Regulator of chromosome condensation

Overview
NameRegulator of chromosome condensation
Smed IDSMED30004700
Length (bp)2011
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Regulator of chromosome condensation (SMED30004700) t-SNE clustered cells

Violin plots show distribution of expression levels for Regulator of chromosome condensation (SMED30004700) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Regulator of chromosome condensation (SMED30004700) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Regulator of chromosome condensation (SMED30004700) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004700

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30004700SMESG000019132.1 SmedASXL_015054SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30004700SMESG000019132.1 SmedASXL_015054SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30004700SMESG000019132.1 dd_Smed_v4_4136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004700SMESG000019132.1 dd_Smed_v4_4136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004700SMESG000019132.1 dd_Smed_v4_4136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004700SMESG000019132.1 dd_Smed_v4_4136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004700SMESG000019132.1 dd_Smed_v4_4136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004700SMESG000019132.1 dd_Smed_v4_4136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Regulator of chromosome condensation vs. Ensembl Human
Match: RCC1 (regulator of chromosome condensation 1 [Source:HGNC Symbol;Acc:HGNC:1913])

HSP 1 Score: 342.428 bits (877), Expect = 5.521e-111
Identity = 175/421 (41.57%), Postives = 257/421 (61.05%), Query Frame = 3
Query:   63 KRRQDSVGGTQKKAKFDLSYVEEECKRTFITQIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV-----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRD 1310
            KRR        K  K  +S+      R+  T+ P  V+++G GD GQLGLGE+V+E+K+PALVS  +DV++  AGGMH++CLSKSGQVY+FGCNDEGALGR    +    VPG+V+L +  KV+ ++AGD+H++ LT+DG+V++WGSFRDNNG+IGLL+P +K      V +D  ++K+ASG +H  ML+ +G+++T GC EQGQLGRV     +        R  +   ++      R  V+F D + G++ T A S  G VYG GL+NY QLG        +  +L  F N  + W  F+ GQHHT+ + +  + Y +GR EYG LG G+         ++     + ++A      YA+  DG V++WGMG++YQLG G DED   P +M+GKQ+ N  ++ +S G QH +    D++
Sbjct:    8 KRRSPPADAIPKSKKVKVSH------RSHSTE-PGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQE--KVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKE 419          
BLAST of Regulator of chromosome condensation vs. Ensembl Human
Match: RCC1 (regulator of chromosome condensation 1 [Source:HGNC Symbol;Acc:HGNC:1913])

HSP 1 Score: 342.428 bits (877), Expect = 5.521e-111
Identity = 175/421 (41.57%), Postives = 257/421 (61.05%), Query Frame = 3
Query:   63 KRRQDSVGGTQKKAKFDLSYVEEECKRTFITQIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV-----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRD 1310
            KRR        K  K  +S+      R+  T+ P  V+++G GD GQLGLGE+V+E+K+PALVS  +DV++  AGGMH++CLSKSGQVY+FGCNDEGALGR    +    VPG+V+L +  KV+ ++AGD+H++ LT+DG+V++WGSFRDNNG+IGLL+P +K      V +D  ++K+ASG +H  ML+ +G+++T GC EQGQLGRV     +        R  +   ++      R  V+F D + G++ T A S  G VYG GL+NY QLG        +  +L  F N  + W  F+ GQHHT+ + +  + Y +GR EYG LG G+         ++     + ++A      YA+  DG V++WGMG++YQLG G DED   P +M+GKQ+ N  ++ +S G QH +    D++
Sbjct:    8 KRRSPPADAIPKSKKVKVSH------RSHSTE-PGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQE--KVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKE 419          
BLAST of Regulator of chromosome condensation vs. Ensembl Human
Match: RCC1 (regulator of chromosome condensation 1 [Source:HGNC Symbol;Acc:HGNC:1913])

HSP 1 Score: 342.428 bits (877), Expect = 5.521e-111
Identity = 175/421 (41.57%), Postives = 257/421 (61.05%), Query Frame = 3
Query:   63 KRRQDSVGGTQKKAKFDLSYVEEECKRTFITQIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV-----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRD 1310
            KRR        K  K  +S+      R+  T+ P  V+++G GD GQLGLGE+V+E+K+PALVS  +DV++  AGGMH++CLSKSGQVY+FGCNDEGALGR    +    VPG+V+L +  KV+ ++AGD+H++ LT+DG+V++WGSFRDNNG+IGLL+P +K      V +D  ++K+ASG +H  ML+ +G+++T GC EQGQLGRV     +        R  +   ++      R  V+F D + G++ T A S  G VYG GL+NY QLG        +  +L  F N  + W  F+ GQHHT+ + +  + Y +GR EYG LG G+         ++     + ++A      YA+  DG V++WGMG++YQLG G DED   P +M+GKQ+ N  ++ +S G QH +    D++
Sbjct:    8 KRRSPPADAIPKSKKVKVSH------RSHSTE-PGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQE--KVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKE 419          
BLAST of Regulator of chromosome condensation vs. Ensembl Human
Match: RCC1 (regulator of chromosome condensation 1 [Source:HGNC Symbol;Acc:HGNC:1913])

HSP 1 Score: 342.813 bits (878), Expect = 1.276e-110
Identity = 167/388 (43.04%), Postives = 245/388 (63.14%), Query Frame = 3
Query:  162 PSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV-----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRD 1310
            P  V+++G GD GQLGLGE+V+E+K+PALVS  +DV++  AGGMH++CLSKSGQVY+FGCNDEGALGR    +    VPG+V+L +  KV+ ++AGD+H++ LT+DG+V++WGSFRDNNG+IGLL+P +K      V +D  ++K+ASG +H  ML+ +G+++T GC EQGQLGRV     +        R  +   ++      R  V+F D + G++ T A S  G VYG GL+NY QLG        +  +L  F N  + W  F+ GQHHT+ + +  + Y +GR EYG LG G+         ++     + ++A      YA+  DG V++WGMG++YQLG G DED   P +M+GKQ+ N  ++ +S G QH +    D++
Sbjct:   65 PGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQE--KVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKE 450          
BLAST of Regulator of chromosome condensation vs. Ensembl Human
Match: RCC1 (regulator of chromosome condensation 1 [Source:HGNC Symbol;Acc:HGNC:1913])

HSP 1 Score: 342.813 bits (878), Expect = 1.276e-110
Identity = 167/388 (43.04%), Postives = 245/388 (63.14%), Query Frame = 3
Query:  162 PSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV-----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRD 1310
            P  V+++G GD GQLGLGE+V+E+K+PALVS  +DV++  AGGMH++CLSKSGQVY+FGCNDEGALGR    +    VPG+V+L +  KV+ ++AGD+H++ LT+DG+V++WGSFRDNNG+IGLL+P +K      V +D  ++K+ASG +H  ML+ +G+++T GC EQGQLGRV     +        R  +   ++      R  V+F D + G++ T A S  G VYG GL+NY QLG        +  +L  F N  + W  F+ GQHHT+ + +  + Y +GR EYG LG G+         ++     + ++A      YA+  DG V++WGMG++YQLG G DED   P +M+GKQ+ N  ++ +S G QH +    D++
Sbjct:   65 PGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQE--KVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKE 450          
BLAST of Regulator of chromosome condensation vs. Ensembl Celegans
Match: ran-3 (Regulator of chromosome condensation [Source:UniProtKB/Swiss-Prot;Acc:Q18211])

HSP 1 Score: 151.754 bits (382), Expect = 7.517e-39
Identity = 122/385 (31.69%), Postives = 184/385 (47.79%), Query Frame = 3
Query:  270 IEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVP-GEVKLPDDI----KVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIG---LLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXX-XXXXHSVKFCD-----LWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKF------AFGQ----------HHTIALSASNRIYVIGRGEYGNLGQG------DNEHRTKAT--EVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHG-DDED---VNVPTKMVGKQVSNMKIIEISPGFQHVLFRA 1298
            ++  AGG+HS  L+  G+VY  G N++G +    VE E +T    +VK  +DI    K++ + AG + ++ LT+ G V  WG+ R++NG +    LL   ++ P   +    +KI+KIA+GENH  ML + G + TFG  E GQLGR S    +R             + +R +H  KF D     ++A  F TI     G+ Y  GLNNY QLG++ D        +G+      + + F      AFG            H + L +  +++ +G+     LG G      D +H    T  E+  DS  I+ ++A   TS A   DGT Y+WG  ++ QLG G  DED   V+ P ++    +    II  S   QH L  A
Sbjct:  188 LQAVAGGVHSAVLTSEGEVYMCGINEKGTVPAEGVEKEGSTDEFAKVKFEEDIEKEGKIVMLAAGASFTAALTDQGSVIAWGNLRNSNGNVDVHPLLHKMQEAPVVIVHQAKRKIVKIAAGENHLVMLDEKGCLLTFGDGEMGQLGRSSRTKTIRSKYMCDESGDHLLVPLRFKHKGKFFDVVAKNVFASGFWTIVHGEDGKYYAFGLNNYAQLGIKVD-----EADVGQDGQDNRELRVFLPAEAPAFGAERTFVNIEGVQHVVILGSDGKVFAMGKNTDNALGLGNWTGKDDQQHWLYDTIQEIEFDSK-IVGVSAKLATSIAWSEDGTAYAWGFDTTGQLGLGLKDEDEKMVSKPEEISSAHLDGYSIIGASISDQHTLIIA 566          
BLAST of Regulator of chromosome condensation vs. Ensembl Celegans
Match: herc-1 (HECT and RCC domain E3 ubiquitin ligase [Source:UniProtKB/TrEMBL;Acc:W6RY72])

HSP 1 Score: 102.834 bits (255), Expect = 2.537e-22
Identity = 92/323 (28.48%), Postives = 149/323 (46.13%), Query Frame = 3
Query:  267 VIEVRAGGMHSICLSKSGQVYTFGCNDEGALGR-TIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQ-LGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDN-EHRTKATEVM-LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTK 1223
            V  V  G  H++ L+K G++++ G N +G LGR +  E   +  P  V      K+I I+AG +H+  +T+DG+V+ WGS  + +G +G+   F    +   V     I+++ASG NH   L + G +F +G    G+ + R  P                   V     V    + AG+   +A S +G V+  G NN  +LG+++   Q  +  + + + L     + A G +HT+ L+   R +  G    G  G G   E RT  T V  L  + +  IAA    + A+   G  Y +G+ SS QLG+G     + P K
Sbjct:   43 VTSVTCGEQHTVFLTKDGKMWSVGSNMDGQLGRGSRTEGSFSIYP--VSWTSSAKIIQISAGRSHTVSVTDDGRVFAWGS--NEHGQLGMESKFTWQGTPRRVQEINDIVQVASGSNHCIALDEGGRVFVWGEQADGRCIHRPEP-------------------VEQLSGVPIVRVLAGARHCLALSASGAVFTWGQNNSGELGIDDLRPQTSVQHVHQMDGLGV--VEAACGDNHTVLLTHCGRTFSFGSDALGQCGFGKKVEKRTNPTAVSDLIGSHVTRIAAGACHTIAICK-GAPYPFGLNSSGQLGNGKIMTQSTPRK 339          

HSP 2 Score: 76.6406 bits (187), Expect = 3.722e-14
Identity = 50/173 (28.90%), Postives = 85/173 (49.13%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGL--LKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLG 683
            V + GS + GQLG+      +  P  V  + D+++V +G  H I L + G+V+ +G   E A GR I        P  V+    + ++ + AG  H   L+  G V+ WG  ++N+G +G+  L+P   +     +     +++ A G+NH  +L+  G  F+FG    GQ G
Sbjct:  115 VFAWGSNEHGQLGMESKFTWQGTPRRVQEINDIVQVASGSNHCIALDEGGRVFVWG---EQADGRCIHR------PEPVEQLSGVPIVRVLAGARHCLALSASGAVFTWG--QNNSGELGIDDLRPQTSVQHVHQMD-GLGVVEAACGDNHTVLLTHCGRTFSFGSDALGQCG 275          

HSP 3 Score: 56.225 bits (134), Expect = 6.746e-8
Identity = 41/126 (32.54%), Postives = 65/126 (51.59%), Query Frame = 3
Query:  333 FGCND--EGALGRTIVEDEDATVPGEVKLPDDI---KVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVD----KKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLG 683
             GC    EG LG  + E         +  P+D+    V  +T G+ H+  LT+DGK++  GS  + +G +G     E   S ++ PV      KII+I++G +H   ++D+G +F +G  E GQLG
Sbjct:    6 LGCGHTGEGQLGVRLSESTIQVPERIIGAPNDMDGTAVTSVTCGEQHTVFLTKDGKMWSVGS--NMDGQLGRGSRTEG--SFSIYPVSWTSSAKIIQISAGRSHTVSVTDDGRVFAWGSNEHGQLG 127          
BLAST of Regulator of chromosome condensation vs. Ensembl Celegans
Match: herc-1 (HECT and RCC domain E3 ubiquitin ligase [Source:UniProtKB/TrEMBL;Acc:W6RY72])

HSP 1 Score: 102.834 bits (255), Expect = 2.537e-22
Identity = 92/323 (28.48%), Postives = 149/323 (46.13%), Query Frame = 3
Query:  267 VIEVRAGGMHSICLSKSGQVYTFGCNDEGALGR-TIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQ-LGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDN-EHRTKATEVM-LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTK 1223
            V  V  G  H++ L+K G++++ G N +G LGR +  E   +  P  V      K+I I+AG +H+  +T+DG+V+ WGS  + +G +G+   F    +   V     I+++ASG NH   L + G +F +G    G+ + R  P                   V     V    + AG+   +A S +G V+  G NN  +LG+++   Q  +  + + + L     + A G +HT+ L+   R +  G    G  G G   E RT  T V  L  + +  IAA    + A+   G  Y +G+ SS QLG+G     + P K
Sbjct:   43 VTSVTCGEQHTVFLTKDGKMWSVGSNMDGQLGRGSRTEGSFSIYP--VSWTSSAKIIQISAGRSHTVSVTDDGRVFAWGS--NEHGQLGMESKFTWQGTPRRVQEINDIVQVASGSNHCIALDEGGRVFVWGEQADGRCIHRPEP-------------------VEQLSGVPIVRVLAGARHCLALSASGAVFTWGQNNSGELGIDDLRPQTSVQHVHQMDGLGV--VEAACGDNHTVLLTHCGRTFSFGSDALGQCGFGKKVEKRTNPTAVSDLIGSHVTRIAAGACHTIAICK-GAPYPFGLNSSGQLGNGKIMTQSTPRK 339          

HSP 2 Score: 76.6406 bits (187), Expect = 3.722e-14
Identity = 50/173 (28.90%), Postives = 85/173 (49.13%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGL--LKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLG 683
            V + GS + GQLG+      +  P  V  + D+++V +G  H I L + G+V+ +G   E A GR I        P  V+    + ++ + AG  H   L+  G V+ WG  ++N+G +G+  L+P   +     +     +++ A G+NH  +L+  G  F+FG    GQ G
Sbjct:  115 VFAWGSNEHGQLGMESKFTWQGTPRRVQEINDIVQVASGSNHCIALDEGGRVFVWG---EQADGRCIHR------PEPVEQLSGVPIVRVLAGARHCLALSASGAVFTWG--QNNSGELGIDDLRPQTSVQHVHQMD-GLGVVEAACGDNHTVLLTHCGRTFSFGSDALGQCG 275          

