDFSEELMERPMKEFVEKEIQFETAKSSLSKYNTLENSKEVQVGQSRLVESREVGCQSEYLMNDIGVETEERECWIMEAKYNQENLSVSY---EMIEEIIQYFSDDFTD-VPXXXXXXXXXLQAGSSRLLGEMDLLCQTGHLMLDNECQTNKMTTNDIMENFQNELNADE------SFPTKSLSNQESQY----DLCEETVLSCQNQALQVGFPKLHQSQEISCQSTVETVDAVVQSE----SVLTNEEYQLKKQLCQEVMIEETVQYVPDGFGSISMKPNTKDRAIQNGNSRIQKD--IDASYQTE-GFTNDSICQTDYSEEENQIDLEIALNQYQANEVVVCNSIEIQSDGLDESLVLEVNR--EECGVQIGPSRINLCRTIDSQTQFHGEDVGVQGALDEALIIETTQQNVHSKLIFEDLIVEEIQFNCLLPRSSI--KKDSKGKKLQVGNSRLLDD-----------SDEFTQTELNDSRNIEDLCIQQVQSFQNTNTISFSDKEV-EPL---FDEEVEFPTTN--------VFKSHSVQVGYPRLNACVDFEGQYSFDIDFDG----SDHFESSE-----IEDRVFSKEQFDELIDETVQY-------SIGMQSSTYPSSVKVNKKLQVGSSRLEVDHDQSCQT 4935
            K KKLQ G+ RL+ D E SCQTGH++ + + QTEF +   T +I         + ++YS      KE Q E        +    K KKIQVG+  +++ SE E Q    + ++ +Q  TD+      +I+ +   LE       LI EE+QY    ++ RL  +  ++GK +Q+G  KL  +L+ SCQ G++  ++ECQT  EF +   +I+     L  Q+   ES  K    + +KEIQ            PI        K KKIQVGH +LN++ EVECQS   ++++ VQTE+DEF+I E + +N   +LF +++I+ES Q+  +++  T+  PKE + K  QVG+ R+  D++ SCQ GHL+   E QT+ +  +  +T    +  +  S+ + R   ++ EKE+Q +          K+ KSKKVQVGHPRLN+NL+VECQSG L++++ +Q E++E +I  + + N   ++  +++IEE  QY+ ENL   I++   TKGKKLQ G S+L+ D + SCQTG L+  SE QTE +E       +I +      F +  +   K+++++E+Q D +D+      + TK  KVQ+G  R+N     ECQS  ++ +  +Q + +E       +R +EA L   ++I+E TQ      N  ++   + K    GKKLQVG+ RLE D D SCQ GH+V D   QTE  +++      S     +F E+ ++  +    E EIQ +     S  I N+  SK VQVG  RL E  DVECQ+ C+ DD+GVQ EVDE MI   +E + E    ++ +IDE TQY DE +  +  SL ++ K KKLQVG  RLD D EVSCQTG  I DSECQT++ DS + ++IT   ++F E+  K  ++E+ EKEIQ E      S   K + S+ +QVG  +LNE  +VECQS  I+ ++GVQ E  E MI     +N++    I DLI+E  QY+++     +    KK+ GKKLQVG   ++ D EVSCQTGHL+I+SE QT+L +  D +  T +++ FSEE++  P+K++ +KEIQ ET   S+S++N    SK+VQVG  RL E  +V CQS Y+M+DIGV+ E  E  I E K  ++NL  S    ++I+E  QY  +     +   ++QKGKKLQ G  RL G+ ++ CQTG ++ D+ECQT+    ND +E     +++ +        P K    +E Q     D   + + + +++ +QVG P+L++  ++ CQS     D  VQ E     +  N+E  L+     E +I+E  QY  D    +++  N KD         I +   ID+  QT+    ND +  T YS+  ++  L   +  Y           EIQ +  D+S + E N+  +   VQ+G  R+N    ++ Q+    +D+GVQ  +DE +I E  +QN+ + L  EDLI E  Q++    +  I  +++ KGKKLQVG  RL  D            D   QT+LNDS  +E L I         ++  FS+K   EP+   +++E++  T N          KS  VQVG+PRLN  +D E Q    +D  G     D F   E     +E+R+F     ++LI+E  QY       +IG Q  T        KKLQVG  RL+VD + SCQT
Sbjct: 1250 KSKKLQAGSSRLNADYEASCQTGHIVNEIETQTEFFY--KTESI---------LPKEYS-----NKETQPE-------SEMAITKGKKIQVGYPHINKISEKEIQIEIDITESSIQ--TDQIGSEKEMINQRSFGLE-------LIDEELQYYG-SLQDRLGNELFYEGKNVQSGSPKLFMELDESCQIGYVKHEAECQTDNEFSDEELVITEVQAELQSQNVLMESKKK---EYTEKEIQ------------PILTFYKASNKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTEIDEFVIEEIRNKNELAALFVEEMIEESVQYMADDI-FTIQYPKETQEKNFQVGNPRIEIDYDTSCQAGHLVRELEIQTDQEPFDGFETQITMVKDQLESQNIVRTTTEFIEKEVQPDFVSE------KSRKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFIIEQTTQINENLTQSSEEMIEELVQYESENLR-PITLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQNELL--FKEYVDQEVQLD-IDDFTGPIPRNTKCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVIDRNLEAFLVNKEMINEATQ-----CNFDLMQPHDGKLMGIGKKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSIS-LREIEIQTDDFPGFSVNIINMNKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASLFIEDLIDEATQYDDEPVKGIINSL-REQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSVETLMITMHSKDFSEKLFKEPMKEYYEKEIQCETPDDSTSDQIKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASQFIEDLIDEATQYDDEPVKLTIVSQTKKI-GKKLQVGISKMNGDLEVSCQTGHLVIDSESQTQLEEPNDKLTTTTYSKVFSEEILIGPIKDYFDKEIQCETTDDSISEHNKANKSKKVQVGHPRLNEILDVECQSGYIMDDIGVQCEVDEFMIEENK--EQNLEASLFIEDLIDEATQYDDEPVKGIINSLREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTD---LNDSVETLMITMHSKDFSEKLFKEPMKEYYEKEIQCETPDDSTSDQIKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASQFIEDLIDEATQY-DDEPVKLTIVSNKKDWK------EITRHLVIDSESQTQLEEPNDKLTTTTYSKVFSEEILIGPIKDYFDK--------EIQCETTDDS-ISEHNKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASLFIEDLIDEATQYDDEPVKVIINSQREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDS--VETLTI-------TMHSKDFSEKLFKEPMKEYYEKEIQCETPNYSISEHNKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEERKEKNLEERLF----VEDLIEEATQYDEENLNVTIGAQIETK------GKKLQVGIPRLDVDFEVSCQT 2845          

HSP 8 Score: 596.66 bits (1537), Expect = 5.646e-172
Identity = 578/1764 (32.77%), Postives = 889/1764 (50.40%), Query Frame = 1