HSP 3 Score: 56.225 bits (134), Expect = 6.746e-8
Identity = 41/126 (32.54%), Postives = 65/126 (51.59%), Query Frame = 3
Query:  333 FGCND--EGALGRTIVEDEDATVPGEVKLPDDI---KVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVD----KKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLG 683
             GC    EG LG  + E         +  P+D+    V  +T G+ H+  LT+DGK++  GS  + +G +G     E   S ++ PV      KII+I++G +H   ++D+G +F +G  E GQLG
Sbjct:    6 LGCGHTGEGQLGVRLSESTIQVPERIIGAPNDMDGTAVTSVTCGEQHTVFLTKDGKMWSVGS--NMDGQLGRGSRTEG--SFSIYPVSWTSSAKIIQISAGRSHTVSVTDDGRVFAWGSNEHGQLG 127          
BLAST of Regulator of chromosome condensation vs. Ensembl Celegans
Match: rpm-1 (E3 ubiquitin-protein ligase rpm-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17551])

HSP 1 Score: 67.3958 bits (163), Expect = 3.292e-11
Identity = 31/92 (33.70%), Postives = 56/92 (60.87%), Query Frame = 3
Query:  414 PDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEK-IPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGR 686
            P D+KV  ++ G+ H+ +L  D +V+ +GS  + +G +G+     K  P   ++P D  I+++A+G NH  + +++G +FTFG   +GQL R
Sbjct:  764 PHDVKVSSVSCGNFHTVLLASDRRVFTFGS--NCHGQLGVGDTLSKNTPQQVILPSDTVIVQVAAGSNHTILRANDGSVFTFGAFGKGQLAR 853          

HSP 2 Score: 58.9214 bits (141), Expect = 1.175e-8
Identity = 36/119 (30.25%), Postives = 57/119 (47.90%), Query Frame = 3
Query:  267 VIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFA 623
            V  V  G  H++ L+   +V+TFG N  G LG  + +      P +V LP D  ++ + AG NH+ +   DG V+ +G+F    G   L +P  +      +P  +K+     G N FA
Sbjct:  769 VSSVSCGNFHTVLLASDRRVFTFGSNCHGQLG--VGDTLSKNTPQQVILPSDTVIVQVAAGSNHTILRANDGSVFTFGAF----GKGQLARPAGEKAGWNAIP--EKVSGFGPGFNAFA 879          
BLAST of Regulator of chromosome condensation vs. Ensembl Celegans
Match: F07B7.12 (pep chromosome:WBcel235:V:8854993:8862049:-1 gene:WBGene00017190.1 transcript:F07B7.12.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F07B7.12)

HSP 1 Score: 67.3958 bits (163), Expect = 3.306e-11
Identity = 31/92 (33.70%), Postives = 56/92 (60.87%), Query Frame = 3
Query:  414 PDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEK-IPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGR 686
            P D+KV  ++ G+ H+ +L  D +V+ +GS  + +G +G+     K  P   ++P D  I+++A+G NH  + +++G +FTFG   +GQL R
Sbjct:  764 PHDVKVSSVSCGNFHTVLLASDRRVFTFGS--NCHGQLGVGDTLSKNTPQQVILPSDTVIVQVAAGSNHTILRANDGSVFTFGAFGKGQLAR 853          

HSP 2 Score: 58.9214 bits (141), Expect = 1.077e-8
Identity = 36/119 (30.25%), Postives = 57/119 (47.90%), Query Frame = 3
Query:  267 VIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFA 623
            V  V  G  H++ L+   +V+TFG N  G LG  + +      P +V LP D  ++ + AG NH+ +   DG V+ +G+F    G   L +P  +      +P  +K+     G N FA
Sbjct:  769 VSSVSCGNFHTVLLASDRRVFTFGSNCHGQLG--VGDTLSKNTPQQVILPSDTVIVQVAAGSNHTILRANDGSVFTFGAF----GKGQLARPAGEKAGWNAIP--EKVSGFGPGFNAFA 879          
BLAST of Regulator of chromosome condensation vs. Ensembl Fly
Match: Rcc1 (gene:FBgn0002638 transcript:FBtr0077075)

HSP 1 Score: 266.159 bits (679), Expect = 1.674e-80
Identity = 163/405 (40.25%), Postives = 235/405 (58.02%), Query Frame = 3
Query:   96 KKAKFDLSYVEEECKRTFITQIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVD----KKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAK-STTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGD-NEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLF 1292
            K+A+    ++E   +RT +      V+  G+GD GQLGLGED+LE+KR + V+ + D +++ AGGMH++ L+KSG +Y+FGCNDEGALGR   ED   + P  + LP   K + I+AGD+HS+ L EDG+V+ WGSFRD++G +GL      I      P+D         IASG +H  +L+  G++FT GCAEQGQLGR+S  ++   GR G   LL P  + +  +  F  +WA ++CT  + S T  ++  GLNN+KQL  E    +  +T +     LK D +  A GQHHT+ L+   +  V+GR EYG LG GD  +   K T V   +  I+++      SYA+  DG +YSWG G + QLG GD +D   P  +V K      ++  S G QH +F
Sbjct:   24 KRARIAF-HLELPKRRTVLGN----VLVCGNGDVGQLGLGEDILERKRLSPVAGIPDAVDISAGGMHNLVLTKSGDIYSFGCNDEGALGRDTSEDGSESKPDLIDLPG--KALCISAGDSHSACLLEDGRVFAWGSFRDSHGNMGLT-----IDGNKRTPIDLMEGTVCCSIASGADHLVILTTAGKVFTVGCAEQGQLGRLSERSISGEGRRGKRDLLRPTQLIITRAKPFEAIWATNYCTFMRESQTQVIWATGLNNFKQLAHETKGKEFALTPI--KTELK-DIRHIAGGQHHTVILTTDLKCSVVGRPEYGRLGLGDVKDVVEKPTIVKKLTEKIVSVGCGEVCSYAVTIDGKLYSWGSGVNNQLGVGDGDDELEPIVVVSKNTQGKHMLLASGGGQHAIF 413          
BLAST of Regulator of chromosome condensation vs. Ensembl Fly
Match: Rcc1 (gene:FBgn0002638 transcript:FBtr0077076)

HSP 1 Score: 266.159 bits (679), Expect = 1.674e-80
Identity = 163/405 (40.25%), Postives = 235/405 (58.02%), Query Frame = 3
Query:   96 KKAKFDLSYVEEECKRTFITQIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVD----KKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAK-STTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGD-NEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLF 1292
            K+A+    ++E   +RT +      V+  G+GD GQLGLGED+LE+KR + V+ + D +++ AGGMH++ L+KSG +Y+FGCNDEGALGR   ED   + P  + LP   K + I+AGD+HS+ L EDG+V+ WGSFRD++G +GL      I      P+D         IASG +H  +L+  G++FT GCAEQGQLGR+S  ++   GR G   LL P  + +  +  F  +WA ++CT  + S T  ++  GLNN+KQL  E    +  +T +     LK D +  A GQHHT+ L+   +  V+GR EYG LG GD  +   K T V   +  I+++      SYA+  DG +YSWG G + QLG GD +D   P  +V K      ++  S G QH +F
Sbjct:   24 KRARIAF-HLELPKRRTVLGN----VLVCGNGDVGQLGLGEDILERKRLSPVAGIPDAVDISAGGMHNLVLTKSGDIYSFGCNDEGALGRDTSEDGSESKPDLIDLPG--KALCISAGDSHSACLLEDGRVFAWGSFRDSHGNMGLT-----IDGNKRTPIDLMEGTVCCSIASGADHLVILTTAGKVFTVGCAEQGQLGRLSERSISGEGRRGKRDLLRPTQLIITRAKPFEAIWATNYCTFMRESQTQVIWATGLNNFKQLAHETKGKEFALTPI--KTELK-DIRHIAGGQHHTVILTTDLKCSVVGRPEYGRLGLGDVKDVVEKPTIVKKLTEKIVSVGCGEVCSYAVTIDGKLYSWGSGVNNQLGVGDGDDELEPIVVVSKNTQGKHMLLASGGGQHAIF 413          
BLAST of Regulator of chromosome condensation vs. Ensembl Fly
Match: Rcc1 (gene:FBgn0002638 transcript:FBtr0077074)

HSP 1 Score: 266.159 bits (679), Expect = 1.674e-80
Identity = 163/405 (40.25%), Postives = 235/405 (58.02%), Query Frame = 3
Query:   96 KKAKFDLSYVEEECKRTFITQIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVD----KKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAK-STTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGD-NEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLF 1292
            K+A+    ++E   +RT +      V+  G+GD GQLGLGED+LE+KR + V+ + D +++ AGGMH++ L+KSG +Y+FGCNDEGALGR   ED   + P  + LP   K + I+AGD+HS+ L EDG+V+ WGSFRD++G +GL      I      P+D         IASG +H  +L+  G++FT GCAEQGQLGR+S  ++   GR G   LL P  + +  +  F  +WA ++CT  + S T  ++  GLNN+KQL  E    +  +T +     LK D +  A GQHHT+ L+   +  V+GR EYG LG GD  +   K T V   +  I+++      SYA+  DG +YSWG G + QLG GD +D   P  +V K      ++  S G QH +F
Sbjct:   24 KRARIAF-HLELPKRRTVLGN----VLVCGNGDVGQLGLGEDILERKRLSPVAGIPDAVDISAGGMHNLVLTKSGDIYSFGCNDEGALGRDTSEDGSESKPDLIDLPG--KALCISAGDSHSACLLEDGRVFAWGSFRDSHGNMGLT-----IDGNKRTPIDLMEGTVCCSIASGADHLVILTTAGKVFTVGCAEQGQLGRLSERSISGEGRRGKRDLLRPTQLIITRAKPFEAIWATNYCTFMRESQTQVIWATGLNNFKQLAHETKGKEFALTPI--KTELK-DIRHIAGGQHHTVILTTDLKCSVVGRPEYGRLGLGDVKDVVEKPTIVKKLTEKIVSVGCGEVCSYAVTIDGKLYSWGSGVNNQLGVGDGDDELEPIVVVSKNTQGKHMLLASGGGQHAIF 413          
BLAST of Regulator of chromosome condensation vs. Ensembl Fly
Match: Herc4 (gene:FBgn0035207 transcript:FBtr0072670)

HSP 1 Score: 126.331 bits (316), Expect = 1.225e-29
Identity = 112/369 (30.35%), Postives = 174/369 (47.15%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLG----EDVLEKKRPALVSTLKD--VIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNN-GLIGLL--KPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM-LDSNDILTIAACNRTSYALM-NDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVS 1244
            +   GS   GQLGLG    E +L    P+ +    D  V +V  G  H++ L+ +G+VY  G ND   LG  +       +P E++   D  +I I  G  HS  L++ G+V  WG   DN+ G +G    K   ++P      V K +++IA G NH   L+  GE++++G    GQLG  SPN+L        L  L+         +    +  G   +   S +G V+G G NN  QLG+ ++  +   T L     L    +  A G   ++ L+    ++  G G YG LG G + +      VM L  + I  +A  NR + AL+ + G VY++G+GSS QLG    + + +P  ++G  VS
Sbjct:    7 LYCWGSTSHGQLGLGGIEDEQILT---PSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGSNDYSQLGHDLPTKRPLLIP-ELQ---DYVIIQICCGSRHSLALSDWGQVLSWG---DNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLL--------GIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGV--RFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRMVMELMGSTITQVACGNRHTLALVPSRGRVYAFGLGSSGQLGTRSTKSLMLPQVVIGPWVS 355          

HSP 2 Score: 103.219 bits (256), Expect = 2.213e-22
Identity = 93/337 (27.60%), Postives = 155/337 (45.99%), Query Frame = 3
Query:  306 LSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVP--VDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEE--DLIQ----LMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEV-MLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVL 1289
            ++   ++Y +G    G LG   +EDE    P ++    D  V  +  G  H+  LT  GKVY  GS  ++   +G   P ++     L+P   D  II+I  G  H   LSD G++ ++G  + GQLG  +   +V+  +     +    +              G+  ++A ++ GE+Y  G N Y QLGV    DL      L +T+L     L       A G +H+  +S S  ++  GR   G LG  D  +R+  T++  L +  +  +A  +  S  L N+G V++ G G+  QLGHG   +  +P +MV  ++    I +++ G +H L
Sbjct:    1 MASGKELYCWGSTSHGQLGLGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGS--NDYSQLGHDLPTKR---PLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIA----------CGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTL-----LGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLP-RMV-MELMGSTITQVACGNRHTL 315          
BLAST of Regulator of chromosome condensation vs. Ensembl Fly
Match: Herc4 (gene:FBgn0035207 transcript:FBtr0072671)

HSP 1 Score: 126.331 bits (316), Expect = 1.225e-29
Identity = 112/369 (30.35%), Postives = 174/369 (47.15%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLG----EDVLEKKRPALVSTLKD--VIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNN-GLIGLL--KPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM-LDSNDILTIAACNRTSYALM-NDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVS 1244
            +   GS   GQLGLG    E +L    P+ +    D  V +V  G  H++ L+ +G+VY  G ND   LG  +       +P E++   D  +I I  G  HS  L++ G+V  WG   DN+ G +G    K   ++P      V K +++IA G NH   L+  GE++++G    GQLG  SPN+L        L  L+         +    +  G   +   S +G V+G G NN  QLG+ ++  +   T L     L    +  A G   ++ L+    ++  G G YG LG G + +      VM L  + I  +A  NR + AL+ + G VY++G+GSS QLG    + + +P  ++G  VS
Sbjct:    7 LYCWGSTSHGQLGLGGIEDEQILT---PSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGSNDYSQLGHDLPTKRPLLIP-ELQ---DYVIIQICCGSRHSLALSDWGQVLSWG---DNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLL--------GIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGV--RFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRMVMELMGSTITQVACGNRHTLALVPSRGRVYAFGLGSSGQLGTRSTKSLMLPQVVIGPWVS 355          

HSP 2 Score: 103.219 bits (256), Expect = 2.213e-22
Identity = 93/337 (27.60%), Postives = 155/337 (45.99%), Query Frame = 3
Query:  306 LSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVP--VDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEE--DLIQ----LMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEV-MLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVL 1289
            ++   ++Y +G    G LG   +EDE    P ++    D  V  +  G  H+  LT  GKVY  GS  ++   +G   P ++     L+P   D  II+I  G  H   LSD G++ ++G  + GQLG  +   +V+  +     +    +              G+  ++A ++ GE+Y  G N Y QLGV    DL      L +T+L     L       A G +H+  +S S  ++  GR   G LG  D  +R+  T++  L +  +  +A  +  S  L N+G V++ G G+  QLGHG   +  +P +MV  ++    I +++ G +H L
Sbjct:    1 MASGKELYCWGSTSHGQLGLGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGS--NDYSQLGHDLPTKR---PLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIA----------CGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTL-----LGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLP-RMV-MELMGSTITQVACGNRHTL 315          
BLAST of Regulator of chromosome condensation vs. Ensembl Zebrafish
Match: rcc1 (regulator of chromosome condensation 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2216])

HSP 1 Score: 347.436 bits (890), Expect = 4.504e-113
Identity = 177/401 (44.14%), Postives = 251/401 (62.59%), Query Frame = 3
Query:  117 SYVEEECKRTFIT--QIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPN--NXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDR 1307
            S V ++ K + I+  Q    V+ +G GD GQLGLGEDV+E+K+PALV+  + +++  AGGMH++CLS +G VYTFGCNDEGALGR   E+   TVP +V L +  K+I ++AGD+HS+ LTEDG VY+WGSFRDNNG+IGLL+P +K      VP+DK ++KI SG +H  ML+ +GE++T GC EQGQLGRV+ +  N         L      +++ R  V F D++ G++ T A S  G VYG GL+NY QLG +      +   L  F N    W  F+ GQHHT+ L++  + Y +GR EYG LG G +        V+   +D+  +A     SYA+   G+V+SWGMG++ QLG G++ED   P +M GKQ+ N  ++ +S G QH +    D+
Sbjct:   17 STVAKKLKVSHISHGQEKGLVLVLGQGDVGQLGLGEDVMERKKPALVTLPEGIVQAVAGGMHTVCLSDTGNVYTFGCNDEGALGRDTSEEGSETVPAKVDLGE--KIIQVSAGDSHSAALTEDGGVYVWGSFRDNNGVIGLLEPMKKCTVPVKVPIDKPVVKIVSGNDHLVMLTAHGELYTSGCGEQGQLGRVAEHFANRGGRKGLMRLLEPQMVIIKPRGKVVFTDVFCGAYFTFAVSKEGHVYGFGLSNYHQLGTQSTNTCFVPVKLSSFKNSTTSWVGFSGGQHHTLCLNSEGKAYSLGRAEYGRLGLGKDVGEKSEPTVVPGISDVQVVACGASVSYAVTKQGSVFSWGMGTNLQLGTGEEEDEWSPVEMTGKQLENRVVLSVSSGGQHTVLLVKDK 415          
BLAST of Regulator of chromosome condensation vs. Ensembl Zebrafish
Match: herc4 (HECT and RLD domain containing E3 ubiquitin protein ligase 4 [Source:ZFIN;Acc:ZDB-GENE-070801-1])

HSP 1 Score: 116.316 bits (290), Expect = 2.465e-26
Identity = 90/344 (26.16%), Postives = 157/344 (45.64%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLG---EDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNR--TSYALMNDGTVYSWGMGSSYQLG 1187
            ++  G+   GQLGLG   E+VL + R       K V +V  G  H++ L + G VYT GCND G LG     ++    P +V   D   ++ ++ G+ H+  L + G+V+ WG   D    + +++   ++P       +  I ++A G  H   L+  GEIF++G  + GQLG                 +  P +++    + F  + AG   +   + +G ++G G N + QLG+ ++  +     L    + +  +     G+ HT AL+    ++  G G YG LG     H     +V      +++  AC R  T   + + G + S+G+G + QLG
Sbjct:    1 MLCWGNASFGQLGLGGIDEEVLLEPRRCEFFEGKRVRDVGCGRRHTVFLLEDGTVYTCGCNDLGQLG----HEKARKKPEQVVSLDAQNIVAVSCGEAHTLALNDKGQVFAWGLGSDGQLGLSIVEDCLRVPRTVKSLSEVHITQVACGYWHSLALARGGEIFSWGQNKYGQLG----------LGQQGACVCSPQVIQSLQGIPFGQISAGGAHSFGLTLSGAIFGWGRNKFGQLGLGDNDDRRFPVLLKTLRSQQVVY--ICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTNHEVNPRKVFELMGSVVSQIACGRQHTLAFIPSSGKIDSFGLGGNGQLG 328          

HSP 2 Score: 75.485 bits (184), Expect = 1.487e-13
Identity = 54/185 (29.19%), Postives = 94/185 (50.81%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVI--EVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKI-PSATLVPVDKKIIKIASGENH-FAMLSDNGEIFTFGCAEQGQLG------RVSP 695
            + S G    GQLGLG+       P ++ +L+ +   ++ AGG HS  L+ SG ++ +G N  G LG  + +++D   P  +K     +V+ I  G++H++ LT++G V+ +G+     G +G      ++ P      +   + +IA G  H  A +  +G+I +FG    GQLG      R+SP
Sbjct:  158 IFSWGQNKYGQLGLGQQGACVCSPQVIQSLQGIPFGQISAGGAHSFGLTLSGAIFGWGRNKFGQLG--LGDNDDRRFPVLLKTLRSQQVVYICCGEDHTAALTKEGGVFTFGA--GGYGQLGHNSTNHEVNPRKVFELMGSVVSQIACGRQHTLAFIPSSGKIDSFGLGGNGQLGTRSTCNRISP 338          

HSP 3 Score: 72.7886 bits (177), Expect = 8.863e-13
Identity = 60/240 (25.00%), Postives = 102/240 (42.50%), Query Frame = 3
Query:  582 KKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVE--EDLIQLMMT--SLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM--LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQH 1283
            K++  +  G  H   L ++G ++T GC + GQLG                  ++       H             T+A +  G+V+  GL +  QLG+   ED +++  T  SL E +       + A G  H++AL+    I+  G+ +YG LG G       + +V+  L       I+A    S+ L   G ++ WG     QLG GD++D   P  +  K + + +++ I  G  H
Sbjct:   34 KRVRDVGCGRRHTVFLLEDGTVYTCGCNDLGQLGHEKARKKPEQVVSLDAQNIVAVSCGEAH-------------TLALNDKGQVFAWGLGSDGQLGLSIVEDCLRVPRTVKSLSEVHI-----TQVACGYWHSLALARGGEIFSWGQNKYGQLGLGQQGACVCSPQVIQSLQGIPFGQISAGGAHSFGLTLSGAIFGWGRNKFGQLGLGDNDDRRFPVLL--KTLRSQQVVYICCGEDH 253          

HSP 4 Score: 57.3806 bits (137), Expect = 5.989e-8
Identity = 36/113 (31.86%), Postives = 61/113 (53.98%), Query Frame = 3
Query:  957 GQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM-LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDED-VNVPTKMVGKQVSNMKIIEISPGFQHVL 1289
            G+ HT+ L     +Y  G  + G LG    + R K  +V+ LD+ +I+ ++     + AL + G V++WG+GS  QLG    ED + VP  +  K +S + I +++ G+ H L
Sbjct:   42 GRRHTVFLLEDGTVYTCGCNDLGQLGH--EKARKKPEQVVSLDAQNIVAVSCGEAHTLALNDKGQVFAWGLGSDGQLGLSIVEDCLRVPRTV--KSLSEVHITQVACGYWHSL 150          
BLAST of Regulator of chromosome condensation vs. Ensembl Zebrafish
Match: herc3 (HECT and RLD domain containing E3 ubiquitin protein ligase 3 [Source:ZFIN;Acc:ZDB-GENE-090313-139])

HSP 1 Score: 102.064 bits (253), Expect = 7.134e-22
Identity = 94/349 (26.93%), Postives = 155/349 (44.41%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLG--EDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFE--KIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLG--RVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM-LDSNDILTIAACNRTSYALM-NDGTVYSWGMGSSYQLGHG 1193
            ++  GS   GQLG+G  E  + + R   V   + + EV  G  HS+ L   G VYT G N  G LG     D+  + P  V   D  K+  ++ G  HS  + E G+V+ WG+   + G +GL    E  ++P       + +I ++  G +H   LS +G++F +G    GQLG  +  P+ L       L              +    + AG   + A S +G V+G G N+  QLG+ ++  + +   +    + K  +   + G+ HT AL+    ++  G G  G LG     +      VM L   ++  IA     + A + + G +Y++G  +  QLG G
Sbjct:    2 MLCWGSSGAGQLGIGASEASVFEPRSCCVFDGRGLKEVACGNQHSLFLLHDGSVYTCGSNSCGQLG----HDKGGSRPELVGALDAQKISGVSCGQAHSLAVNEQGQVFAWGA--GDGGQLGLGTAEEAVRVPRLIKKLCEHRISQVMCGNHHCIALSKDGQLFVWGENSSGQLGLGKGEPSTLSPQPLKSLC------------GIPLTQISAGGDHSFALSFSGAVFGWGKNSAGQLGLNDEQDRAVPCHIKFLRSQKVVY--ISCGEEHTAALTKEGGLFTFGNGSKGQLGHDSTRNEPLPRRVMELMGTEVSQIACGRNHTLAFVPSTGLIYAFGCNTQGQLGTG 330          

HSP 2 Score: 70.0922 bits (170), Expect = 7.106e-12
Identity = 64/249 (25.70%), Postives = 103/249 (41.37%), Query Frame = 3
Query:  555 PSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGV----EEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM--LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQH 1283
            P +  V   + + ++A G  H   L  +G ++T G    GQLG     +            +        HS             +A +  G+V+  G  +  QLG+    E   +  ++  L E         +   G HH IALS   +++V G    G LG G  E  T + + +  L    +  I+A    S+AL   G V+ WG  S+ QLG  D++D  VP  +  K + + K++ IS G +H
Sbjct:   25 PRSCCVFDGRGLKEVACGNQHSLFLLHDGSVYTCGSNSCGQLGHDKGGSRPELVGALDAQKISGVSCGQAHS-------------LAVNEQGQVFAWGAGDGGQLGLGTAEEAVRVPRLIKKLCE-----HRISQVMCGNHHCIALSKDGQLFVWGENSSGQLGLGKGEPSTLSPQPLKSLCGIPLTQISAGGDHSFALSFSGAVFGWGKNSAGQLGLNDEQDRAVPCHI--KFLRSQKVVYISCGEEH 253          
BLAST of Regulator of chromosome condensation vs. Ensembl Zebrafish
Match: herc2 (HECT and RLD domain containing E3 ubiquitin protein ligase 2 [Source:ZFIN;Acc:ZDB-GENE-070718-6])

HSP 1 Score: 99.3673 bits (246), Expect = 7.008e-21
Identity = 93/351 (26.50%), Postives = 154/351 (43.87%), Query Frame = 3
Query:  396 PGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPV------DKKIIKIASGEN--HFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLG---VEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQG--DNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRDIVQ--EEDKIDEVAENQNEKLEPAENPNLESKN 1403
            P + K   ++ V  I   +    ILT  G VY                  +   S TL P+       +KI+K+A+  +  H+  LS NGE+F++GC + G+LG      L       +      G        +   +  GS  + A +  GE++  G  NY +LG    E+    +++T+L     LK        G   T+A++ + +++  G G+YG LG+G  D     K  E + D  DI+ +   ++ S AL  DG VY+WG G + +LGHG DE V  P  +    +   ++++I+ G  H L    + ++      DK+       + K +P   P L SK+
Sbjct:  432 PIQCKALSNLGVTQIVCSEKGFLILTITGAVYT-----------------QNYKSTTLAPMLVHALTSRKIMKLAAHPDGQHYLALSVNGEVFSWGCGDGGRLGHGDTTYLEEPTMISVFSGRPVGK-------QVVHIACGSTYSAAITADGELHTWGRGNYGRLGHGSSEDQTTPMLVTAL---KGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLVEKLQDL-DIVKVCCGSQFSVALTKDGQVYTWGKGDNQRLGHGTDEHVRYPKLL--DSLQGKRVVDIAVGSTHCLALTEEGEVHSWGSNDKLQHFDTLFSNKKQPKALPGLNSKH 752          

HSP 2 Score: 99.3673 bits (246), Expect = 8.113e-21
Identity = 93/345 (26.96%), Postives = 153/345 (44.35%), Query Frame = 3
Query:  279 RAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIP-----SATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQH--HTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEV-MLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVL 1289
            R  G+ S    ++ +V+ +G ND+  LG   ++     VP   +    + V+ +  G      +T +GKVY  G     NG +GL      IP     SA    V KK+  + SG  H   L+ +G++F++G  + G+LG  S  N  +      L              +  D+  GS  + A +++GE+Y  GL  Y +LG  ++  QL    +     L     + A G     T+AL+    ++  G G++G LG+G +E       +  L+   +  I    + S AL   G V++WG G  ++LGHG D  V  P  + G  +   KI+ ++ G  H L
Sbjct: 2941 RLSGLESAATIRT-KVFVWGLNDKDQLGG--LKGSKIKVPSFSETLSALNVVQVAGGSKSLFAVTAEGKVYACG--EATNGRLGLGLSSGTIPIPRQISALSNYVVKKV-AVHSGGRHAMALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTK-----------RIRDIACGSSHSAAITSSGELYSWGLGEYGRLGHGDNTTQLRPKLVKVL--LGHRVVQVACGSRDAQTLALTDEGMVFSWGDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHGTDVHVRKPQMVEG--LRGKKIVHVAVGALHCL 3264          

HSP 3 Score: 95.1301 bits (235), Expect = 1.563e-19
Identity = 85/332 (25.60%), Postives = 144/332 (43.37%), Query Frame = 3
Query:  315 SGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKI----IKIASGENHFAMLSDNGEIFTFGCAEQGQLGR--VSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEV-MLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVL 1289
            SG +Y +G N  G LG   +E     VP   +    ++ + +  G+     +T DGK+Y  G        I      E + + TL+   + +    + + SG  H   LS  GE++++G AE G+LG    SP +  R                    V+  D+ AG   +   + +GE+Y  G   Y +LG  +   QL    +      +        G   T+ L+  + ++  G G+YG LG+G ++      ++  L    ++ +   ++ S AL   G VY+WG G  ++LGHG D+ V  P ++ G Q    K+I I+ G  H +
Sbjct: 3947 SGTIYGWGHNHRGQLGG--IEGAKVKVPTPTEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGGRLGI---GGTESVSTPTLLESIQHVFIRKVAVNSGGKHCLALSSEGELYSWGEAEDGKLGHGNRSPCDRPRVIESL-------------RGVEVVDIAAGGAHSACITASGELYTWGKGRYGRLGHGDSEDQLKPKLVEALQGHRVIDVACGSGDAQTLCLTDDDMVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQ--GKKVIAIATGSLHCV 4258          

HSP 4 Score: 86.2705 bits (212), Expect = 9.366e-17
Identity = 85/334 (25.45%), Postives = 150/334 (44.91%), Query Frame = 3
Query:  354 ALGRTIVEDED-ATVP----------GEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCG------LNNYKQLGVEE-DLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDN--EHRTKATEVMLDSNDILTIAACNR--TSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVL 1289
            A+GR   EDED ATVP           E      +    ++  ++ ++I T   KV++WG   D + L GL     K+PS +       ++++A G      ++  G+++  G A  G+LG    +  +   R               HS        G    +A +  G+V+  G      L ++ ++  ++  LI+ + T         +  +  A G  H+ A+++S  +Y  G GEYG LG GDN  + R K  +V+L  + ++ +A  +R   + AL ++G V+SWG G   +LG G  E  N+P  +  ++++   + +I  G Q  L
Sbjct: 2903 AVGRVRAEDEDLATVPFLASDNEEEEDEKTATGSMSRKRLSGLESAATIRT---KVFVWG-LNDKDQLGGLKGSKIKVPSFSETLSALNVVQVAGGSKSLFAVTAEGKVYACGEATNGRLGLGLSSGTIPIPRQISALSNYVVKKVAVHS--------GGRHAMALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKT---------KRIRDIACGSSHSAAITSSGELYSWGLGEYGRLGHGDNTTQLRPKLVKVLL-GHRVVQVACGSRDAQTLALTDEGMVFSWGDGDFGKLGRGGSEGCNIPQNI--ERLNGQGVCQIECGAQFSL 3212          