Query:  157 QKRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTEFDWLPDTSAITLVSKDFN---QVARKYSLT-DLAEKEIQ------FELID------DSFLRDE--------------------KCKKSKKIQVGFSKLSECSEAECQTGCLMDDTGVQYETD------------------------KFIIIDFKE----------------------DSLETSLRTDNLIHEEIQYDDEDVKMRLSPQAEHKGKIIQAGFSKLGFDLEASCQTGHLIIDSECQTEFDNNNEIISLSLNYQDFSEESSGKIIKYFDDKEIQFDALCDSIPKLHPIKSKKIQVGHTRLNDYREVECQSGCIMDDVEVQTEVDEFMIMERKERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEIKGKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEIDNEI--DTLTIT-MHSKDYSERLFREPIK--YFEKEIQFETTENSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQTE------FNEQIIITMNSPDFTDLKIQQKKDFMEKEMQCDSLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDVGVQCDXXXXXXXXXXXXXXXASLFIDDLIDETTQYDDLSLNVRIISQK-EYKGKKLQVGSPRLELDSDMSCQVGHLVFDSECQTESFD-------SISITKYRSDFSEVPTERHLKDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVECQAVCMKDDVGVQNEVDEIMIMTERENHFEERFVLDLMIDETTQYGDEIIVYCSLQKDLKNKKLQVGNSRLDIDSEVSCQTGNFIMDSECQTEVEDSTDMILI-----THQFQNFEEERKPHVREFVEKEIQSEFLSRYN----KPSSSQVIQVGLSKLNEYKEVECQSEFIVFEMGVQTEAKESMIIVGTGRNVDQDLLIYDLIEETVQYNED----VNEAFKKLKGKKLQVGNPYLDSDSEVSCQTGHLLIESECQTELGDEFDTIIKTEHTQDFSEELMERPMKEFVEKEIQFETAKSSLSKYNTLENSKEVQVGQSRLVESREVGCQSEYLMNDIGVETEERECWIMEAKYNQENLSVSY---EMIEEIIQYFSDDFT-DVPXXXXXXXXXLQAGSSRLLGEMDLLCQTGHLMLDNECQT------NKMTTNDIMENFQNELNADESFPTKSLSNQESQYDLCEET--VLSCQNQA-----LQVGFPKLHQSQEISCQSTVETVDAVVQSE----SVLTNEEYQLKKQLCQEVMIEETVQYVPDGF-GSISMKPNTKDRAIQNGNSRIQKDIDASYQTEGFTNDSICQTDYSEEENQIDLEIALNQYQANEVVVCNSI------EIQSDGLDESLV--LEVNREECGVQIGPSRINLCRTIDSQTQFHGEDVGVQGALDEALIIETTQQNVHSKLIFEDLIVEEIQFN---CLLPRSSIKKDSKGKKLQVGNSRLLDDSDEFTQTELNDSRNIEDLCIQQVQSFQNTNTISFSDK----EVEPLFDEEVEFPTTN--------VFKSHSVQVGYPRLNACVDFEGQYSFDIDFDG----SDHFESSEIEDRVFSKEQF-DELIDETVQYSIGMQSSTYPSSVKVN-------KKLQVGSSRLEVDHDQSCQT 4935
            +K KKLQ+GN RL+G+LE SCQTGH++ +   QTE   L     + L+SK+     + A KY +  ++  K++Q      ++ ID       SF   E                    K  ++K+ Q+G S+L    E  CQTG ++ D   Q E D                        K + + + +                      DS+E  +    L   EIQ++  DV+      +  K K +QAG S+L  D EASCQTGH++ + E QTEF    E I                + K + +KE Q ++      ++   K KKIQVG+  +N   E E Q    + +  +QT+     I   KE  + +  F  +LIDE  Q+ G +L   +      +GK +Q GS +L+ + + SCQ G++   +ECQT  DNE   + L IT + ++  S+ +  E  K  Y EKEIQ   T      +  +NK KK+QVGHP+LNE +EVECQS   +++I VQ E++E +I   + +N  A+  ++++IEES QY  +++  TI   KET+ K  QVG  +++ D + SCQ G L+   E QT+      F  QI +  +  +  ++ ++   +F+EKE+Q D +        K  KS KVQ+G  R+N+  +VECQSG +++++ +Q +++E  I ++ +     +   +++I+E  QY+  S N+R I+ K   KGKKLQ GS RLE D D SCQ GHLV +SE QTE+ +        I +   ++ F     E   K++V++E+Q + ++D +  I      K VQVG  RL      ECQ+  +  +  +Q E DE++     + + E   V   MI+E TQ   +++     +     KKLQVG SRL+ D + SCQTG+ + D   QTE+E++   ILI      ++FQ    +    +RE    EIQ++    ++      + S+ +QVG  +LNE  +VECQS  I+ ++GVQ E  E MI     +N++  L I DLI+E  QY+++    +  + ++ KGKKLQVG P LD D EVSCQTG ++ +SECQT+L D  +T++ T H++DFSE+L + PMKE+ EKEIQ ET   S S       SK+VQVG  RL E  +V CQS  +M+DIGV+ E  E  I E K  ++NL  S    ++I+E  QY  +     +  +  + GKKLQ G S++ G++++ CQTGHL++D+E QT      +K+TT    + F  E+      P K   ++E Q   CE T   +S  N+A     +QVG P+L++  ++ CQS     D  VQ E     +  N+E  L+  L  E +I+E  QY  +   G I+     K + +Q G  R+  D + S QT     DS CQTD ++      L I ++    +E +    +      EIQ +  D+S    ++ N+ +  VQ+G  R+N    ++ Q+    +D+GVQ  +DE +I E  +QN+ +    EDLI E  Q++     L   S KKD K    ++    ++D   +    E ND                 T +  FS++     ++  FD+E++  TT+          KS  VQVG+PRLN  +D E Q    +D  G     D F   E +++      F ++LIDE  QY         P  V +N       KKLQVG  RL+ D + SCQT
Sbjct: 1008 KKNKKLQIGNSRLEGNLESSCQTGHVVDEFHTQTE--ELLFMEPMGLLSKEIQSDIESADKYQIRLEMKGKKVQVGYPQTYDRIDVECQVQSSFFEAETETISLARNEFEMNEREWTVKTTENKETQIGCSRLDGDFETSCQTGHIVKDFESQTENDYTEHQIQLVTMANNLQAVKSQMKGKKVQVGYPQLNMSFEFGSQFGDDLNDATIQTDSIEEYINPMTLTDGEIQWN--DVEEGSQSSSGLKSKKLQAGSSRLNADYEASCQTGHIVNEIETQTEFFYKTESI----------------LPKEYSNKETQPES------EMAITKGKKIQVGYPHINKISEKEIQIEIDITESSIQTD----QIGSEKEM-INQRSFGLELIDEELQYYG-SLQDRLGNELFYEGKNVQSGSPKLFMELDESCQIGYVKHEAECQT--DNEFSDEELVITEVQAELQSQNVLMESKKKEYTEKEIQPILT-----FYKASNKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTEIDEFVIEEIRNKNELAALFVEEMIEESVQYMADDI-FTIQYPKETQEKNFQVGNPRIEIDYDTSCQAGHLVRELEIQTDQEPFDGFETQITMVKDQLESQNI-VRTTTEFIEKEVQPDFVS------EKSRKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFIIEQTTQINENLTQSSEEMIEELVQYE--SENLRPITLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQ---NELLFKEYVDQEVQLD-IDDFTGPIPRNTKCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVIDRNLEAFLVNKEMINEATQCNFDLMQPHDGKLMGIGKKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSISLREI---EIQTDDFPGFSVNIINMNKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASLFIEDLIDEATQYDDEPVKGIINSLREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSVETLMITMHSKDFSEKLFKEPMKEYYEKEIQCETPDDSTSDQIKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENK--EQNLEASQFIEDLIDEATQYDDEPVKLTIVSQTKKIGKKLQVGISKMNGDLEVSCQTGHLVIDSESQTQLEEPNDKLTTTTYSKVFSEEILIG---PIKDYFDKEIQ---CETTDDSISEHNKANKSKKVQVGHPRLNEILDVECQSGYIMDDIGVQCEVDEFMIEENKEQNLEASLFIEDLIDEATQYDDEPVKGIINSLREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSVET--LMITMHSKDFSEKLFKEPMKEYYEKEIQCETPDDSTSDQIKANKSK-KVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASQFIEDLIDEATQYDDEPVKLTIVSNKKDWK----EITRHLVIDSESQTQLEEPNDKLTT------------TTYSKVFSEEILIGPIKDYFDKEIQCETTDDSISEHNKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASLFIEDLIDEATQY------DDEPVKVIINSQREQKGKKLQVGIPRLDGDFEVSCQT 2682          