HSP 5 Score: 80.4925 bits (197), Expect = 6.017e-15
Identity = 70/293 (23.89%), Postives = 124/293 (42.32%), Query Frame = 3
Query:  423 IKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLG---VEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM-LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVL 1289
            I+ + + +G  H   L+ +G++Y WG   D     G   P ++ P         +++ IA+G  H A ++ +GE++T+G    G+LG     + ++      L           H V      +G   T+  +    V+  G  +Y +LG    +   + + + SL     +K +      G   ++AL+ S  +Y  G+G+Y  LG G ++H  +  +V  L    ++ IA  +        DG VY+WG     QLG G    +  P  +   Q    KI  ++ G  H L
Sbjct: 4035 IRKVAVNSGGKHCLALSSEGELYSWGEAEDGKLGHGNRSPCDR-PRVIESLRGVEVVDIAAGGAHSACITASGELYTWGKGRYGRLGHGDSEDQLKPKLVEALQG---------HRVIDVACGSGDAQTLCLTDDDMVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVKVE-----CGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQ--GKKINRVACGSAHTL 4310          

HSP 6 Score: 78.1814 bits (191), Expect = 2.750e-14
Identity = 80/338 (23.67%), Postives = 145/338 (42.90%), Query Frame = 3
Query:  138 KRTFITQIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVI----EVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKI-PSATLVPVDKKIIKIASG--ENHFAMLSDNGEIFTFGCAEQGQLGRVS------PNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAAC 1112
            K  F       V + G    G+LGLG        P  +S L + +     V +GG H++ L+  G+V+++G  D+G LG     + D   P  ++     ++ DI  G +HS+ +T  G++Y WG      G +G      ++ P    V +  +++++A G  +     L+D G +F++G  + G+LGR        P N+ R                  +    C +  G+  ++A + +G V+  G  +Y +LG   D + +    + E    K+     A G  H +A++ + +++  G  ++G  G G      K T V       +T  AC
Sbjct: 2996 KSLFAVTAEGKVYACGEATNGRLGLGLSSGTIPIPRQISALSNYVVKKVAVHSGGRHAMALTVDGKVFSWGEGDDGKLGHFSRMNCDK--PRLIEALKTKRIRDIACGSSHSAAITSSGELYSWG--LGEYGRLGHGDNTTQLRPKLVKVLLGHRVVQVACGSRDAQTLALTDEGMVFSWGDGDFGKLGRGGSEGCNIPQNIERL-----------------NGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHGTD-VHVRKPQMVEGLRGKKI-VHVAVGALHCLAVTETGQVFAWGDNDHGQQGNGTTTVNRKPTLVQGLEGQKITRVAC 3310          

HSP 7 Score: 73.9442 bits (180), Expect = 5.125e-13
Identity = 82/285 (28.77%), Postives = 129/285 (45.26%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTLK--DVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDIT--AGDNHSSILTEDGKVYIWG----SFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLG-VEEDLIQ---LMMTSLGEFNNLKEDWKKFAFGQHHTIALSAS 989
            + S G  + G+LG G       RP ++ +L+  +V+++ AGG HS C++ SG++YT+G    G LG    + ED   P  V+     +VID+   +GD  +  LT+D  V+ WG          G  G   P  KI S T + V    +K+  G      L+ +G ++T+G  +  +LG  S ++           +  P  V+     K   +  GS   +  +  GEVY  G N+  QLG    + IQ   L+    G+  N      + A G  HT+A S S
Sbjct: 4056 LYSWGEAEDGKLGHGNRS-PCDRPRVIESLRGVEVVDIAAGGAHSACITASGELYTWGKGRYGRLGHG--DSEDQLKPKLVEALQGHRVIDVACGSGDAQTLCLTDDDMVWSWGDGDYGKLGRGGSDGCKVPM-KIDSLTGLGV----VKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDH-----------VRRPRQVQGLQGKKVIAIATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKIN------RVACGSAHTLAWSTS 4315          

HSP 8 Score: 72.0182 bits (175), Expect = 2.219e-12
Identity = 54/184 (29.35%), Postives = 87/184 (47.28%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTL------KDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDIT--AGDNHSSILTEDGKVYIWGSFRDNNGLIGLL----KPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGR 686
            V S G GD G+LG G D    + P ++S        K V+ +  G  +S  ++  G+++T+G  + G LG      ED T P  V     +KVID+   +GD  +  +TE+G+V+ WG     +G  G L        K P       D  I+K+  G      L+ +G+++T+G  +  +LG 
Sbjct:  506 VFSWGCGDGGRLGHG-DTTYLEEPTMISVFSGRPVGKQVVHIACGSTYSAAITADGELHTWGRGNYGRLGHG--SSEDQTTPMLVTALKGLKVIDVACGSGDAQTLAVTENGQVWSWG-----DGDYGKLGRGGSDGCKTPKLVEKLQDLDIVKVCCGSQFSVALTKDGQVYTWGKGDNQRLGH 681          

HSP 9 Score: 70.0922 bits (170), Expect = 8.099e-12
Identity = 61/180 (33.89%), Postives = 83/180 (46.11%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTLKD--VIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDI---KVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSP 695
            V S G GD G+LG G      K P LV  L+D  +++V  G   S+ L+K GQVYT+G  D   LG     DE    P   KL D +   +V+DI  G  H   LTE+G+V+ WGS  D       L   +K P A      K I+ I+ G          G+ F++    +  +G   P
Sbjct:  616 VWSWGDGDYGKLGRGGSD-GCKTPKLVEKLQDLDIVKVCCGSQFSVALTKDGQVYTWGKGDNQRLGHGT--DEHVRYP---KLLDSLQGKRVVDIAVGSTHCLALTEEGEVHSWGS-NDKLQHFDTLFSNKKQPKALPGLNSKHIVGISCGP---------GQSFSWSSCSEWSVGLRVP 779          

HSP 10 Score: 68.5514 bits (166), Expect = 2.831e-11
Identity = 63/221 (28.51%), Postives = 107/221 (48.42%), Query Frame = 3
Query:  240 PALVSTL--KDVIEVRAG--GMHSICLSKSGQVYTFGCNDEGALGR--TIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDK--KIIKIA--SGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLG 872
            P LV  L  + ++++ A   G H + LS +G+V+++GC D G LG   T   +E   +      P   +V+ I  G  +S+ +T DG+++ WG  R N G +G     E   +  LV   K  K+I +A  SG+     +++NG+++++G  + G+LGR   +          L  L          VK C    GS  ++A +  G+VY  G  + ++LG
Sbjct:  474 PMLVHALTSRKIMKLAAHPDGQHYLALSVNGEVFSWGCGDGGRLGHGDTTYLEEPTMISVFSGRPVGKQVVHIACGSTYSAAITADGELHTWG--RGNYGRLG-HGSSEDQTTPMLVTALKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLVEKLQDLDI--------VKVC---CGSQFSVALTKDGQVYTWGKGDNQRLG 680          

HSP 11 Score: 67.781 bits (164), Expect = 4.259e-11
Identity = 73/282 (25.89%), Postives = 120/282 (42.55%), Query Frame = 3
Query:  453 NHSSILTEDGKVYIWGSF---RDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGS--FCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEH-RTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVN--VPTKMVGKQVSNMKIIEISPG 1274
             H   L+ +G+V+ WG     R  +G    L+    I   +  PV K+++ IA G  + A ++ +GE+ T+G    G+LG  S  +         L             +K  D+  GS    T+A +  G+V+  G  +Y +LG            + +  +L  D  K   G   ++AL+   ++Y  G+G+   LG G +EH R       L    ++ IA  +    AL  +G V+SW  GS+ +L H D    N   P  + G    ++  I   PG
Sbjct:  495 QHYLALSVNGEVFSWGCGDGGRLGHGDTTYLEEPTMISVFSGRPVGKQVVHIACGSTYSAAITADGELHTWGRGNYGRLGHGSSEDQTTPMLVTALK-----------GLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLVEKLQDL--DIVKVCCGSQFSVALTKDGQVYTWGKGDNQRLGHGTDEHVRYPKLLDSLQGKRVVDIAVGSTHCLALTEEGEVHSW--GSNDKLQHFDTLFSNKKQPKALPGLNSKHIVGISCGPG 761          

HSP 12 Score: 55.8398 bits (133), Expect = 2.239e-7
Identity = 34/87 (39.08%), Postives = 46/87 (52.87%), Query Frame = 3
Query:  114 LSYVEEECKRTFITQI--PSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTL--KDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALG 362
            L  V+ EC   F   +     V + G GD  +LG G D    +RP  V  L  K VI +  G +H +C ++ G+VYT+G NDEG LG
Sbjct: 4193 LGVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDD-HVRRPRQVQGLQGKKVIAIATGSLHCVCCTEDGEVYTWGDNDEGQLG 4278          
BLAST of Regulator of chromosome condensation vs. Ensembl Zebrafish
Match: herc2 (HECT and RLD domain containing E3 ubiquitin protein ligase 2 [Source:ZFIN;Acc:ZDB-GENE-070718-6])

HSP 1 Score: 98.2117 bits (243), Expect = 8.981e-21
Identity = 93/351 (26.50%), Postives = 154/351 (43.87%), Query Frame = 3
Query:  396 PGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPV------DKKIIKIASGEN--HFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLG---VEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQG--DNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRDIVQ--EEDKIDEVAENQNEKLEPAENPNLESKN 1403
            P + K   ++ V  I   +    ILT  G VY                  +   S TL P+       +KI+K+A+  +  H+  LS NGE+F++GC + G+LG      L       +      G        +   +  GS  + A +  GE++  G  NY +LG    E+    +++T+L     LK        G   T+A++ + +++  G G+YG LG+G  D     K  E + D  DI+ +   ++ S AL  DG VY+WG G + +LGHG DE V  P  +    +   ++++I+ G  H L    + ++      DK+       + K +P   P L SK+
Sbjct:  432 PIQCKALSNLGVTQIVCSEKGFLILTITGAVYT-----------------QNYKSTTLAPMLVHALTSRKIMKLAAHPDGQHYLALSVNGEVFSWGCGDGGRLGHGDTTYLEEPTMISVFSGRPVGK-------QVVHIACGSTYSAAITADGELHTWGRGNYGRLGHGSSEDQTTPMLVTAL---KGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLVEKLQDL-DIVKVCCGSQFSVALTKDGQVYTWGKGDNQRLGHGTDEHVRYPKLL--DSLQGKRVVDIAVGSTHCLALTEEGEVHSWGSNDKLQHFDTLFSNKKQPKALPGLNSKH 752          

HSP 2 Score: 72.0182 bits (175), Expect = 1.367e-12
Identity = 54/184 (29.35%), Postives = 87/184 (47.28%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTL------KDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDIT--AGDNHSSILTEDGKVYIWGSFRDNNGLIGLL----KPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGR 686
            V S G GD G+LG G D    + P ++S        K V+ +  G  +S  ++  G+++T+G  + G LG      ED T P  V     +KVID+   +GD  +  +TE+G+V+ WG     +G  G L        K P       D  I+K+  G      L+ +G+++T+G  +  +LG 
Sbjct:  506 VFSWGCGDGGRLGHG-DTTYLEEPTMISVFSGRPVGKQVVHIACGSTYSAAITADGELHTWGRGNYGRLGHG--SSEDQTTPMLVTALKGLKVIDVACGSGDAQTLAVTENGQVWSWG-----DGDYGKLGRGGSDGCKTPKLVEKLQDLDIVKVCCGSQFSVALTKDGQVYTWGKGDNQRLGH 681          

HSP 3 Score: 70.4774 bits (171), Expect = 4.801e-12
Identity = 61/180 (33.89%), Postives = 83/180 (46.11%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTLKD--VIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDI---KVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSP 695
            V S G GD G+LG G      K P LV  L+D  +++V  G   S+ L+K GQVYT+G  D   LG     DE    P   KL D +   +V+DI  G  H   LTE+G+V+ WGS  D       L   +K P A      K I+ I+ G          G+ F++    +  +G   P
Sbjct:  616 VWSWGDGDYGKLGRGGSD-GCKTPKLVEKLQDLDIVKVCCGSQFSVALTKDGQVYTWGKGDNQRLGHGT--DEHVRYP---KLLDSLQGKRVVDIAVGSTHCLALTEEGEVHSWGS-NDKLQHFDTLFSNKKQPKALPGLNSKHIVGISCGP---------GQSFSWSSCSEWSVGLRVP 779          

HSP 4 Score: 68.5514 bits (166), Expect = 1.933e-11
Identity = 63/221 (28.51%), Postives = 107/221 (48.42%), Query Frame = 3
Query:  240 PALVSTL--KDVIEVRAG--GMHSICLSKSGQVYTFGCNDEGALGR--TIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDK--KIIKIA--SGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLG 872
            P LV  L  + ++++ A   G H + LS +G+V+++GC D G LG   T   +E   +      P   +V+ I  G  +S+ +T DG+++ WG  R N G +G     E   +  LV   K  K+I +A  SG+     +++NG+++++G  + G+LGR   +          L  L          VK C    GS  ++A +  G+VY  G  + ++LG
Sbjct:  474 PMLVHALTSRKIMKLAAHPDGQHYLALSVNGEVFSWGCGDGGRLGHGDTTYLEEPTMISVFSGRPVGKQVVHIACGSTYSAAITADGELHTWG--RGNYGRLG-HGSSEDQTTPMLVTALKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLVEKLQDLDI--------VKVC---CGSQFSVALTKDGQVYTWGKGDNQRLG 680          

HSP 5 Score: 66.6254 bits (161), Expect = 7.910e-11
Identity = 73/282 (25.89%), Postives = 120/282 (42.55%), Query Frame = 3
Query:  453 NHSSILTEDGKVYIWGSF---RDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGS--FCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEH-RTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVN--VPTKMVGKQVSNMKIIEISPG 1274
             H   L+ +G+V+ WG     R  +G    L+    I   +  PV K+++ IA G  + A ++ +GE+ T+G    G+LG  S  +         L             +K  D+  GS    T+A +  G+V+  G  +Y +LG            + +  +L  D  K   G   ++AL+   ++Y  G+G+   LG G +EH R       L    ++ IA  +    AL  +G V+SW  GS+ +L H D    N   P  + G    ++  I   PG
Sbjct:  495 QHYLALSVNGEVFSWGCGDGGRLGHGDTTYLEEPTMISVFSGRPVGKQVVHIACGSTYSAAITADGELHTWGRGNYGRLGHGSSEDQTTPMLVTALK-----------GLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLVEKLQDL--DIVKVCCGSQFSVALTKDGQVYTWGKGDNQRLGHGTDEHVRYPKLLDSLQGKRVVDIAVGSTHCLALTEEGEVHSW--GSNDKLQHFDTLFSNKKQPKALPGLNSKHIVGISCGPG 761          
BLAST of Regulator of chromosome condensation vs. Ensembl Xenopus
Match: sema3d (semaphorin 3D [Source:Xenbase;Acc:XB-GENE-490694])

HSP 1 Score: 327.02 bits (837), Expect = 5.156e-105
Identity = 170/387 (43.93%), Postives = 246/387 (63.57%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKI----IKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDR 1307
            V+++G GD GQLGLGEDV+E+K+PALV+  +D+++  AGGMH++CL  SG +YTFGCNDEGALGR   E+   T PG+V L +  KV+ ++AGD+H++ LTEDG+V+++GSFRDNNG+IGLL+P +K    ++VPV  +I    IKIASG +H  +L+ +G+++T GC EQGQLGRV    +     +G    L+P  I    +    V F D++ G++ T A S  G VYG GL+NY QLG +         +L  F N  + W  F+ GQHHTI + +  ++Y +GR EYG LG G+N         +       ++A     SYA+ NDG V++WGMG++ QLG G++EDV  P +M GKQ+ +  ++ +S G QH +     R
Sbjct:   39 VLTLGQGDVGQLGLGEDVMERKKPALVTLPEDIVQAAAGGMHTVCLGASGSIYTFGCNDEGALGRDTSEEGSETQPGKVDLVE--KVVQVSAGDSHTAALTEDGRVFVFGSFRDNNGVIGLLEPMKK----SMVPVQMQINAPVIKIASGNDHLVLLTVDGDLYTSGCGEQGQLGRVPERFTNRGGRKGLERLLVPQCIHLKAKGSGRVHFQDVFCGAYFTFAVSQEGHVYGFGLSNYHQLGTKTTQSCFAPQNLTSFKNSTKSWVGFSGGQHHTICVDSEGKVYSLGRAEYGRLGLGENAEELSEPTPIPILPKTKSVACGASVSYAVSNDGRVFAWGMGTNLQLGTGEEEDVWSPQEMTGKQLEDRDVLSVSSGGQHTVLLVRKR 419          
BLAST of Regulator of chromosome condensation vs. Ensembl Xenopus
Match: sema3d (semaphorin 3D [Source:Xenbase;Acc:XB-GENE-490694])

HSP 1 Score: 325.479 bits (833), Expect = 8.817e-105
Identity = 170/387 (43.93%), Postives = 246/387 (63.57%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKI----IKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDR 1307
            V+++G GD GQLGLGEDV+E+K+PALV+  +D+++  AGGMH++CL  SG +YTFGCNDEGALGR   E+   T PG+V L +  KV+ ++AGD+H++ LTEDG+V+++GSFRDNNG+IGLL+P +K    ++VPV  +I    IKIASG +H  +L+ +G+++T GC EQGQLGRV    +     +G    L+P  I    +    V F D++ G++ T A S  G VYG GL+NY QLG +         +L  F N  + W  F+ GQHHTI + +  ++Y +GR EYG LG G+N         +       ++A     SYA+ NDG V++WGMG++ QLG G++EDV  P +M GKQ+ +  ++ +S G QH +     R
Sbjct:   15 VLTLGQGDVGQLGLGEDVMERKKPALVTLPEDIVQAAAGGMHTVCLGASGSIYTFGCNDEGALGRDTSEEGSETQPGKVDLVE--KVVQVSAGDSHTAALTEDGRVFVFGSFRDNNGVIGLLEPMKK----SMVPVQMQINAPVIKIASGNDHLVLLTVDGDLYTSGCGEQGQLGRVPERFTNRGGRKGLERLLVPQCIHLKAKGSGRVHFQDVFCGAYFTFAVSQEGHVYGFGLSNYHQLGTKTTQSCFAPQNLTSFKNSTKSWVGFSGGQHHTICVDSEGKVYSLGRAEYGRLGLGENAEELSEPTPIPILPKTKSVACGASVSYAVSNDGRVFAWGMGTNLQLGTGEEEDVWSPQEMTGKQLEDRDVLSVSSGGQHTVLLVRKR 395          
BLAST of Regulator of chromosome condensation vs. Ensembl Xenopus
Match: sema3d (semaphorin 3D [Source:Xenbase;Acc:XB-GENE-490694])

HSP 1 Score: 326.635 bits (836), Expect = 9.065e-105
Identity = 170/387 (43.93%), Postives = 246/387 (63.57%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKI----IKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDR 1307
            V+++G GD GQLGLGEDV+E+K+PALV+  +D+++  AGGMH++CL  SG +YTFGCNDEGALGR   E+   T PG+V L +  KV+ ++AGD+H++ LTEDG+V+++GSFRDNNG+IGLL+P +K    ++VPV  +I    IKIASG +H  +L+ +G+++T GC EQGQLGRV    +     +G    L+P  I    +    V F D++ G++ T A S  G VYG GL+NY QLG +         +L  F N  + W  F+ GQHHTI + +  ++Y +GR EYG LG G+N         +       ++A     SYA+ NDG V++WGMG++ QLG G++EDV  P +M GKQ+ +  ++ +S G QH +     R
Sbjct:   54 VLTLGQGDVGQLGLGEDVMERKKPALVTLPEDIVQAAAGGMHTVCLGASGSIYTFGCNDEGALGRDTSEEGSETQPGKVDLVE--KVVQVSAGDSHTAALTEDGRVFVFGSFRDNNGVIGLLEPMKK----SMVPVQMQINAPVIKIASGNDHLVLLTVDGDLYTSGCGEQGQLGRVPERFTNRGGRKGLERLLVPQCIHLKAKGSGRVHFQDVFCGAYFTFAVSQEGHVYGFGLSNYHQLGTKTTQSCFAPQNLTSFKNSTKSWVGFSGGQHHTICVDSEGKVYSLGRAEYGRLGLGENAEELSEPTPIPILPKTKSVACGASVSYAVSNDGRVFAWGMGTNLQLGTGEEEDVWSPQEMTGKQLEDRDVLSVSSGGQHTVLLVRKR 434          
BLAST of Regulator of chromosome condensation vs. Ensembl Xenopus
Match: sema3d (semaphorin 3D [Source:Xenbase;Acc:XB-GENE-490694])

HSP 1 Score: 325.094 bits (832), Expect = 1.321e-104
Identity = 170/387 (43.93%), Postives = 246/387 (63.57%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKI----IKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDR 1307
            V+++G GD GQLGLGEDV+E+K+PALV+  +D+++  AGGMH++CL  SG +YTFGCNDEGALGR   E+   T PG+V L +  KV+ ++AGD+H++ LTEDG+V+++GSFRDNNG+IGLL+P +K    ++VPV  +I    IKIASG +H  +L+ +G+++T GC EQGQLGRV    +     +G    L+P  I    +    V F D++ G++ T A S  G VYG GL+NY QLG +         +L  F N  + W  F+ GQHHTI + +  ++Y +GR EYG LG G+N         +       ++A     SYA+ NDG V++WGMG++ QLG G++EDV  P +M GKQ+ +  ++ +S G QH +     R
Sbjct:   23 VLTLGQGDVGQLGLGEDVMERKKPALVTLPEDIVQAAAGGMHTVCLGASGSIYTFGCNDEGALGRDTSEEGSETQPGKVDLVE--KVVQVSAGDSHTAALTEDGRVFVFGSFRDNNGVIGLLEPMKK----SMVPVQMQINAPVIKIASGNDHLVLLTVDGDLYTSGCGEQGQLGRVPERFTNRGGRKGLERLLVPQCIHLKAKGSGRVHFQDVFCGAYFTFAVSQEGHVYGFGLSNYHQLGTKTTQSCFAPQNLTSFKNSTKSWVGFSGGQHHTICVDSEGKVYSLGRAEYGRLGLGENAEELSEPTPIPILPKTKSVACGASVSYAVSNDGRVFAWGMGTNLQLGTGEEEDVWSPQEMTGKQLEDRDVLSVSSGGQHTVLLVRKR 403          
BLAST of Regulator of chromosome condensation vs. Ensembl Xenopus
Match: sema3d (semaphorin 3D [Source:Xenbase;Acc:XB-GENE-490694])

HSP 1 Score: 324.709 bits (831), Expect = 3.503e-104
Identity = 166/383 (43.34%), Postives = 243/383 (63.45%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDR 1307
            V+++G GD GQLGLGEDV+E+K+PALV+  +D+++  AGGMH++CL  SG +YTFGCNDEGALGR   E+   T PG+V L +  KV+ ++AGD+H++ LTEDG+V+++GSFRDNNG+IGLL+P +K      + ++  +IKIASG +H  +L+ +G+++T GC EQGQLGRV    +     +G    L+P  I    +    V F D++ G++ T A S  G VYG GL+NY QLG +         +L  F N  + W  F+ GQHHTI + +  ++Y +GR EYG LG G+N         +       ++A     SYA+ NDG V++WGMG++ QLG G++EDV  P +M GKQ+ +  ++ +S G QH +     R
Sbjct:   38 VLTLGQGDVGQLGLGEDVMERKKPALVTLPEDIVQAAAGGMHTVCLGASGSIYTFGCNDEGALGRDTSEEGSETQPGKVDLVE--KVVQVSAGDSHTAALTEDGRVFVFGSFRDNNGVIGLLEPMKKSMVPVQMQINAPVIKIASGNDHLVLLTVDGDLYTSGCGEQGQLGRVPERFTNRGGRKGLERLLVPQCIHLKAKGSGRVHFQDVFCGAYFTFAVSQEGHVYGFGLSNYHQLGTKTTQSCFAPQNLTSFKNSTKSWVGFSGGQHHTICVDSEGKVYSLGRAEYGRLGLGENAEELSEPTPIPILPKTKSVACGASVSYAVSNDGRVFAWGMGTNLQLGTGEEEDVWSPQEMTGKQLEDRDVLSVSSGGQHTVLLVRKR 418          
BLAST of Regulator of chromosome condensation vs. Ensembl Mouse
Match: Rcc1 (regulator of chromosome condensation 1 [Source:MGI Symbol;Acc:MGI:1913989])

HSP 1 Score: 345.125 bits (884), Expect = 3.774e-112
Identity = 171/388 (44.07%), Postives = 248/388 (63.92%), Query Frame = 3
Query:  162 PSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV-----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRT-SYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDR 1307
            P  V+++G GD GQLGLGE VLE+K+PALV  L+DV++  AGGMH++CLS+SGQVY+FGCNDEGALGR    +    VPG+V+L +  KV+ ++AGD+H++ LTEDG+V++WGSFRDNNG+IGLL+P +K      V +D  ++K+ASG +H  ML+++G+++T GC EQGQLGRV     +       GR  +   ++      R  V+F D + G++ T A S  G VYG GL+NY QLG        +  +L  F N  + W  F+ GQHHT+ + +  + Y +GR EYG LG G+     K+   ++    +++  AC  +  YA+  DG V++WGMG++YQLG G DED   P +M GKQ+ N  ++ +S G QH +    D+
Sbjct:   34 PGLVLTLGQGDVGQLGLGESVLERKKPALVPLLQDVVQAEAGGMHTVCLSQSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQE--KVVQVSAGDSHTAALTEDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDAPVVKVASGNDHLVMLTNDGDLYTLGCGEQGQLGRVPELFANRGGRQGLGRLLVPRCVLLKSRGTRGRVRFQDAFCGAYFTFAISREGHVYGFGLSNYHQLGTPGTGSCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEE-KSIPTLISRLPVVSSVACGASVGYAVSKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMTGKQLENRVVLTVSSGGQHTVLLVKDQ 418          
BLAST of Regulator of chromosome condensation vs. Ensembl Mouse
Match: Rcc1 (regulator of chromosome condensation 1 [Source:MGI Symbol;Acc:MGI:1913989])

HSP 1 Score: 345.125 bits (884), Expect = 3.774e-112
Identity = 171/388 (44.07%), Postives = 248/388 (63.92%), Query Frame = 3
Query:  162 PSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV-----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRT-SYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDR 1307
            P  V+++G GD GQLGLGE VLE+K+PALV  L+DV++  AGGMH++CLS+SGQVY+FGCNDEGALGR    +    VPG+V+L +  KV+ ++AGD+H++ LTEDG+V++WGSFRDNNG+IGLL+P +K      V +D  ++K+ASG +H  ML+++G+++T GC EQGQLGRV     +       GR  +   ++      R  V+F D + G++ T A S  G VYG GL+NY QLG        +  +L  F N  + W  F+ GQHHT+ + +  + Y +GR EYG LG G+     K+   ++    +++  AC  +  YA+  DG V++WGMG++YQLG G DED   P +M GKQ+ N  ++ +S G QH +    D+
Sbjct:   34 PGLVLTLGQGDVGQLGLGESVLERKKPALVPLLQDVVQAEAGGMHTVCLSQSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQE--KVVQVSAGDSHTAALTEDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDAPVVKVASGNDHLVMLTNDGDLYTLGCGEQGQLGRVPELFANRGGRQGLGRLLVPRCVLLKSRGTRGRVRFQDAFCGAYFTFAISREGHVYGFGLSNYHQLGTPGTGSCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEE-KSIPTLISRLPVVSSVACGASVGYAVSKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMTGKQLENRVVLTVSSGGQHTVLLVKDQ 418          
BLAST of Regulator of chromosome condensation vs. Ensembl Mouse
Match: Rcc1 (regulator of chromosome condensation 1 [Source:MGI Symbol;Acc:MGI:1913989])

HSP 1 Score: 344.739 bits (883), Expect = 6.921e-112
Identity = 171/388 (44.07%), Postives = 248/388 (63.92%), Query Frame = 3
Query:  162 PSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV-----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRT-SYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDR 1307
            P  V+++G GD GQLGLGE VLE+K+PALV  L+DV++  AGGMH++CLS+SGQVY+FGCNDEGALGR    +    VPG+V+L +  KV+ ++AGD+H++ LTEDG+V++WGSFRDNNG+IGLL+P +K      V +D  ++K+ASG +H  ML+++G+++T GC EQGQLGRV     +       GR  +   ++      R  V+F D + G++ T A S  G VYG GL+NY QLG        +  +L  F N  + W  F+ GQHHT+ + +  + Y +GR EYG LG G+     K+   ++    +++  AC  +  YA+  DG V++WGMG++YQLG G DED   P +M GKQ+ N  ++ +S G QH +    D+
Sbjct:   47 PGLVLTLGQGDVGQLGLGESVLERKKPALVPLLQDVVQAEAGGMHTVCLSQSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQE--KVVQVSAGDSHTAALTEDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDAPVVKVASGNDHLVMLTNDGDLYTLGCGEQGQLGRVPELFANRGGRQGLGRLLVPRCVLLKSRGTRGRVRFQDAFCGAYFTFAISREGHVYGFGLSNYHQLGTPGTGSCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEE-KSIPTLISRLPVVSSVACGASVGYAVSKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMTGKQLENRVVLTVSSGGQHTVLLVKDQ 431          
BLAST of Regulator of chromosome condensation vs. Ensembl Mouse
Match: Herc4 (hect domain and RLD 4 [Source:MGI Symbol;Acc:MGI:1914595])