HSP 9 Score: 464.537 bits (1194), Expect = 7.948e-131
Identity = 526/1746 (30.13%), Postives = 845/1746 (48.40%), Query Frame = 1
Query:  106 IQYSDESSSVTVLSQKEQKRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTEFDWLPDTSAITLVSKDFNQVARKYSLTDLAEKEIQFELIDDSFLRDEKCKKSKKIQVGFSKLSECSEAECQTGCLMDDTGVQYETDKFIIIDFKEDSLETSLRTDNLIHEEIQYDDEDVKMRLSP---QAEH---KGKIIQAGFSKLGFDLEASCQTGHLIIDSECQTE---FDNNNEIISLSL--------NYQDFSEESSGKI-IKY---FDDKEIQ-------FDALCDSIP-------------KLHPIKSKKIQVGHTRLNDYREVECQSGCIMDDVEVQTEVD------EFMIMERKERNLEESL---------------------FFDDLIDESTQFDG--ENLNVTVAVPKEI---------------KGKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEIDNEIDTLTITMHSKDYSERLFREPIKYFEKEIQFETTENSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQT--EF-NEQIIITMNSPDFTDLKI---QQKKDFMEKEMQCDSLDNSLLKENKIT-KSMKVQMGLARINECREVECQSGCMMDDVGVQCDXXXXXXXXXXXXXXXASLFIDDLIDETTQY--DDLSLNVRIISQKEYKGKKLQVGSPRLELDSDMSCQVGHLVFDSECQT--ESFDSI--SITKYRSDFSEVPTERHLKDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVECQAVCMKDDVGVQNEVDEIMIMTERENHFEERFVL--DLMIDETTQYGDEIIVYCSLQKDLKNKKLQVGNSRLDIDSEVSCQTGNFIMDSECQTE-------VEDSTDMILITHQFQNFEEERKPHVREFVEKEIQ---SEFLSRYNKPSSSQVIQVGLSKLNEYKEVECQSEFIVFEMGVQTEAKESMIIVGTGRNVDQDLLIYDLIEETVQYNEDVNEAF-KKLK--GKKLQVGNPYLDSDSEVSCQTGHLLIESECQTELGDEFDTI-IKTEHTQDFSEELMERPMKEFVEKEIQFETAKSSLSKYNTLENSKEVQVGQSRLVESREVGCQSEYLMNDIGVETEERECWIMEAKYNQENLSVSY---EMIEEIIQYFSDDFTD-VPXXXXXXXXXLQAGSSRLLGEMDLLCQTGHLMLDNECQTNKMTTNDIMENFQNELNADE------SFPTKSLSNQESQY----DLCEETVLSCQNQALQVGFPKLHQSQEISCQSTVETVDAVVQSE----SVLTNEEYQLKKQLCQEVMIEETVQYVPDGFGSISMKPNTK--DRAIQNGNSRIQKDIDASYQTEGFTNDSICQTDYSEEENQIDLEIALNQYQANEVVVCNSI------EIQSDGLDESLVLEVNR--EECGVQIGPSRINLCRTIDSQTQFHGEDVGVQGALDEALIIETTQQNVHSKLIFEDLIVEEIQFNCLLPRSSIK--KDSKGKKLQVGNSRLLDD-----------SDEFTQTELNDSRNIEDLCIQQVQSFQNTNTISFSDKEV-EPL---FDEEVEFPTTN--------VFKSHSVQVGYPRLNACVDFEGQYSFDIDFDG----SDHFESSEIEDRVFSKEQF-DELIDETVQY 4827
            I   D S+ +  + Q+  K K++Q G  +L G+ E S QT + +I++  QT  + + D + ++      N +     LT   ++ I  E+  D  +  +K    KK+Q+G SKL E  E+ CQ G ++ ++ +Q +     +I   E S    L          +  DE  +  + P   + EH   K K +Q G S+L  +LE+SCQTGH++ +   QTE   F     ++S  +         YQ   E    K+ + Y   +D  +++       F+A  ++I               +   ++K+ Q+G +RL+   E  CQ+G I+ D E QTE D      + + M    + ++  +                     F DDL D + Q D   E +N       EI               K KKLQ GS+RL  D+E SCQTGH++   E QTE   + +++                P +Y  KE Q E+        +   K KK+QVG+P +N+  E E Q    + +  +Q +      +GS+++ +       +LI+E  QY   +L   +      +GK +Q G  KL  +L+ SCQ G +   +ECQT  EF +E+++IT    +     +    +KK++ EKE+Q       +L   K + K  K+Q+G  ++NE  EVECQS   ++++ VQ +I+E  I E R +   A+LF++++I+E+ QY  DD+     I   KE + K  QVG+PR+E+D D SCQ GHLV + E QT  E FD     IT  +         R   +F+EKE+Q + + + S      + SK VQVG  RL +  DVECQ+  + +++ +Q E+DE +I  E+     E      + MI+E  QY  E +   +L+ + K KKLQ G+SRL+ D + SCQTG+ + +SE QTE       ++    +     QFQN     +   +E+V++E+Q    +F     + +  + +QVG  +LN     ECQSE ++    +QTE  E +  V   RN++  L+  ++I E  Q N D+ +    KL   GKKLQVG   L+ D + SCQTGH++ +   QTE+ +   +I I+++   +  +E+  +      E EIQ +           +  SK+VQVG  RL E  +V CQS  +M+DIGV+ E  E  I E K  ++NL  S    ++I+E  QY  +     +   ++QKGKKLQ G  RL G+ ++ CQTG ++ D+ECQT+    ND +E     +++ +        P K    +E Q     D   + + + +++ +QVG P+L++  ++ CQS     D  VQ E     +  N+E  L+     E +I+E  QY  D    +++   TK   + +Q G S++  D++ S QT     DS  QT   E  +++        +  +E ++   I      EIQ +  D+S + E N+  +   VQ+G  R+N    ++ Q+ +  +D+GVQ  +DE +I E  +QN+ + L  EDLI E  Q++    +  I   ++ KGKKLQVG  RL  D            D   QT+LNDS  +E L I         ++  FS+K   EP+   +++E++  T +          KS  VQVG+PRLN  +D E Q    +D  G     D F   E +++     QF ++LIDE  QY
Sbjct:  843 IYIRDNSTDMDSIGQR--KNKRIQFGKSKLFGEGEFSSQTNYHLIEANVQTN-NEVEDYATLSE-----NGMLEYEILTQEPKQTIDVEIQSDLEIVKQK---GKKVQIGSSKLLETCESSCQIGTVLHNSELQTDDKLKFVIQANEKSSPIGL----------ELKDESTQWGIIPIDNEIEHGMKKNKKLQIGNSRLEGNLESSCQTGHVVDEFHTQTEELLFMEPMGLLSKEIQSDIESADKYQIRLEMKGKKVQVGYPQTYDRIDVECQVQSSFFEAETETISLARNEFEMNEREWTVKTTENKETQIGCSRLDGDFETSCQTGHIVKDFESQTENDYTEHQIQLVTMANNLQAVKSQMKGKKVQVGYPQLNMSFEFGSQFGDDLNDATIQTDSIEEYINPMTLTDGEIQWNDVEEGSQSSSGLKSKKLQAGSSRLNADYEASCQTGHIVNEIETQTEFFYKTESIL---------------PKEYSNKETQPES-------EMAITKGKKIQVGYPHINKISEKEIQIEIDITESSIQTDQ-----IGSEKEMINQRSFGLELIDEELQYYG-SLQDRLGNELFYEGKNVQSGSPKLFMELDESCQIGYVKHEAECQTDNEFSDEELVITEVQAELQSQNVLMESKKKEYTEKEIQ------PILTFYKASNKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTEIDEFVIEEIRNKNELAALFVEEMIEESVQYMADDI---FTIQYPKETQEKNFQVGNPRIEIDYDTSCQAGHLVRELEIQTDQEPFDGFETQITMVKDQLESQNIVRTTTEFIEKEVQPDFVSEKS------RKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFII--EQTTQINENLTQSSEEMIEELVQYESENLRPITLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQN-----ELLFKEYVDQEVQLDIDDFTGPIPRNTKCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVIDRNLEAFLVNKEMINEATQCNFDLMQPHDGKLMGIGKKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSISLREIEIQTDDFPGFSVNIINMNKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENK--EQNLEASLFIEDLIDEATQYDDEPVKGIINSLREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTD---LNDSVETLMITMHSKDFSEKLFKEPMKEYYEKEIQCETPDDSTSDQIKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASQFIEDLIDEATQY-DDEPVKLTIVSQTKKIGKKLQVGISKMNGDLEVSCQTGHLVIDSESQTQLEEPNDKLTTTTYSKVF--SEEILIGPIKDYFDKEIQCETTDDS-ISEHNKANKSKKVQVGHPRLNEILDVECQSGYIMDDIGVQCEVDEFMIEENKEQNLEASLFIEDLIDEATQYDDEPVKGIINSLREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDS--VETLMI-------TMHSKDFSEKLFKEPMKEYYEKEIQCETPDDSTSDQIKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASQFIEDLIDEATQY 2499          

HSP 10 Score: 312.768 bits (800), Expect = 1.033e-84
Identity = 379/1284 (29.52%), Postives = 593/1284 (46.18%), Query Frame = 1
Query: 1372 VKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIMIMGSKEQNLEASRLIDDLIEESTQYDDENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQTEFNEQIIITMN---SPDFTDLKIQQKKDFMEKEMQCDSLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDVGVQCDXXXXXXXXXXXXXXXASLFID--DLIDETTQYDDLSLNVRIISQKEYKGKKLQVGSPRLELDSDMSCQVGHLVFDSECQTESF---------------------DSISITKYRSDFSEVPTERHL---------KDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVECQAVCMKDDVGVQ--NEVDEIMIMTERENHFEERFVLDLMIDETTQYGDEIIVYCSLQKDLKNKKLQVGNSRLDIDSEVSCQTGNFIMDSECQTEVEDSTDMILITHQFQNFEEERKPHVREFVEKEIQSEFLSRYNKPSSSQVIQVGLSKLNEYKEVECQSEFIVFEMGVQTEAKESMIIVGTGRN-VDQDLLIYDLIEETVQYNEDV-----NEAFKKLKGKKLQVGNPYLDSDSEVSCQTGHLLIESECQT--ELGDEFDTIIKTEHTQDFSEELMERPMKEFVEKEIQFETAKSSLSKYNTLENSKEVQVGQSRLVESREVGCQSEYLMNDIGVETEERECWIMEAKYNQENLSVSY--EMIEEIIQYFSDDFTDVPXXXXXXXXXLQAGSSRLLGEMDLLCQTGHLMLDNECQTNK----------MTTNDIMENFQNELNADESFPTKSLSNQESQYDLCEETVLSCQNQALQVGFPKLHQSQEISCQSTVETVDAVVQSE--SVLTNEEYQLKKQLCQ--EVMIEETVQYVPDGFGSISMKPNTKDRAIQNGNSRIQKDIDASYQTEGFTNDSICQTDYSEEENQIDLEIALNQYQA---NEVVVCNSI--EIQSDGLDESLVLEVNREECGVQIGPSRINLCRTIDSQTQFHGEDVGVQGALDEALIIETTQQNVHSKLIFEDLIVEEIQ--FNCLLPRSSIKKDSKGKKLQVGNSRLLDD-----------SDEFTQTELNDSRN---IED-LCIQQVQSFQNTNTISFSDKEVE----PLFDEEVEFPTTNVFKSHSVQVGYPRLNACVDFEGQYSFDIDFDG----SDHFESSEIEDRVFSKEQF-DELIDETVQYS----IGMQSSTYPSSVKVNKKLQVGSSRLEVDHDQSCQT 4935
            +   K+K++Q G  +L    E   Q+   + +  VQ   NE+    +  +N      I  L +E  Q  D  +   + ++K+ KGKK+Q+G SKL E  E SCQ G ++ NSE QT+   + +I  N   SP   +LK +        +     +DN +  E+ + K+ K+Q+G +R+    E  CQ+G ++D+   Q +                 LF++   L+ +  Q D  S +   I + E KGKK+QVG P+     D+ CQV    F++E +T S                        I  ++   DF       H+          D+ E +IQ   + +    + +    K VQVG  +L            M  + G Q  +++++  I T+     EE      + D   Q+ D +         LK+KKLQ G+SRL+ D E SCQTG+ + + E QTE    T+ IL                +E+  KE Q E      K    + IQVG   +N+  E E Q E  + E  +QT+       +G+ +  ++Q     +LI+E +QY   +     NE F   +GK +Q G+P L  + + SCQ G++  E+ECQT  E  DE   I + +        LME   KE+ EKEIQ       L+ Y      K++QVG  +L E  EV CQSE  + +I V+TE  E +++E   N+  L+  +  EMIEE +QY +DD   +   K+ + K  Q G+ R+  + D  CQ GHL+ + E QT++              D +E+ QN +     F  K     E Q D   E   S +++ +QVG P+L+ + ++ CQS     +  +Q+E    +  +  Q+ + L Q  E MIEE VQY  +    I++K NTK + +Q G+SR++ D D+S QT     +S  QT+  E   +ID EI L   Q    NE++    +  E+Q D  D +  +  N +   VQ+G  R+NL    + Q++   ++  +Q   DE L      +N+ + L+ +++I E  Q  F+ + P    K    GKKLQVG SRL  D            D+  QTE+ ++     IE  L + + Q   + ++IS  + E++    P F   +     N+ KS  VQVG+PRLN  +D E Q    +D  G     D F   E +++      F ++LIDE  QY      G+ +S         KKLQVG  RL+ D + SCQT
Sbjct:  855 IGQRKNKRIQFGKSKLFGEGEFSSQTNYHLIEANVQTN-NEVEDYATLSENGMLEYEI--LTQEPKQTIDVEIQSDLEIVKQ-KGKKVQIGSSKLLETCESSCQIGTVLHNSELQTDDKLKFVIQANEKSSPIGLELKDES------TQWGIIPIDNEI--EHGMKKNKKLQIGNSRLEGNLESSCQTGHVVDEFHTQTEEL---------------LFMEPMGLLSKEIQSDIESADKYQI-RLEMKGKKVQVGYPQTYDRIDVECQVQSSFFEAETETISLARNEFEMNEREWTVKTTENKETQIGCSRLDGDFETSCQTGHIVKDFESQTENDYTEHQIQLVTMANNLQAVKSQMKGKKVQVGYPQLN-----------MSFEFGSQFGDDLNDATIQTDS---IEEYINPMTLTDGEIQWND-VEEGSQSSSGLKSKKLQAGSSRLNADYEASCQTGHIVNEIETQTEFFYKTESIL---------------PKEYSNKETQPESEMAITK---GKKIQVGYPHINKISEKEIQIEIDITESSIQTDQ------IGSEKEMINQRSFGLELIDEELQYYGSLQDRLGNELF--YEGKNVQSGSPKLFMELDESCQIGYVKHEAECQTDNEFSDEELVITEVQAELQSQNVLMESKKKEYTEKEIQ-----PILTFYKASNKGKKIQVGHPKLNEFVEVECQSEISIEEIAVQTEIDE-FVIEEIRNKNELAALFVEEMIEESVQYMADDIFTIQYPKETQEKNFQVGNPRIEIDYDTSCQAGHLVRELEIQTDQEPFDGFETQITMVKDQLES-QNIVRTTTEFIEK-----EVQPDFVSEK--SRKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFIIEQTTQINENLTQSSEEMIEELVQYESENLRPITLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQNELLFKEYVDQEVQLDIDDFTGPIPRNTKCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVIDRNLEAFLVNKEMINEATQCNFDLMQPHDG-KLMGIGKKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSISLREIEIQTDDFPGFSVNI----INMNKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASLFIEDLIDEATQYDDEPVKGIINSLREQK---GKKLQVGIPRLDGDFEVSCQT 2047          

HSP 11 Score: 259.225 bits (661), Expect = 1.879e-68
Identity = 437/1727 (25.30%), Postives = 795/1727 (46.03%), Query Frame = 1
Query:  142 LSQKEQKRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTEFDWLPDTSAITLVSKDFNQVARKYSLTDLAEKEIQFELIDDSFLRDEKCKKSKKIQVGFSKLSECSEAECQTGCLMDDTGVQYETDKF-------IIIDFKEDSLETSLRTDNLIHEEIQYDDEDVKMRLSPQAEHKGKIIQAGFSKLGFDLEASCQTGHLIIDSECQTEFDNNNEIISLSLNYQDFSEESSGKIIKYFDDKEIQFDALCDSIPKLHPIKSKKIQVGHTRLNDYREVECQSGCIMDDVEVQTEVDE----------FMIMERKERNLEESLFFDDLIDESTQFDGENLNVTVAVPKEIKGKKLQVGSARLYDDFEVSCQTGHLIMNSECQTEID------NEIDTLTITMHSKDYSERLFREPIKYFEKEIQFETTENSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNE-----IMIMGSKEQNLEASRLIDDLIEESTQYD---DENLNVTISVLKETKGKKLQVGCSKLDEDLEVSCQTGRLIMNSECQTEFNEQIIITMNSPDFTDLKIQQKKDFMEKEMQCDSLDNSLLKENKITK-SMKVQMGLARINECREVECQSGCMMDDVGVQCDXXXXXXXXXXXXXXXASLFIDD-LIDETTQYDDLSLNVRI----ISQ--KEYKGKKLQVGSPRLELDSDMSCQVGHLVFDSECQTESFDSISITKYRSDFSEVPTERHLKDFVEKEIQFELLEDCSSTINNVK--ISKNVQVGQARLAEGRDVECQAVCMKDDVGVQNEVD---EIMIMTERENHFEERFVLDLMIDETTQYGDEIIVYCSLQKDL--------KNKKLQVGNSRLDIDSEVSCQTGNFIMDSECQTEVEDSTDMILITHQFQNFEEERKPHVREFVEKEIQSEFLSRYNKPSSSQVIQVGLSKLNEYKEVECQSEFIVFEMGVQTEAKE---SMIIVGTGRNVDQDLL---IYDLIEETVQ---YNEDVNEAFKKLKGKKLQVGNPYLDSDSEVSCQTGHLLIESECQTELGDEFDTIIKTEHTQDFSEELMERPMKEFVEKEIQF--ETAKSSLSKYNTLENSKEVQVGQSRLVESREVGCQSEYLMNDIGVETE-----ERECWIMEAKYNQENL--SVSYEMIEEIIQYFSDDFTDVPXXXXXXXXXLQAGSSRLLGEMDLLCQTGHLMLDNECQTNKMTTNDIMENFQNELNADESFPTKSLSNQESQYDLCEETV-------LSCQNQALQVGFPKLHQSQEISCQSTVETVDAVVQSE-------SVLTNEEYQLKKQLCQEV--MIEETVQYVPDGFGSISMKPNTKDRAIQNGNSRIQKDIDASYQTEGFTNDSI---CQTD--YSEEENQIDLEIALNQYQANEVVVCNSIEIQSDGLDESLVLEVNREECGVQIGPSRIN-----LCRT----IDSQTQFHGEDVGVQGALDEALIIETTQQNVHSKLIFEDLIVEEIQFNCLLPRSSIK--KDSKGKKLQVGNSRLLDDSDEFTQTELNDSRNIEDLCIQ-QVQSFQNTNTISFSDKEVEP------LFDEEVEFPTTNV---------FKSHSVQVGYPRLNACVDFEGQYSFDI-------DFDGSDHFESSEIEDRVFSKEQFDELI----DETVQYSIGMQSSTYPSSVKVNKKLQVGSSRLEVDHDQSCQT 4935
            +S+K +K KK+QVG+PRL+ +L+V CQ+G L+ + + QTE D        T ++++  Q     S  ++ E+ +Q+E  +   +  +   K KK+Q G S+L    ++ CQTG L+ ++ VQ E D+F       I +  ++   +  L     + +E+Q D +D    +      K K +Q G+ +L   + A CQ+  ++ + + QTE D     + +  N + F    + ++I   +  +  FD +     KL  I  KK+QVG +RL    +  CQ+G I+ D   QTE++E            + E +E   ++S+   ++  ++  F G ++N+        K KK+QVG  RL +  +V CQ+G ++ +   Q E+D      N+   L  ++    + E L  E  +Y ++ ++           ++  K KK+QVG PRL+ + EV CQ+G ++ D   Q ++N+     ++ M SK+    + +L  + ++E  + +   +   + T   +K  K KK+QVG  +L+E L+V CQ+G ++ +   Q E +E +I      +      Q  +D +++  Q D     L   ++  K   K+Q+G++++N   EV CQ+G ++ D   Q      E  +       + +F ++ LI     Y D  +        IS+  K  K KK+QVG PRL    D+ CQ G+++ D   Q E  D   I + +    E      ++D +++  Q++  E     IN+++    K +QVG  RL    +V CQ   +  D   Q +++   E +++T     F E+   + M +    Y  EI   C    D         K+KK+QVG+ RL+   +V CQ+G  + D   Q EV+   + ++  ++ QN E        +F+E  I     ++Y+       I   +S   ++KE+   +  +V +   QT+ +E    +      +   +++L   I D  ++ +Q    ++ ++E  K  K KK+QVG+P L+   +V CQ+G ++ +   Q E+ DEF  +I+    Q+    L    +++ +++  Q+  E  K  ++     +  K++QVG  RL    EV CQ+  ++ D   +T+     E     M +K   E L      E  E+ IQ  + +++     K  K KK+Q G  RL   +D+ CQ+G +M D   Q      ++ M   + E N +E    + L  + +QYD  EE +       +  + + LQVG P+L    E+SCQ+    +D+  Q+E         +T       ++L +E    +E+ +Q+         +    K + IQ G+ R+ K ++   Q+ G   D I   C+TD    EE N+ +LE +L      + ++  +I+   +    +++ +  ++   +Q+G  R++      C+T    IDSQ Q   + +    A+    ++      V  K    DL  +EIQF  L+  S ++  K  K KK+QVG S+L     E ++ E      ++D  +Q +   F     I F +  +E       L  EE+++   +V          K   +Q G+ +L   ++   Q    I       +FD ++   S  +  + FS+E   ++I    D+ +Q+     S      +K +KK+QVG +RL    +  CQ+
Sbjct: 1616 VSEKSRKSKKVQVGHPRLNDNLDVECQSGTLLNEMEIQTELDEFI-IEQTTQINENLTQ-----SSEEMIEELVQYESENLRPITLKTNTKGKKLQTGSSRLENDFDSSCQTGHLVTESEVQTENDEFGGKIDKEIRLANEQTQFQNELLFKEYVDQEVQLDIDDFTGPIPRNT--KCKKVQVGYPRLNLQIHAECQSEIVLQNEDIQTENDELLHEVVIDRNLEAFL--VNKEMIN--EATQCNFDLMQPHDGKLMGI-GKKLQVGTSRLEYDFDASCQTGHIVKDDCDQTEIEETVGSILIESKLALNEFQEMTSKDSISLREIEIQTDDFPGFSVNIINMN----KSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLEASL----FIEDLIDEATQYDDEPVK------GIINSLREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSVETLMITMHSKDF---SEKLFKEPMKEYYEKEIQCETPDDSTSDQIKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVDEFMIEENKEQNLE--ASQFIEDLIDEATQYDDEPVKLTIVSQTKKIGKKLQVGISKMNGDLEVSCQTGHLVIDSESQ--TQLEEPNDKLTTTTYSKVFSEEILIGPIKDYFDKEIQCETTDDSISEHNKANKSKKVQVGHPRLNEILDVECQSGYIMDDIGVQCE-VDEFMIEENKEQNLEASL--FIEDLIDEATQYD-DEPVKGIINSLREQKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSVETLMITMHSKDFSEKLFKEPMKE---YYEKEI--QCETPDDSTSDQIKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEVD---EFMIEENKEQNLE------ASQFIEDLIDE--ATQYDDEPVKLTI---VSNKKDWKEI---TRHLVIDSESQTQLEEPNDKLTTTTYSKVFSEEILIGPIKDYFDKEIQCETTDDSISEHNKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCEV-DEF--MIEENKEQNLEASLF---IEDLIDEATQYDDEPVKVIINSQRE-QKGKKLQVGIPRLDGDFEVSCQTGRIIKDSECQTDLNDSVETLTITMHSKDFSEKLFKEPMKEYYEKEIQCETPNYSISEHNKANKSKKVQVGHPRLNEILDVECQSGCIMDDIGVQCE---VDEFMIEERKEKNLEERLFVEDLIEEATQYD--EENLNVTIGAQIETKGKKLQVGIPRLDVDFEVSCQTGHLIIDSECQTEIDNEIDTLTITMHSKDFSEKLFKEPKNYLEKEIQFETAEVSDSQLVKTKKSKKIQVGHPRLNKSLEGECQS-GCIMDDIGVQCETDEFMIEENNEQNLEASL----LIDDLIEENIQYSDESSSVTVLSQKEQKRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTEFDWLPDTSAI---TLVSKDFNQVARKYSLTDLAEKEIQFE-LIDDSFLRDEKCKKSKKIQVGFSKL----SECSEAECQTGCLMDDTGVQYETDKFI---IIDFKEDSLETSLRTDNLIHEEIQYDDEDVKMRLSPQAEHKGKIIQAGFSKLGFDLEASCQTGHLIIDSECQTEFDNNNEIISLSLNYQDFSEESSGKIIKYFDDKEIQFDALCDSIPKLHPIK-SKKIQVGHTRLNDYREVECQS 3253          