HSP 1 Score: 132.494 bits (332), Expect = 2.044e-31
Identity = 106/373 (28.42%), Postives = 168/373 (45.04%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLG----EDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFE--KIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLG-------RVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNR--TSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVS 1244
            ++  G+   GQLGLG    E VLE +R       K V +V  G  H++ +   G VYT GCND G LG     ++    P +V   D   ++ +  G+ H+  L + G+VY WG   D++G +GL    E  ++P       D +I+++A G  H   LS   E+F +G  + GQLG       + SP                  L++    + F  + AG   +   + +G ++G G N + QLG+ ++  + +   L    + K  +     G+ HT AL+    ++  G G YG LG     H     +V      I+T  AC R  TS  + + G +YS+G+G + QLG G   +   P  + G   S
Sbjct:    1 MLCWGNASYGQLGLGGIDEEIVLEPRRSDFFVN-KKVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLG----HEKSRKKPEQVVALDAQNIVAVACGEAHTLALNDKGQVYAWG--LDSDGQLGLQGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGIDCQKQTSPQ-----------------LIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDENDRYVPNLLKSLRSQKIVY--ICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSHEINPRKVFELMGSIVTQVACGRQHTSAFVPSSGRIYSFGLGGNGQLGTGSTSNRKSPFTVKGNWFS 347          
BLAST of Regulator of chromosome condensation vs. Ensembl Mouse
Match: Herc4 (hect domain and RLD 4 [Source:MGI Symbol;Acc:MGI:1914595])

HSP 1 Score: 132.109 bits (331), Expect = 2.567e-31
Identity = 106/373 (28.42%), Postives = 168/373 (45.04%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLG----EDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFE--KIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLG-------RVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNR--TSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVS 1244
            ++  G+   GQLGLG    E VLE +R       K V +V  G  H++ +   G VYT GCND G LG     ++    P +V   D   ++ +  G+ H+  L + G+VY WG   D++G +GL    E  ++P       D +I+++A G  H   LS   E+F +G  + GQLG       + SP                  L++    + F  + AG   +   + +G ++G G N + QLG+ ++  + +   L    + K  +     G+ HT AL+    ++  G G YG LG     H     +V      I+T  AC R  TS  + + G +YS+G+G + QLG G   +   P  + G   S
Sbjct:    1 MLCWGNASYGQLGLGGIDEEIVLEPRRSDFFVN-KKVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLG----HEKSRKKPEQVVALDAQNIVAVACGEAHTLALNDKGQVYAWG--LDSDGQLGLQGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGIDCQKQTSPQ-----------------LIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDENDRYVPNLLKSLRSQKIVY--ICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSHEINPRKVFELMGSIVTQVACGRQHTSAFVPSSGRIYSFGLGGNGQLGTGSTSNRKSPFTVKGNWFS 347          
BLAST of Regulator of chromosome condensation vs. UniProt/SwissProt
Match: sp|P23800|RCC1_MESAU (Regulator of chromosome condensation OS=Mesocricetus auratus OX=10036 GN=RCC1 PE=1 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 1.560e-111
Identity = 170/389 (43.70%), Postives = 247/389 (63.50%), Query Frame = 3
Query:  162 PSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV-----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRT-SYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRD 1310
            P  V+++G GD GQLGLGE VLE+K+PALV  L+DV++  AGGMH++CL++SGQVY+FGCNDEGALGR    +    VPG+V+L +  KV+ ++AGD+H++ LTEDG+V++WGSFRDNNG+IGLL+P +K      V +D  ++K+ASG +H  ML+ +G+++T GC EQGQLGRV     +        R  +   ++      R  V+F D + G++ T A S  G VYG GL+NY QLG        +  +L  F N  + W  F+ GQHHTI + +  + Y +GR EYG LG G+     K+   ++    +++  AC  +  YA+  DG V++WGMG++YQLG G DED   P +M GKQ+ N  ++ +S G QH +    D++
Sbjct:   34 PGLVLTLGQGDVGQLGLGESVLERKKPALVPLLQDVVQAEAGGMHTVCLNQSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQE--KVVQVSAGDSHTAALTEDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDMPVVKVASGNDHLVMLTTDGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVLLKSRGSRGRVRFQDAFCGAYLTFAISREGHVYGFGLSNYHQLGTPGTASCFIPQNLTSFKNSTKSWVGFSGGQHHTICMDSEGKAYSLGRAEYGRLGLGEGAEE-KSIPTLISRLPVVSSVACGASVGYAVSKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMTGKQLENRVVLTVSSGGQHTVLLVKDKE 419          
BLAST of Regulator of chromosome condensation vs. UniProt/SwissProt
Match: sp|Q8VE37|RCC1_MOUSE (Regulator of chromosome condensation OS=Mus musculus OX=10090 GN=Rcc1 PE=1 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 2.640e-111
Identity = 171/388 (44.07%), Postives = 248/388 (63.92%), Query Frame = 3
Query:  162 PSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV-----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRT-SYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDR 1307
            P  V+++G GD GQLGLGE VLE+K+PALV  L+DV++  AGGMH++CLS+SGQVY+FGCNDEGALGR    +    VPG+V+L +  KV+ ++AGD+H++ LTEDG+V++WGSFRDNNG+IGLL+P +K      V +D  ++K+ASG +H  ML+++G+++T GC EQGQLGRV     +       GR  +   ++      R  V+F D + G++ T A S  G VYG GL+NY QLG        +  +L  F N  + W  F+ GQHHT+ + +  + Y +GR EYG LG G+     K+   ++    +++  AC  +  YA+  DG V++WGMG++YQLG G DED   P +M GKQ+ N  ++ +S G QH +    D+
Sbjct:   34 PGLVLTLGQGDVGQLGLGESVLERKKPALVPLLQDVVQAEAGGMHTVCLSQSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQE--KVVQVSAGDSHTAALTEDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDAPVVKVASGNDHLVMLTNDGDLYTLGCGEQGQLGRVPELFANRGGRQGLGRLLVPRCVLLKSRGTRGRVRFQDAFCGAYFTFAISREGHVYGFGLSNYHQLGTPGTGSCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEE-KSIPTLISRLPVVSSVACGASVGYAVSKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMTGKQLENRVVLTVSSGGQHTVLLVKDQ 418          
BLAST of Regulator of chromosome condensation vs. UniProt/SwissProt
Match: sp|P18754|RCC1_HUMAN (Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1 PE=1 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 2.652e-110
Identity = 175/421 (41.57%), Postives = 257/421 (61.05%), Query Frame = 3
Query:   63 KRRQDSVGGTQKKAKFDLSYVEEECKRTFITQIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV-----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRD 1310
            KRR        K  K  +S+      R+  T+ P  V+++G GD GQLGLGE+V+E+K+PALVS  +DV++  AGGMH++CLSKSGQVY+FGCNDEGALGR    +    VPG+V+L +  KV+ ++AGD+H++ LT+DG+V++WGSFRDNNG+IGLL+P +K      V +D  ++K+ASG +H  ML+ +G+++T GC EQGQLGRV     +        R  +   ++      R  V+F D + G++ T A S  G VYG GL+NY QLG        +  +L  F N  + W  F+ GQHHT+ + +  + Y +GR EYG LG G+         ++     + ++A      YA+  DG V++WGMG++YQLG G DED   P +M+GKQ+ N  ++ +S G QH +    D++
Sbjct:    8 KRRSPPADAIPKSKKVKVSH------RSHSTE-PGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQE--KVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKE 419          
BLAST of Regulator of chromosome condensation vs. UniProt/SwissProt
Match: sp|P25183|RCC1_XENLA (Regulator of chromosome condensation OS=Xenopus laevis OX=8355 GN=rcc1 PE=2 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 1.448e-104
Identity = 164/383 (42.82%), Postives = 244/383 (63.71%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDR 1307
            V+++G GD GQLGLGED++E+K+PALV+  +D+++  AGGMH++CL  SG +YTFGCNDEGALGR   E+     PG+V+L +  KV+ ++AGD+H++ LTEDG+V+++GSFRDNNG+IGLL+P +K      V ++  +IKIASG +H  +L+ +G+++T GC EQGQLGRV    +     +G    L+P  I    +    V F D++ G++ T A S  G VYG GL+NY QLG +         +L  F N  + W  F+ GQHHT+ + +  + Y +GR EYG LG G+N         + D   I ++A+    SYA+  DG V++WGMG++ QLG G++EDV  P +M GK + + +++ +S G QH +     R
Sbjct:   43 VLTLGQGDVGQLGLGEDIMERKKPALVTLTEDIVQAAAGGMHTVCLGASGSIYTFGCNDEGALGRDTSEEGSEMQPGKVELAE--KVVQVSAGDSHTAALTEDGRVFVFGSFRDNNGVIGLLEPMKKSMVPVQVQINTPVIKIASGNDHLVLLTVDGDLYTSGCGEQGQLGRVPERFTNRGGRKGLERLLVPQCIHLKAKGSGRVHFQDVFCGAYFTFAVSQEGHVYGFGLSNYHQLGTKNTQACYAPQNLTSFKNSTKSWIGFSGGQHHTVCVDSEGKAYSLGRAEYGRLGLGENAEEQSEPTPIPDLPKINSVASGASVSYAVSTDGCVFAWGMGTNLQLGTGEEEDVWSPEQMTGKHLEDREVLSVSSGGQHTVLLVRKR 423          
BLAST of Regulator of chromosome condensation vs. UniProt/SwissProt
Match: sp|P25171|RCC1_DROME (Regulator of chromosome condensation OS=Drosophila melanogaster OX=7227 GN=Rcc1 PE=1 SV=2)

HSP 1 Score: 266.159 bits (679), Expect = 1.678e-79
Identity = 163/405 (40.25%), Postives = 235/405 (58.02%), Query Frame = 3
Query:   96 KKAKFDLSYVEEECKRTFITQIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVD----KKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAK-STTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGD-NEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLF 1292
            K+A+    ++E   +RT +      V+  G+GD GQLGLGED+LE+KR + V+ + D +++ AGGMH++ L+KSG +Y+FGCNDEGALGR   ED   + P  + LP   K + I+AGD+HS+ L EDG+V+ WGSFRD++G +GL      I      P+D         IASG +H  +L+  G++FT GCAEQGQLGR+S  ++   GR G   LL P  + +  +  F  +WA ++CT  + S T  ++  GLNN+KQL  E    +  +T +     LK D +  A GQHHT+ L+   +  V+GR EYG LG GD  +   K T V   +  I+++      SYA+  DG +YSWG G + QLG GD +D   P  +V K      ++  S G QH +F
Sbjct:   24 KRARIAF-HLELPKRRTVLGN----VLVCGNGDVGQLGLGEDILERKRLSPVAGIPDAVDISAGGMHNLVLTKSGDIYSFGCNDEGALGRDTSEDGSESKPDLIDLPG--KALCISAGDSHSACLLEDGRVFAWGSFRDSHGNMGLT-----IDGNKRTPIDLMEGTVCCSIASGADHLVILTTAGKVFTVGCAEQGQLGRLSERSISGEGRRGKRDLLRPTQLIITRAKPFEAIWATNYCTFMRESQTQVIWATGLNNFKQLAHETKGKEFALTPI--KTELK-DIRHIAGGQHHTVILTTDLKCSVVGRPEYGRLGLGDVKDVVEKPTIVKKLTEKIVSVGCGEVCSYAVTIDGKLYSWGSGVNNQLGVGDGDDELEPIVVVSKNTQGKHMLLASGGGQHAIF 413          
BLAST of Regulator of chromosome condensation vs. TrEMBL
Match: A0A2K6F397 (Regulator of chromosome condensation 1 OS=Propithecus coquereli OX=379532 GN=RCC1 PE=4 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 7.701e-110
Identity = 170/388 (43.81%), Postives = 245/388 (63.14%), Query Frame = 3
Query:  162 PSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV-----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRD 1310
            P  V+++G GD GQLGLGE+V+E+K+PALVS  +DV++  AGGMH++CLSKSGQVY+FGCNDEGALGR    +    VPG+V+L +  KV+ ++AGD+H++ LTEDG+V++WGSFRDNNG+IGLL+P +K      V +D  ++K+ASG +H  ML+ +G+++T GC EQGQLGRV     +        R  +   ++      R  VKF D + G++ T A S  G VYG GL+NY QLG +      +  +L  F N  + W  F+ GQHHT+ + +  + Y +GR EYG LG G+         ++     + ++A      YA+  DG V++WGMG++YQLG G DED   P +M GKQ+ N  ++ +S G QH +    D+D
Sbjct:   34 PGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQE--KVVQVSAGDSHTAALTEDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDAPVVKVASGNDHLVMLTVDGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVKFQDAFCGAYFTFAISREGHVYGFGLSNYHQLGTQGTESCFVPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMTGKQLENRVVLSVSSGGQHTVLLVKDKD 419          
BLAST of Regulator of chromosome condensation vs. TrEMBL
Match: Q6NY65 (Regulator of chromosome condensation 1 OS=Danio rerio OX=7955 GN=rcc1 PE=1 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 1.008e-109
Identity = 177/401 (44.14%), Postives = 251/401 (62.59%), Query Frame = 3
Query:  117 SYVEEECKRTFIT--QIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPN--NXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDR 1307
            S V ++ K + I+  Q    V+ +G GD GQLGLGEDV+E+K+PALV+  + +++  AGGMH++CLS +G VYTFGCNDEGALGR   E+   TVP +V L +  K+I ++AGD+HS+ LTEDG VY+WGSFRDNNG+IGLL+P +K      VP+DK ++KI SG +H  ML+ +GE++T GC EQGQLGRV+ +  N         L      +++ R  V F D++ G++ T A S  G VYG GL+NY QLG +      +   L  F N    W  F+ GQHHT+ L++  + Y +GR EYG LG G +        V+   +D+  +A     SYA+   G+V+SWGMG++ QLG G++ED   P +M GKQ+ N  ++ +S G QH +    D+
Sbjct:   17 STVAKKLKVSHISHGQEKGLVLVLGQGDVGQLGLGEDVMERKKPALVTLPEGIVQAVAGGMHTVCLSDTGNVYTFGCNDEGALGRDTSEEGSETVPAKVDLGE--KIIQVSAGDSHSAALTEDGGVYVWGSFRDNNGVIGLLEPMKKCTVPVKVPIDKPVVKIVSGNDHLVMLTAHGELYTSGCGEQGQLGRVAEHFANRGGRKGLMRLLEPQMVIIKPRGKVVFTDVFCGAYFTFAVSKEGHVYGFGLSNYHQLGTQSTNTCFVPVKLSSFKNSTTSWVGFSGGQHHTLCLNSEGKAYSLGRAEYGRLGLGKDVGEKSEPTVVPGISDVQVVACGASVSYAVTKQGSVFSWGMGTNLQLGTGEEEDEWSPVEMTGKQLENRVVLSVSSGGQHTVLLVKDK 415          
BLAST of Regulator of chromosome condensation vs. TrEMBL
Match: A0A2K6F393 (Regulator of chromosome condensation 1 OS=Propithecus coquereli OX=379532 GN=RCC1 PE=4 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 1.770e-109
Identity = 170/388 (43.81%), Postives = 245/388 (63.14%), Query Frame = 3
Query:  162 PSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV-----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRD 1310
            P  V+++G GD GQLGLGE+V+E+K+PALVS  +DV++  AGGMH++CLSKSGQVY+FGCNDEGALGR    +    VPG+V+L +  KV+ ++AGD+H++ LTEDG+V++WGSFRDNNG+IGLL+P +K      V +D  ++K+ASG +H  ML+ +G+++T GC EQGQLGRV     +        R  +   ++      R  VKF D + G++ T A S  G VYG GL+NY QLG +      +  +L  F N  + W  F+ GQHHT+ + +  + Y +GR EYG LG G+         ++     + ++A      YA+  DG V++WGMG++YQLG G DED   P +M GKQ+ N  ++ +S G QH +    D+D
Sbjct:   65 PGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQE--KVVQVSAGDSHTAALTEDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDAPVVKVASGNDHLVMLTVDGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVKFQDAFCGAYFTFAISREGHVYGFGLSNYHQLGTQGTESCFVPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMTGKQLENRVVLSVSSGGQHTVLLVKDKD 450          
BLAST of Regulator of chromosome condensation vs. TrEMBL
Match: F7I7F5 (Regulator of chromosome condensation isoform c OS=Callithrix jacchus OX=9483 GN=RCC1 PE=2 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 7.104e-109
Identity = 168/388 (43.30%), Postives = 245/388 (63.14%), Query Frame = 3
Query:  162 PSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV-----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRD 1310
            P  V+++G GD GQLGLGE+V+E+K+PALVS  +DV++  AGGMH++CLSKSGQVY+FGCNDEGALGR    +    VPG+V+L +  KV+ ++AGD+H++ LTEDG+V++WGSFRDNNG+IGLL+P +K      V +D  ++K+ASG +H  ML+ +G+++T GC EQGQLGRV     +        R  +   ++      R  V+F D + G++ T A S  G VYG GL+NY QLG        +  +L  F N  + W +F+ GQHHT+ + +  + Y +GR EYG LG G+         ++     + ++A      YA+  DG V++WGMG++YQLG G DED   P +M GKQ+ N  ++ +S G QH +    D++
Sbjct:   34 PGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQE--KVVQVSAGDSHTAALTEDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVTVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISREGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVRFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMTGKQLENRVVLSVSSGGQHTVLLVKDKE 419          
BLAST of Regulator of chromosome condensation vs. TrEMBL
Match: U3BWS9 (Regulator of chromosome condensation isoform c OS=Callithrix jacchus OX=9483 GN=RCC1 PE=2 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 8.711e-109
Identity = 168/388 (43.30%), Postives = 245/388 (63.14%), Query Frame = 3
Query:  162 PSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV-----SPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRD 1310
            P  V+++G GD GQLGLGE+V+E+K+PALVS  +DV++  AGGMH++CLSKSGQVY+FGCNDEGALGR    +    VPG+V+L +  KV+ ++AGD+H++ LTEDG+V++WGSFRDNNG+IGLL+P +K      V +D  ++K+ASG +H  ML+ +G+++T GC EQGQLGRV     +        R  +   ++      R  V+F D + G++ T A S  G VYG GL+NY QLG        +  +L  F N  + W +F+ GQHHT+ + +  + Y +GR EYG LG G+         ++     + ++A      YA+  DG V++WGMG++YQLG G DED   P +M GKQ+ N  ++ +S G QH +    D++
Sbjct:   34 PGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQE--KVVQVSAGDSHTAALTEDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVTVVKVASGNDHMVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISREGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVRFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMTGKQLENRVVLSVSSGGQHTVLLVKDKE 419          
BLAST of Regulator of chromosome condensation vs. Ensembl Cavefish
Match: rcc1 (regulator of chromosome condensation 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2216])