HSP 12 Score: 73.1738 bits (178), Expect = 4.193e-12
Identity = 140/551 (25.41%), Postives = 244/551 (44.28%), Query Frame = 1
Query: 3475 YFSDDFTDVPXXXXXXXXXLQAGSSRLLGEMDLLCQTGHLMLDNECQTNKMTTN--DIMENFQNELNADESFPTKSLSNQESQYDLCEETVLSCQNQALQVGFPKLHQSQEISCQSTVETVDAVVQSESVLTNEEYQLKKQLCQEV------MIEETVQY--VP-DGFGSISMKPNTKDRAIQNGNSRIQKDIDASYQTEGFTNDSICQTDYSEEENQIDLEIALNQYQANEVVVCNSIEIQSDGLDESLVLEVNREECGVQIGPSRINLCRTIDSQTQFHGEDVGVQGALDEALIIETTQQNVHSKLIFEDLIVEEIQFNCLLPRSSIKKDSKGKKLQVGNSRLLDDSDEFTQTELNDSRNIEDLCIQQVQSFQNTNTISFSDKEVEPLFDEEVEFPTTNVFKSHSVQVGYPRLNACVDFEGQYSFDIDFDGSDHFESSEIEDRVFSKEQFDELIDETVQYSIGMQSSTYPSSVKVNKKLQVGSSRLEVDHDQSCQTXXXXXXXXXXX-------XXXPNEIQYSNKQTEPDYPMVSEFAMFKSAGVGVG 5073
            Y  D+ TD+     +K K++Q G S+L GE +   QT + +++   QTN    +   + EN   E       P +++ + E Q DL    ++  + + +Q+G  KL ++ E SCQ     +  V+ +  + T+++ +   Q  ++       + +E+ Q+  +P D      MK N K   +Q GNSR++ ++++S           CQT +  +E     E  L      E +   S EIQSD ++ +   ++  E  G ++          ID + Q       VQ +  EA           ++ I   L   E + N    R    K ++ K+ Q+G SRL  D +   QT               V+ F++     +++ +++ +          +  K   VQVGYP+LN   +F  Q+  D++ D +   ++  IE+ +        L D  +Q++   + S   S +K +KKLQ GSSRL  D++ SCQT     E E +        ++ P E  YSNK+T+P+    SE A+ K   + VG
Sbjct:  844 YIRDNSTDMDSIGQRKNKRIQFGKSKLFGEGEFSSQTNYHLIEANVQTNNEVEDYATLSENGMLEYEILTQEPKQTI-DVEIQSDL---EIVKQKGKKVQIGSSKLLETCESSCQ-----IGTVLHNSELQTDDKLKFVIQANEKSSPIGLELKDESTQWGIIPIDNEIEHGMKKNKK---LQIGNSRLEGNLESS-----------CQTGHVVDEFHTQTEELLFM----EPMGLLSKEIQSD-IESADKYQIRLEMKGKKVQVGYPQTYDRIDVECQ-------VQSSFFEA----------ETETI--SLARNEFEMN---EREWTVKTTENKETQIGCSRLDGDFETSCQTG------------HIVKDFESQTENDYTEHQIQLVTMANNLQAVKSQMKGKKVQVGYPQLNMSFEFGSQFGDDLN-DAT--IQTDSIEEYINPMT----LTDGEIQWNDVEEGSQSSSGLK-SKKLQAGSSRLNADYEASCQTGHIVNEIETQTEFFYKTESILPKE--YSNKETQPE----SEMAITKGKKIQVG 1318          
The following BLAST results are available for this feature:
BLAST of SMED30004725 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004725 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004725 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004725 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004725 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004725 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004725 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004725 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004725 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004725 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004725 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004725 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004725 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004725 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000023005.15.646e-17290.91SMESG000023005.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004725 ID=SMED30004725|Name=SMED30004725|organism=Schmidtea mediterranea sexual|type=transcript|length=7852bp
GATGACATCGGGGTTCAATGTGAGACAGATGAATTCATGATTGAGGAAAA
TAACGAACAAAATCTTGAAGCGAGTTTGTTAATTGACGATCTGATTGAAG
AGAATATTCAGTATAGTGATGAAAGTAGTAGTGTAACAGTGTTGTCACAG
AAAGAACAGAAAAGAAAGAAGTTACAAGTTGGAAATCCAAGATTAGATGG
AGACTTGGAAGTATCATGTCAGACTGGTCATTTGATAATAGATTCACAAT
GCCAGACAGAATTTGATTGGTTACCTGACACCTCAGCCATAACATTGGTT
TCTAAAGATTTTAACCAAGTTGCAAGAAAATATTCGTTGACAGATTTAGC
TGAGAAAGAAATTCAATTCGAATTAATTGATGATTCATTTTTGAGAGACG
AAAAATGTAAAAAGTCAAAGAAAATACAAGTCGGTTTTTCAAAATTAAGT
GAATGTAGTGAAGCCGAATGTCAAACGGGGTGCCTAATGGATGATACCGG
AGTCCAATATGAAACCGATAAATTTATTATAATTGACTTTAAAGAGGATA
GCTTGGAAACAAGTTTGAGAACGGATAATTTAATTCATGAAGAAATACAG
TATGATGATGAAGATGTCAAAATGAGACTTTCACCGCAAGCTGAACACAA
AGGGAAAATAATACAAGCTGGATTTTCCAAGCTAGGTTTTGATTTGGAAG
CGTCGTGCCAAACGGGACATTTAATTATAGATTCAGAATGTCAGACCGAA
TTCGATAATAACAATGAGATTATTAGTCTTTCTTTGAATTATCAAGACTT
TAGTGAAGAAAGCTCAGGAAAAATAATCAAATATTTTGATGATAAAGAAA
TACAGTTTGACGCATTATGTGATTCAATTCCGAAACTTCATCCAATAAAA
TCCAAGAAAATTCAAGTGGGTCATACTAGATTGAATGATTATAGAGAGGT
TGAATGTCAATCGGGATGTATTATGGATGATGTCGAAGTTCAAACGGAAG
TAGATGAATTCATGATAATGGAAAGAAAAGAGCGGAATCTCGAAGAGAGT
TTATTTTTTGACGATCTGATTGATGAATCAACACAATTTGATGGTGAGAA
CTTGAATGTCACGGTTGCTGTGCCAAAGGAAATAAAAGGAAAGAAATTGC
AAGTTGGAAGCGCGAGATTATATGATGATTTTGAGGTTTCATGTCAAACG
GGACATTTAATCATGAATTCAGAATGTCAGACGGAAATTGATAATGAAAT
AGATACATTGACGATAACAATGCATTCCAAGGATTACAGTGAAAGATTAT
TCAGAGAACCCATAAAATACTTCGAGAAAGAAATACAATTTGAAACAACT
GAAAATTCTTATTCGGAACATGTTAAAGCAAATAAATCAAAGAAAGTCCA
AGTCGGTCATCCAAGATTGAATGAAAATTTAGAAGTGGAATGCCAATCAG
GATGCCTAATGGATGACATCGGGGTTCAATGCGAAGTAAATGAAATTATG
ATCATGGGAAGTAAAGAACAAAATCTTGAAGCGAGTCGTTTAATTGACGA
TCTGATTGAAGAATCAACTCAATATGATGACGAGAATTTGAATGTGACTA
TTAGTGTTCTTAAAGAAACGAAAGGAAAAAAATTACAAGTTGGATGTTCT
AAATTAGATGAGGACTTGGAAGTATCTTGTCAAACTGGGCGTTTAATAAT
GAATTCGGAATGTCAAACTGAATTCAATGAACAAATAATTATAACGATGA
ATTCTCCAGATTTTACAGACCTTAAGATTCAACAAAAGAAAGACTTTATG
GAGAAAGAAATGCAGTGTGATTCACTTGACAATTCTTTGCTGAAAGAAAA
TAAAATTACTAAATCAATGAAAGTTCAAATGGGTCTTGCAAGAATTAATG
AATGCCGTGAAGTTGAATGTCAATCAGGATGCATGATGGATGACGTTGGA
GTTCAATGCGATATAAATGAATCCGAAATTATAGAAAGTAGAGAAAGAAA
GATTGAAGCAAGTTTATTCATTGACGATCTGATTGACGAAACAACTCAGT
ATGATGATTTATCTCTCAATGTAAGAATTATATCACAGAAAGAATATAAA
GGAAAGAAATTGCAAGTAGGATCTCCTAGATTAGAATTAGATTCAGATAT
GTCATGTCAAGTTGGACATTTAGTCTTTGATTCTGAATGCCAGACTGAAA
GCTTTGACTCAATTTCAATAACAAAATATAGGTCTGATTTTAGCGAAGTA
CCAACTGAACGACATTTGAAAGATTTCGTTGAGAAAGAAATTCAATTTGA
ACTTTTAGAAGATTGTTCTTCCACAATTAATAATGTGAAAATATCGAAAA
ATGTTCAAGTAGGCCAGGCACGCTTAGCTGAAGGAAGAGATGTTGAATGT
CAAGCTGTGTGCATGAAGGATGACGTTGGCGTTCAAAATGAAGTTGATGA
AATCATGATTATGACTGAAAGAGAAAACCATTTCGAGGAGAGATTTGTGT
TGGATTTAATGATCGACGAGACGACTCAATATGGTGATGAGATAATCGTT
TATTGTTCTCTTCAAAAAGATTTGAAAAATAAGAAATTACAAGTCGGAAA
TTCTAGACTCGACATTGATTCAGAGGTTTCATGTCAAACAGGAAATTTTA
TAATGGATTCTGAATGTCAAACAGAAGTTGAAGATTCAACTGATATGATC
TTGATAACACATCAATTTCAAAACTTCGAGGAAGAAAGAAAACCCCATGT
AAGAGAATTCGTTGAAAAAGAAATACAGTCTGAATTTTTATCTCGATATA
ATAAACCTAGTAGTTCACAGGTTATTCAAGTAGGCCTATCAAAGTTGAAT
GAATATAAAGAAGTAGAATGTCAATCTGAATTTATTGTGTTTGAAATGGG
AGTTCAAACTGAAGCAAAAGAATCTATGATTATTGTAGGCACAGGACGAA
ACGTTGATCAAGATTTACTAATATATGATTTGATTGAGGAAACTGTTCAA
TACAATGAAGATGTCAATGAAGCTTTTAAGAAACTGAAAGGAAAGAAATT
GCAAGTCGGAAATCCTTATTTGGATAGCGATTCAGAAGTTTCCTGTCAAA
CTGGACATTTATTAATTGAATCTGAATGTCAAACTGAGCTGGGTGATGAA
TTTGATACCATTATAAAAACCGAGCATACTCAAGATTTCAGTGAAGAACT
TATGGAACGACCTATGAAAGAATTTGTTGAGAAAGAAATCCAATTCGAAA
CCGCAAAGTCGTCATTGTCAAAATATAACACTCTTGAAAATTCAAAGGAA
GTCCAAGTAGGCCAGTCTCGATTAGTTGAAAGTAGAGAAGTCGGTTGTCA
ATCAGAATATTTAATGAATGATATTGGCGTTGAAACTGAAGAAAGAGAAT
GTTGGATAATGGAAGCAAAATATAACCAAGAAAACTTGAGTGTGTCATAC
GAAATGATAGAGGAAATCATACAATATTTCAGTGATGATTTTACTGATGT
TCCAAAAAAGAAAGATCAGAAAGGAAAGAAATTACAAGCTGGATCTTCAC
GACTGCTCGGAGAAATGGATTTGTTATGTCAAACTGGACATTTGATGTTA
GATAATGAATGCCAAACCAATAAAATGACTACAAATGACATCATGGAAAA
TTTTCAAAATGAATTAAATGCAGATGAAAGTTTTCCTACTAAGTCTTTAT
CAAATCAGGAAAGTCAATATGATCTTTGTGAAGAAACGGTATTGTCGTGT
CAAAATCAAGCTCTTCAAGTCGGTTTTCCTAAATTACATCAATCACAAGA
AATTTCATGCCAATCAACCGTAGAGACTGTTGATGCAGTTGTTCAAAGCG
AATCGGTCCTTACAAATGAAGAATATCAACTTAAGAAGCAACTTTGTCAA
GAAGTTATGATTGAAGAAACCGTTCAATATGTTCCTGATGGATTTGGTTC
AATTTCAATGAAACCAAACACGAAAGATCGTGCGATACAGAATGGCAACT
CGAGAATTCAAAAGGACATTGATGCATCATATCAGACTGAAGGATTCACG
AATGATTCTATTTGCCAAACAGATTACAGCGAAGAAGAAAACCAAATAGA
TCTTGAAATAGCTTTGAACCAATATCAAGCTAACGAAGTTGTCGTTTGTA
ACTCAATTGAAATTCAGTCTGATGGGTTAGATGAATCACTTGTTTTGGAG
GTCAACCGGGAAGAGTGTGGGGTTCAAATTGGACCCAGTAGAATAAATCT
CTGCAGAACTATCGATTCTCAAACTCAATTTCACGGAGAAGATGTCGGTG
TTCAAGGTGCTCTTGATGAAGCTTTGATCATTGAAACCACGCAACAAAAC
GTCCATTCAAAATTAATATTCGAAGATCTTATTGTTGAAGAAATTCAATT
TAACTGCTTACTTCCAAGAAGTTCAATTAAGAAAGACAGTAAAGGGAAAA
AGTTACAAGTCGGTAATTCAAGGTTACTAGACGATTCTGATGAATTCACA
CAAACTGAACTGAACGACAGTCGGAATATTGAGGATTTATGTATTCAACA
AGTCCAATCCTTTCAAAATACAAATACAATTTCTTTTTCAGACAAAGAAG
TGGAGCCGCTTTTCGACGAAGAAGTCGAATTTCCGACCACAAATGTTTTT
AAATCACACTCCGTTCAAGTTGGATATCCTAGATTGAATGCTTGTGTTGA
TTTTGAAGGACAATACTCGTTTGACATTGATTTCGATGGAAGTGATCATT
TCGAGAGTTCAGAAATTGAAGATCGTGTTTTTTCGAAAGAACAATTCGAT
GAATTGATTGATGAAACTGTGCAATACAGTATTGGAATGCAAAGTTCTAC
TTATCCAAGCAGTGTAAAAGTTAATAAGAAATTACAAGTCGGCAGTTCAC
GTTTAGAAGTCGATCATGATCAGTCATGTCAGACAATAAAGGAGGAGGCT
GAAAAAGAAATTAAACATGCGTTAGAGCCGAATGAAATTCAATATTCCAA
TAAGCAAACTGAACCCGACTATCCAATGGTTTCTGAATTTGCAATGTTTA
AAAGTGCAGGAGTTGGTGTTGGAAAGACCGATGCATTCCAAAATTTTGAC
CATAGATCAAGAAACGTTTTCCGCCACAATCAAAGTGAAAGACTCATTTC
TGTTGGAACGGCTACTTGGGATTATGATAAGAACAAATACAAATTGTTGA
CCATTGACTTACAGTACGGCACTGAGTTGGTGTTCAAGTCCGAAAAGCAA
CAAACAGAGGATCAATTTTCTCCGCAGATAAAAACTAAGTCTGTCGAATG
TTTTGAAACTCCGATTCCCACAGTAAATAAATCCGTTCAAGTTGAAACCG
AATTAACTGACTCTGTTACTCAAACATCCGATTACTCTGAATCCCATTCA
GTTTCCATTCAAATATCTCCAAAAGTTTCAAAATTTGAAAACGAAGCCCA
TTTGATTCTGAATTACTTCAACAAGCAAGTTGACATTCGCAACGACAATC
TCACTTCTATTACAACTCCAATTTGCGATTTACAACCGACACAGTTCATT
TCCTGTGACATTGAGAAAGATTTCCGAACCATTCTATGTGATAAAATGAT
CCAGTATTCTCGGCGACATCCGATTTACTTAGATAAGTTGACGGATTTCC
AACTTTCCACGGACATGGTTGAATTCGACCAACAGCACAACACGAAACTG
CAAATGTGCGATAGACTGGTTTCGTATTTGGCAAGAAAATCCACTAGTGA
GGCATGTTTTGAATATGATTTCTTTGCCGGGAAATCTTTGACAGACATTT
CAATGATTCCCAGCTCAAATACCAAAGATTTTATCAATCTATTCGAATCA
AGCGCCATCCAGCAAGAAAGAAAGAGCTCCGATATCGAGAACTTATCAAA
GAAAAAATCTTCAAATTATTTTGATGAATTTCCAGATTCCTTAGAAATTA