HSP 1 Score: 226.098 bits (575), Expect = 6.597e-68
Identity = 107/216 (49.54%), Postives = 150/216 (69.44%), Query Frame = 3
Query:   42 PTRSTPQKRRQDSVGGTQKKAKFDLSYVEEECKRTFITQIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV 689
            P +  P+++++     +    K  +S+           Q    V+ +G GD GQLGLGEDVLE+K+PALV+  + +++  AGGMH++CLS +G VYTFGCNDEGALGR   E+    VP +V+L +  K++ ++AGD+H++ LTE+G V++WGSFRDNNG+IGLL+P +K    T VP+DK +IKIASG +H  ML+ NGEI+T GC EQGQLGRV
Sbjct:    2 PAKKAPKRQKEVEAEDSAALKKLKVSHKSH-------GQEKGLVLVLGQGDVGQLGLGEDVLERKKPALVNLPEGIVQAVAGGMHTVCLSDTGNVYTFGCNDEGALGRDTSEEGTEMVPAKVELAE--KIVQVSAGDSHTAALTEEGTVFVWGSFRDNNGIIGLLEPMKKCTVPTKVPLDKAVIKIASGNDHLVMLTVNGEIYTSGCGEQGQLGRV 208          

HSP 2 Score: 82.4185 bits (202), Expect = 1.090e-16
Identity = 78/311 (25.08%), Postives = 134/311 (43.09%), Query Frame = 3
Query:  453 NHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVY--GCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQ-----GDNEHRTKATEVMLDSNDILTIAAC--------------NRTSYALMND-----GTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDR 1307
            +H S   E G V + G  + + G +GL +   +     LV + + I++  +G  H   LSD G ++TFGC ++G LGR +           +               K   + AG   T A +  G V+  G   +N   +G+ E + +  + +      L +   K A G  H + L+ +  IY  G GE G LG+      +   R   +   L  ND +  +                +   ++++       G+V++WGMG++ QLG G++ED+  P +M GKQ+ N  ++  S G QH +    D+
Sbjct:   27 SHKSHGQEKGLVLVLG--QGDVGQLGLGEDVLERKKPALVNLPEGIVQAVAGGMHTVCLSDTGNVYTFGCNDEGALGRDTSEEGTEMVPAKVELAE-----------KIVQVSAGDSHTAALTEEGTVFVWGSFRDNNGIIGLLEPMKKCTVPTK---VPLDKAVIKIASGNDHLVMLTVNGEIYTSGCGEQGQLGRVPERFANRGGRKGLSMCYLYFNDCVRCSVTEEIILFFFMLLIFESMHYFSVLTSILSLLGSVFAWGMGTNLQLGTGEEEDLWSPVEMSGKQLENRVVLSASSGGQHTVLLVKDK 321          
BLAST of Regulator of chromosome condensation vs. Ensembl Cavefish
Match: rcc1 (regulator of chromosome condensation 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2216])

HSP 1 Score: 225.713 bits (574), Expect = 1.399e-67
Identity = 107/216 (49.54%), Postives = 150/216 (69.44%), Query Frame = 3
Query:   42 PTRSTPQKRRQDSVGGTQKKAKFDLSYVEEECKRTFITQIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRV 689
            P +  P+++++     +    K  +S+           Q    V+ +G GD GQLGLGEDVLE+K+PALV+  + +++  AGGMH++CLS +G VYTFGCNDEGALGR   E+    VP +V+L +  K++ ++AGD+H++ LTE+G V++WGSFRDNNG+IGLL+P +K    T VP+DK +IKIASG +H  ML+ NGEI+T GC EQGQLGRV
Sbjct:    2 PAKKAPKRQKEVEAEDSAALKKLKVSHKSH-------GQEKGLVLVLGQGDVGQLGLGEDVLERKKPALVNLPEGIVQAVAGGMHTVCLSDTGNVYTFGCNDEGALGRDTSEEGTEMVPAKVELAE--KIVQVSAGDSHTAALTEEGTVFVWGSFRDNNGIIGLLEPMKKCTVPTKVPLDKAVIKIASGNDHLVMLTVNGEIYTSGCGEQGQLGRV 208          

HSP 2 Score: 75.8702 bits (185), Expect = 2.105e-14
Identity = 82/332 (24.70%), Postives = 135/332 (40.66%), Query Frame = 3
Query:  453 NHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVY--GCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQ-----GDNEHRTKATEVMLDSNDI-----LTIAACNRTSY---ALMND--------------------------------GTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDR 1307
            +H S   E G V + G  + + G +GL +   +     LV + + I++  +G  H   LSD G ++TFGC ++G LGR +           +               K   + AG   T A +  G V+  G   +N   +G+ E + +  + +      L +   K A G  H + L+ +  IY  G GE G LG+      +   R   +   L  ND      + +A  N   Y   +L+                                  G+V++WGMG++ QLG G++ED+  P +M GKQ+ N  ++  S G QH +    D+
Sbjct:   27 SHKSHGQEKGLVLVLG--QGDVGQLGLGEDVLERKKPALVNLPEGIVQAVAGGMHTVCLSDTGNVYTFGCNDEGALGRDTSEEGTEMVPAKVELAE-----------KIVQVSAGDSHTAALTEEGTVFVWGSFRDNNGIIGLLEPMKKCTVPTK---VPLDKAVIKIASGNDHLVMLTVNGEIYTSGCGEQGQLGRVPERFANRGGRKGLSMCYLYFNDCEQNIKMPVALPNMFVYNQFSLLGTSVTEEIILFFFMLLIFESMHYFSVLTSILSLLGSVFAWGMGTNLQLGTGEEEDLWSPVEMSGKQLENRVVLSASSGGQHTVLLVKDK 342          
BLAST of Regulator of chromosome condensation vs. Ensembl Cavefish
Match: herc4 (HECT and RLD domain containing E3 ubiquitin protein ligase 4 [Source:NCBI gene;Acc:103028096])

HSP 1 Score: 117.087 bits (292), Expect = 1.288e-26
Identity = 94/348 (27.01%), Postives = 165/348 (47.41%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLG---EDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGL--LKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLG--RVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNR--TSYALMNDGTVYSWGMGSSYQLG 1187
            ++  G+   GQLGLG   E+++ + R       K V +V  G  H++ L   G VYT GCND G LG     ++    P +V   D   ++ ++ G++H+  L + G+V+ WG  + + G +GL  ++   ++P       +  I+++  G  H   LS  G+IF++G  + GQLG  +  P+            +L P LV+    + F  + AG   +   + +G V+G G N + QLG+ ++  +     L    + +  +     G+ HT AL+    ++  G G YG LG     H     +V     +++T  +C R  T   + + G + S+G+G + QLG
Sbjct:    1 MLCWGNASYGQLGLGGIDEEIVVEPRKCSFFNGKLVWDVGCGRRHTVFLLGDGTVYTCGCNDLGQLG----HEKTRKKPEQVVALDAQNIVAVSCGESHTLALNDKGQVFAWG--QASEGQLGLANMEDCVRVPRNIKSLSEVHIVQVTCGYRHSLALSRRGQIFSWGQNKYGQLGLGKEGPS------------VLTPQLVQSLLGIPFAQISAGGAHSFGLTLSGAVFGWGRNKFGQLGLNDNSDRCAPCLLKTLRSQRVVY--ICCGEDHTAALTKEGGVFTFGAGGYGQLGHNTTNHEINPRKVFELMGNVVTQISCGRQHTMAFIPSSGKIDSFGLGGNGQLG 328          

HSP 2 Score: 77.7962 bits (190), Expect = 2.165e-14
Identity = 56/181 (30.94%), Postives = 91/181 (50.28%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDV--IEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKI-PSATLVPVDKKIIKIASGENH-FAMLSDNGEIFTFGCAEQGQLGRVSPNN 701
            + S G    GQLGLG++      P LV +L  +   ++ AGG HS  L+ SG V+ +G N  G LG  + ++ D   P  +K     +V+ I  G++H++ LT++G V+ +G+     G +G      +I P      +   + +I+ G  H  A +  +G+I +FG    GQLG  S  N
Sbjct:  158 IFSWGQNKYGQLGLGKEGPSVLTPQLVQSLLGIPFAQISAGGAHSFGLTLSGAVFGWGRNKFGQLG--LNDNSDRCAPCLLKTLRSQRVVYICCGEDHTAALTKEGGVFTFGA--GGYGQLGHNTTNHEINPRKVFELMGNVVTQISCGRQHTMAFIPSSGKIDSFGLGGNGQLGTRSTCN 334          

HSP 3 Score: 62.003 bits (149), Expect = 1.776e-9
Identity = 57/240 (23.75%), Postives = 97/240 (40.42%), Query Frame = 3
Query:  582 KKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVE--EDLIQL--MMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM--LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQH 1283
            K +  +  G  H   L  +G ++T GC + GQLG                  ++       H             T+A +  G+V+  G  +  QLG+   ED +++   + SL E + ++        G  H++ALS   +I+  G+ +YG LG G         +++  L       I+A    S+ L   G V+ WG     QLG  D+ D   P  +  K + + +++ I  G  H
Sbjct:   34 KLVWDVGCGRRHTVFLLGDGTVYTCGCNDLGQLGHEKTRKKPEQVVALDAQNIVAVSCGESH-------------TLALNDKGQVFAWGQASEGQLGLANMEDCVRVPRNIKSLSEVHIVQ-----VTCGYRHSLALSRRGQIFSWGQNKYGQLGLGKEGPSVLTPQLVQSLLGIPFAQISAGGAHSFGLTLSGAVFGWGRNKFGQLGLNDNSDRCAPCLL--KTLRSQRVVYICCGEDH 253          

HSP 4 Score: 60.8474 bits (146), Expect = 3.969e-9
Identity = 48/154 (31.17%), Postives = 79/154 (51.30%), Query Frame = 3
Query:  846 GLNNYKQLGV----EEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM-LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDED-VNVPTKMVGKQVSNMKIIEISPGFQHVL 1289
            G  +Y QLG+    EE +++    S   F N K  W     G+ HT+ L     +Y  G  + G LG    + R K  +V+ LD+ +I+ ++     + AL + G V++WG  S  QLG  + ED V VP  +  K +S + I++++ G++H L
Sbjct:    5 GNASYGQLGLGGIDEEIVVEPRKCS---FFNGKLVWD-VGCGRRHTVFLLGDGTVYTCGCNDLGQLGH--EKTRKKPEQVVALDAQNIVAVSCGESHTLALNDKGQVFAWGQASEGQLGLANMEDCVRVPRNI--KSLSEVHIVQVTCGYRHSL 150          
BLAST of Regulator of chromosome condensation vs. Ensembl Cavefish
Match: herc4 (HECT and RLD domain containing E3 ubiquitin protein ligase 4 [Source:NCBI gene;Acc:103028096])

HSP 1 Score: 116.701 bits (291), Expect = 1.781e-26
Identity = 94/348 (27.01%), Postives = 165/348 (47.41%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLG---EDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGL--LKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLG--RVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNR--TSYALMNDGTVYSWGMGSSYQLG 1187
            ++  G+   GQLGLG   E+++ + R       K V +V  G  H++ L   G VYT GCND G LG     ++    P +V   D   ++ ++ G++H+  L + G+V+ WG  + + G +GL  ++   ++P       +  I+++  G  H   LS  G+IF++G  + GQLG  +  P+            +L P LV+    + F  + AG   +   + +G V+G G N + QLG+ ++  +     L    + +  +     G+ HT AL+    ++  G G YG LG     H     +V     +++T  +C R  T   + + G + S+G+G + QLG
Sbjct:    1 MLCWGNASYGQLGLGGIDEEIVVEPRKCSFFNGKLVWDVGCGRRHTVFLLGDGTVYTCGCNDLGQLG----HEKTRKKPEQVVALDAQNIVAVSCGESHTLALNDKGQVFAWG--QASEGQLGLANMEDCVRVPRNIKSLSEVHIVQVTCGYRHSLALSRRGQIFSWGQNKYGQLGLGKEGPS------------VLTPQLVQSLLGIPFAQISAGGAHSFGLTLSGAVFGWGRNKFGQLGLNDNSDRCAPCLLKTLRSQRVVY--ICCGEDHTAALTKEGGVFTFGAGGYGQLGHNTTNHEINPRKVFELMGNVVTQISCGRQHTMAFIPSSGKIDSFGLGGNGQLG 328          