ACCTTGTTCCAAAACTTATAACTATTGACTCTAAAAGTATCAAGTTGATA
GATGAAGAAGTAATGTATGAAGATCCCAGAAGTTACATTGAGGTGACAGT
AGAACACGATAGCAGTATTGATGCCAGCTATATATCCAACCTTCAATGTG
GTGTGAATAAAGATGATAGTGAAGCAAATCTCATAGAATCGGAAACGCAA
ATGAAATTGGAAAGTCTTTTAGACGATAAAACAATGCTCAAGTCAGATAA
GTCCTTCATTGAATTCTCGATGAATCATGACTGCAATAGTGACAATTTAG
TTGATAGCAAAATAATACTTGAAAACACCTTGACGGAAGCTATTGAGATC
AGTCTAATACCCAAATTGATCTCCAATCAATCTGTCAGAAAAACGGAATC
CATTCTTACAGAGGTAAAGATTCCTGAAACAAAATTCAAACCGATTTCCT
CGGTGGATTTCATTCAATTCGACAACAAAATGACCTCTACTCCTGAATTG
GTGGAGAAATCTAATTTCGGAACTCAGATTTATGCCCAACCCGCCTATGA
TGGTCAAACCCAAACCAATATTTCCAGTAGCGATTTCGGAACACAAGTAA
CCGATTCGTCGTCTATTTCTCCATTAACGGTATCAATTCCTCTCTATTCA
ACTGATAGACAATCCGTTTTGGCTAGCCTAGGAACGGCGACTCATAATTC
CATTGCCACCGATGCTTATTTCGAAGACGACTACATCGTTGAATGCGTCA
AATCTCGTTCGATTGTTACAAAAAAACAAGAAGTTCTTCCAAAATTTTCG
CATGATTTCACTGATATTAAAGAAGAACCAGCAAAACTTTTCGTAACGTA
CCAAGAGAAAACCAAACCGAAATTATGTGACACGAAAACTCAGAGTTATC
ACAGTGATCACTGTAAAGACTCCTGCAGTCAAACTCATTTGGAGTTGTGT
TTCAGAGATGATGAGTTGATGAAAGTGTATAAGAAATTAATTTCAAGCAA
ACATCTAAAGGAGCAAGGAGTTCAAGAATCAAATGCCGATGGGTTATTTG
AGGTTTTGGCGAAAACCAAAGGATTGCGTTATATCCTAAATAAATACCAA
AGTGCTTGCACTATTCATGACCAATCAAATCAAACAGAACAACTCATCAC
AATGAATTCTACAAGAACTCAATATGATCCGGAAAATGTCAAATCCCTCG
ATGTTAAACCAACCAATTCAATGCCCGAGAGACTTTCCGTTACTAGCGCC
GATCACGATATCGCCGGTTCAATGATTAGCAGTTTCAATAGTAGACCTTC
ACATAAAAACAAACGAGTTCAAAGAGGCTGTAGTTTTTTCAAGTTGAAAG
ATGCCAACACGAATACCGACGAGAGTCTCGATGACCATATCGAAGTCACA
TACACCGAAACGATATTGGAAGAATCTGTCATTACGAAGCGTCCTTTGTC
GAAAATGGATGATCATTATGATTTTTCGAAATCATCAAGTCTAACGAGAA
GATCAGCAAGTTCAACGTCGATTCCAGTGTCGAATCAAACTCACAGATAT
ATCCAAACACTCCTTTATCCGTCACAGATCTTTATTGCGGAGGAAAATTG
CGACCAATATTTGACAATTATCAAATCCTATCATGTTACCGCGGTTTATG
ATTATAGTTCTAGAAAATATCAGTCCTTGAGAGACGCCTTCAGAACTGGA
ATTATAGATCTGGAAAACGACAAATATCGCCAGTCGAGCACGGAATTTAT
TTCAATAGAAACCGCTTTGGAAAAAGGCTTTTTGATTATGAAACACGACT
TTTGATTTTTATGTAATTTATGATTGTTTTTATCGACGAACTATTTATTG
CTTTAATAATAATATTTTATTGTTTTTAATAAATTTTGACACTATCAAAA
AA
back to top

protein sequence of SMED30004725-orf-1

>SMED30004725-orf-1 ID=SMED30004725-orf-1|Name=SMED30004725-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2585bp
DDIGVQCETDEFMIEENNEQNLEASLLIDDLIEENIQYSDESSSVTVLSQ
KEQKRKKLQVGNPRLDGDLEVSCQTGHLIIDSQCQTEFDWLPDTSAITLV
SKDFNQVARKYSLTDLAEKEIQFELIDDSFLRDEKCKKSKKIQVGFSKLS
ECSEAECQTGCLMDDTGVQYETDKFIIIDFKEDSLETSLRTDNLIHEEIQ
YDDEDVKMRLSPQAEHKGKIIQAGFSKLGFDLEASCQTGHLIIDSECQTE
FDNNNEIISLSLNYQDFSEESSGKIIKYFDDKEIQFDALCDSIPKLHPIK
SKKIQVGHTRLNDYREVECQSGCIMDDVEVQTEVDEFMIMERKERNLEES
LFFDDLIDESTQFDGENLNVTVAVPKEIKGKKLQVGSARLYDDFEVSCQT
GHLIMNSECQTEIDNEIDTLTITMHSKDYSERLFREPIKYFEKEIQFETT
ENSYSEHVKANKSKKVQVGHPRLNENLEVECQSGCLMDDIGVQCEVNEIM
IMGSKEQNLEASRLIDDLIEESTQYDDENLNVTISVLKETKGKKLQVGCS
KLDEDLEVSCQTGRLIMNSECQTEFNEQIIITMNSPDFTDLKIQQKKDFM
EKEMQCDSLDNSLLKENKITKSMKVQMGLARINECREVECQSGCMMDDVG
VQCDINESEIIESRERKIEASLFIDDLIDETTQYDDLSLNVRIISQKEYK
GKKLQVGSPRLELDSDMSCQVGHLVFDSECQTESFDSISITKYRSDFSEV
PTERHLKDFVEKEIQFELLEDCSSTINNVKISKNVQVGQARLAEGRDVEC
QAVCMKDDVGVQNEVDEIMIMTERENHFEERFVLDLMIDETTQYGDEIIV
YCSLQKDLKNKKLQVGNSRLDIDSEVSCQTGNFIMDSECQTEVEDSTDMI
LITHQFQNFEEERKPHVREFVEKEIQSEFLSRYNKPSSSQVIQVGLSKLN
EYKEVECQSEFIVFEMGVQTEAKESMIIVGTGRNVDQDLLIYDLIEETVQ
YNEDVNEAFKKLKGKKLQVGNPYLDSDSEVSCQTGHLLIESECQTELGDE
FDTIIKTEHTQDFSEELMERPMKEFVEKEIQFETAKSSLSKYNTLENSKE
VQVGQSRLVESREVGCQSEYLMNDIGVETEERECWIMEAKYNQENLSVSY
EMIEEIIQYFSDDFTDVPKKKDQKGKKLQAGSSRLLGEMDLLCQTGHLML
DNECQTNKMTTNDIMENFQNELNADESFPTKSLSNQESQYDLCEETVLSC
QNQALQVGFPKLHQSQEISCQSTVETVDAVVQSESVLTNEEYQLKKQLCQ
EVMIEETVQYVPDGFGSISMKPNTKDRAIQNGNSRIQKDIDASYQTEGFT
NDSICQTDYSEEENQIDLEIALNQYQANEVVVCNSIEIQSDGLDESLVLE
VNREECGVQIGPSRINLCRTIDSQTQFHGEDVGVQGALDEALIIETTQQN
VHSKLIFEDLIVEEIQFNCLLPRSSIKKDSKGKKLQVGNSRLLDDSDEFT
QTELNDSRNIEDLCIQQVQSFQNTNTISFSDKEVEPLFDEEVEFPTTNVF
KSHSVQVGYPRLNACVDFEGQYSFDIDFDGSDHFESSEIEDRVFSKEQFD
ELIDETVQYSIGMQSSTYPSSVKVNKKLQVGSSRLEVDHDQSCQTIKEEA
EKEIKHALEPNEIQYSNKQTEPDYPMVSEFAMFKSAGVGVGKTDAFQNFD
HRSRNVFRHNQSERLISVGTATWDYDKNKYKLLTIDLQYGTELVFKSEKQ
QTEDQFSPQIKTKSVECFETPIPTVNKSVQVETELTDSVTQTSDYSESHS
VSIQISPKVSKFENEAHLILNYFNKQVDIRNDNLTSITTPICDLQPTQFI
SCDIEKDFRTILCDKMIQYSRRHPIYLDKLTDFQLSTDMVEFDQQHNTKL
QMCDRLVSYLARKSTSEACFEYDFFAGKSLTDISMIPSSNTKDFINLFES
SAIQQERKSSDIENLSKKKSSNYFDEFPDSLEINLVPKLITIDSKSIKLI
DEEVMYEDPRSYIEVTVEHDSSIDASYISNLQCGVNKDDSEANLIESETQ
MKLESLLDDKTMLKSDKSFIEFSMNHDCNSDNLVDSKIILENTLTEAIEI
SLIPKLISNQSVRKTESILTEVKIPETKFKPISSVDFIQFDNKMTSTPEL
VEKSNFGTQIYAQPAYDGQTQTNISSSDFGTQVTDSSSISPLTVSIPLYS
TDRQSVLASLGTATHNSIATDAYFEDDYIVECVKSRSIVTKKQEVLPKFS
HDFTDIKEEPAKLFVTYQEKTKPKLCDTKTQSYHSDHCKDSCSQTHLELC
FRDDELMKVYKKLISSKHLKEQGVQESNADGLFEVLAKTKGLRYILNKYQ
SACTIHDQSNQTEQLITMNSTRTQYDPENVKSLDVKPTNSMPERLSVTSA
DHDIAGSMISSFNSRPSHKNKRVQRGCSFFKLKDANTNTDESLDDHIEVT
YTETILEESVITKRPLSKMDDHYDFSKSSSLTRRSASSTSIPVSNQTHRY
IQTLLYPSQIFIAEENCDQYLTIIKSYHVTAVYDYSSRKYQSLRDAFRTG
IIDLENDKYRQSSTEFISIETALEKGFLIMKHDF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000096ventral epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 14..34