HSP 2 Score: 77.411 bits (189), Expect = 2.740e-14
Identity = 56/181 (30.94%), Postives = 91/181 (50.28%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDV--IEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKI-PSATLVPVDKKIIKIASGENH-FAMLSDNGEIFTFGCAEQGQLGRVSPNN 701
            + S G    GQLGLG++      P LV +L  +   ++ AGG HS  L+ SG V+ +G N  G LG  + ++ D   P  +K     +V+ I  G++H++ LT++G V+ +G+     G +G      +I P      +   + +I+ G  H  A +  +G+I +FG    GQLG  S  N
Sbjct:  158 IFSWGQNKYGQLGLGKEGPSVLTPQLVQSLLGIPFAQISAGGAHSFGLTLSGAVFGWGRNKFGQLG--LNDNSDRCAPCLLKTLRSQRVVYICCGEDHTAALTKEGGVFTFGA--GGYGQLGHNTTNHEINPRKVFELMGNVVTQISCGRQHTMAFIPSSGKIDSFGLGGNGQLGTRSTCN 334          

HSP 3 Score: 61.6178 bits (148), Expect = 2.429e-9
Identity = 57/240 (23.75%), Postives = 97/240 (40.42%), Query Frame = 3
Query:  582 KKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVE--EDLIQL--MMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM--LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQH 1283
            K +  +  G  H   L  +G ++T GC + GQLG                  ++       H             T+A +  G+V+  G  +  QLG+   ED +++   + SL E + ++        G  H++ALS   +I+  G+ +YG LG G         +++  L       I+A    S+ L   G V+ WG     QLG  D+ D   P  +  K + + +++ I  G  H
Sbjct:   34 KLVWDVGCGRRHTVFLLGDGTVYTCGCNDLGQLGHEKTRKKPEQVVALDAQNIVAVSCGESH-------------TLALNDKGQVFAWGQASEGQLGLANMEDCVRVPRNIKSLSEVHIVQ-----VTCGYRHSLALSRRGQIFSWGQNKYGQLGLGKEGPSVLTPQLVQSLLGIPFAQISAGGAHSFGLTLSGAVFGWGRNKFGQLGLNDNSDRCAPCLL--KTLRSQRVVYICCGEDH 253          

HSP 4 Score: 60.4622 bits (145), Expect = 5.026e-9
Identity = 48/154 (31.17%), Postives = 79/154 (51.30%), Query Frame = 3
Query:  846 GLNNYKQLGV----EEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM-LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDED-VNVPTKMVGKQVSNMKIIEISPGFQHVL 1289
            G  +Y QLG+    EE +++    S   F N K  W     G+ HT+ L     +Y  G  + G LG    + R K  +V+ LD+ +I+ ++     + AL + G V++WG  S  QLG  + ED V VP  +  K +S + I++++ G++H L
Sbjct:    5 GNASYGQLGLGGIDEEIVVEPRKCS---FFNGKLVWD-VGCGRRHTVFLLGDGTVYTCGCNDLGQLGH--EKTRKKPEQVVALDAQNIVAVSCGESHTLALNDKGQVFAWGQASEGQLGLANMEDCVRVPRNI--KSLSEVHIVQVTCGYRHSL 150          
BLAST of Regulator of chromosome condensation vs. Ensembl Cavefish
Match: herc3 (HECT and RLD domain containing E3 ubiquitin protein ligase 3 [Source:NCBI gene;Acc:103047299])

HSP 1 Score: 106.301 bits (264), Expect = 3.356e-23
Identity = 90/355 (25.35%), Postives = 156/355 (43.94%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLG--EDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQ--LGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM-LDSNDILTIAACNRTSYALM-NDGTVYSWGMGSSYQLGHGDDEDVNVP 1217
            ++  GS   GQLGLG  E V+ + R   + + + + EV   G HS+ L   G VY+ G N  G LG     ++    P  V   D  K+  +  GD HS  + E G+V+ WG+       +G ++   ++P       + +I ++  G  H   L+ +G++FT+G    GQ  LG+  P++L       L              +    + AG   + A S +G V+G G N+  QLG+ ++  + +   +    + K  +   + G  HT AL+    ++  G G  G LG     +      V+ L   ++  I      + A + + G VY++G  +  QLG  +  +  +P
Sbjct:    1 MLCWGSSAWGQLGLGDAEPVVAEPRSCRMFSGRGLKEVACRGQHSLFLLHDGSVYSCGSNSHGQLG----HEKPGNKPELVVALDAQKIAGVACGDAHSLAVNEQGQVFAWGTGEKGQLGLGTVEEAVRVPRLIKKLCEHRISQVMCGNQHCIALAKDGQLFTWGQNSSGQLGLGKGEPSSLSPQPLKSLC------------GIPLAQISAGGDHSFALSLSGAVFGWGRNSAGQLGLNDEQDRAVPCHIKFLRSQKVVY--ISCGDEHTAALTKDGGLFTFGNGSRGQLGHDSTNNEPLPRRVLELMGTEVSQIVCGKHHTLAFVPSTGLVYAFGCNAHGQLGLANRGNARIP 337          

HSP 2 Score: 81.6481 bits (200), Expect = 1.496e-15
Identity = 80/329 (24.32%), Postives = 143/329 (43.47%), Query Frame = 3
Query:  339 CNDEGALGRTIVEDEDATV--PGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKED---------WKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEV-MLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVL 1289
            C    A G+  + D +  V  P   ++     + ++     HS  L  DG VY  GS  +++G +G  KP  K P   +    +KI  +A G+ H   +++ G++F +G  E+GQLG         G     + +         H +    +  G+   IA +  G+++  G N+  QLG+ +          GE ++L              + + G  H+ ALS S  ++  GR   G LG  D + R     +  L S  ++ I+  +  + AL  DG ++++G GS  QLGH    +  +P +++  ++   ++ +I  G  H L
Sbjct:    3 CWGSSAWGQLGLGDAEPVVAEPRSCRMFSGRGLKEVACRGQHSLFLLHDGSVYSCGS--NSHGQLGHEKPGNK-PELVVALDAQKIAGVACGDAHSLAVNEQGQVFAWGTGEKGQLG--------LGTVEEAVRVPRLIKKLCEHRIS--QVMCGNQHCIALAKDGQLFTWGQNSSGQLGLGK----------GEPSSLSPQPLKSLCGIPLAQISAGGDHSFALSLSGAVFGWGRNSAGQLGLNDEQDRAVPCHIKFLRSQKVVYISCGDEHTAALTKDGGLFTFGNGSRGQLGHDSTNNEPLPRRVL--ELMGTEVSQIVCGKHHTL 306          
BLAST of Regulator of chromosome condensation vs. Ensembl Sea Lamprey
Match: rcc1 (regulator of chromosome condensation 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2216])

HSP 1 Score: 334.724 bits (857), Expect = 4.566e-109
Identity = 174/386 (45.08%), Postives = 244/386 (63.21%), Query Frame = 3
Query:  162 PSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSP----NNXXXXXXXXXXXXXXXXXXXXXHS-VKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVD 1304
            P  V+++G GD GQLGLG +V+E+KRPALV   + V++  AGGMHS+CL KSG+VYTFGCNDEGALGR  VED +  +PG V LP+    + ++AGD+H+++LTE G VY+WG+FRDNNG+IGLL+P  K P  T + +D +I+K+ASG +H  +LS++ +I+T GC EQGQLGRV+         RG    L+P  +    R  HS V+F D++ GS+ T A ST G +YG GL+NY QLG  +     +   L  F N  E W +   GQHH++ L +  ++Y +GR +YG LG G          ++   + I +IA     SYA+  DG  +SWGMG++ QLG G+D+D   P ++ GKQ+ N  ++  S G QH L    D
Sbjct:   34 PGAVLAIGQGDVGQLGLGPNVMERKRPALVHMPEPVLQAVAGGMHSVCLGKSGKVYTFGCNDEGALGRITVEDVEEAMPGTVMLPE--LAVQVSAGDSHTAVLTEFGSVYLWGTFRDNNGIIGLLEPMMKCPLPTKLTLDTRIVKVASGNDHLVLLSESRQIYTLGCGEQGQLGRVAEMFANRGGRRGLLRLLVPEQVRVKARRGHSHVEFLDVFCGSYFTFALSTDGSLYGFGLSNYHQLGTAKPDSAFVPNLLTSFEN-SETWLELCGGQHHSLCLDSGGKVYSLGRADYGRLGLGKGACDVALPTLVPTPSHINSIACGASVSYAVTKDGRAFSWGMGTNCQLGTGEDKDEWSPVQVTGKQLENRHVLTASSGGQHTLLLVTD 416          
BLAST of Regulator of chromosome condensation vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007593.1 (pep scaffold:Pmarinus_7.0:GL489435:1357:4090:-1 gene:ENSPMAG00000006855.1 transcript:ENSPMAT00000007593.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 185.267 bits (469), Expect = 1.487e-55
Identity = 83/149 (55.70%), Postives = 112/149 (75.17%), Query Frame = 3
Query:  162 PSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASG 608
            P  V+++G GD GQLGLG  V E+KRPALV   +  ++  AGGMH++ L++SGQV TFGCNDEGALGR   E+ED  V G V+L D  +V+ ++AGD+H++ LT+ G VY+WG+FRDNNG+IGLLKP EK P   L+P++  I+K+ASG
Sbjct:   12 PGEVLALGEGDVGQLGLGSAVTERKRPALVPLSEKAVQAEAGGMHTVVLTESGQVLTFGCNDEGALGRVTAEEEDEAVAGVVQLAD--RVVQVSAGDSHTAALTQSGSVYVWGTFRDNNGVIGLLKPMEKCPLPALLPLETPIVKVASG 158          

HSP 2 Score: 47.3654 bits (111), Expect = 1.451e-6
Identity = 25/80 (31.25%), Postives = 44/80 (55.00%), Query Frame = 3
Query:  453 NHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVS 692
            +H S     G+V   G    + G +GL     +     LVP+ +K ++  +G  H  +L+++G++ TFGC ++G LGRV+
Sbjct:    4 SHPSHAHSPGEVLALG--EGDVGQLGLGSAVTERKRPALVPLSEKAVQAEAGGMHTVVLTESGQVLTFGCNDEGALGRVT 81          
BLAST of Regulator of chromosome condensation vs. Ensembl Sea Lamprey
Match: rcc2 (regulator of chromosome condensation 2 [Source:NCBI gene;Acc:406455])

HSP 1 Score: 92.8189 bits (229), Expect = 2.672e-20
Identity = 101/404 (25.00%), Postives = 171/404 (42.33%), Query Frame = 3
Query:  210 LGEDVLEKKRPALVSTLKDVIEVRA----GGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSAT-LVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFC-----------------DLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEED-------LIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSY-QLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRDIVQEEDK 1331
            LG+++    R     +L+D+   R        HS+ +S  G VY++G  ++G LG       D  VP  +    +  ++D   G +H+  LT+ G VY +G  R   G +GL    + +PS T +V   ++++K+A G      +  +G +F+FGC E GQLG    +N           +     +  R   +F                  D+  G+  TIA  T G V+  G   Y +LG  E        L++L+       N+++        G   T A++    +Y  G          D     KA   +  ++  +   AC ++S  + +D +  SWG   +Y +LG+G+ +  +       K++S + I E++ GF H L  A D     EEDK
Sbjct:   36 LGQNLWAPHR---YGSLRDIAVSRVITGPCAAHSLLISTRGLVYSWGRGEKGQLGHGDTCRVD--VPRIIDTLKECVIVDGACGRSHTLCLTDTGTVYAFGENR--LGQLGLGNQTDAVPSPTQIVYSGRQVVKVACGAEFSVFIDCDGNLFSFGCPEYGQLG----HNTDGRYIVRAQRIEFVCELAPRRLARFIEKTRDGQVLTVRGVVVRDVACGANHTIALDTRGRVFTWGFGGYGRLGHAEQKDELLPRLVKLLDRPAPAVNSVRA-------GYSCTFAINVVGTLYFWGSTNTSR----DPTMYPKAVHDLCGTH--VRSLACGKSSILITSDESTMSWGPWPTYGELGYGEGKQRSSSMPQELKKLSGIHIHEVAMGFAHSLLLARDDS---EEDK 412          

HSP 2 Score: 63.929 bits (154), Expect = 5.076e-11
Identity = 54/208 (25.96%), Postives = 88/208 (42.31%), Query Frame = 3
Query:  144 TFITQIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEV--RAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKL-PDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIG------------------------LLKPFEKIPSATLVPVDKKIIK-IASGENHFAMLSDNGEIFTFGCAEQGQLG 683
            + +      V S G G+ GQLG G D      P ++ TLK+ + V    G  H++CL+ +G VY FG N  G LG   + ++   VP   ++     +V+ +  G   S  +  DG ++ +G      G +G                        L +  EK     ++ V   +++ +A G NH   L   G +FT+G    G+LG
Sbjct:   66 SLLISTRGLVYSWGRGEKGQLGHG-DTCRVDVPRIIDTLKECVIVDGACGRSHTLCLTDTGTVYAFGENRLGQLG---LGNQTDAVPSPTQIVYSGRQVVKVACGAEFSVFIDCDGNLFSFGC--PEYGQLGHNTDGRYIVRAQRIEFVCELAPRRLARFIEKTRDGQVLTVRGVVVRDVACGANHTIALDTRGRVFTWGFGGYGRLG 267          

HSP 3 Score: 51.9878 bits (123), Expect = 2.967e-7
Identity = 46/181 (25.41%), Postives = 81/181 (44.75%), Query Frame = 3
Query:  828 GEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKED-WKKFAFGQ---------------HHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTI-AACNRT-SYALMNDGTVYSWGMGSSYQLGHGDDED-VNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRDI 1313
            G++  CG  N+  +G  E     +      F NL ++ W    +G                 H++ +S    +Y  GRGE G LG GD   R     ++    + + +  AC R+ +  L + GTVY++G     QLG G+  D V  PT++V    S  ++++++ G +  +F   D ++
Sbjct:    8 GQLLICGATNWDLVGRRE-----VPKQQAAFRNLGQNLWAPHRYGSLRDIAVSRVITGPCAAHSLLISTRGLVYSWGRGEKGQLGHGDTC-RVDVPRIIDTLKECVIVDGACGRSHTLCLTDTGTVYAFGENRLGQLGLGNQTDAVPSPTQIV---YSGRQVVKVACGAEFSVFIDCDGNL 179          
BLAST of Regulator of chromosome condensation vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001275.1 (pep scaffold:Pmarinus_7.0:GL476529:184068:212443:-1 gene:ENSPMAG00000001140.1 transcript:ENSPMAT00000001275.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 1.068e-17
Identity = 98/356 (27.53%), Postives = 156/356 (43.82%), Query Frame = 3
Query:  144 TFITQIPSFVMSMGSGDTGQLGLG----EDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVI-DITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEK-IPSATLVPVDKKIIKIASGENHFAMLSDNGEI-FTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWK-----KFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHR-TKATEVM-LDSNDILTIAACNRTSY---ALMNDGTVYSW 1160
            TF+  +   V + G G  G+LGLG    +  L+K        +K +   R    H++ ++  G+V+++G  D G LG           P  ++ P   KV+  ++AG  HS+ +TEDG++Y WG    + G +G      + IP  TLV     + ++A G +H   +S +G I ++FG  + G+LG    N + +      L  +           K C   AGS  ++A ++TG++Y  G       G  E       T+L     L ED         + G  H +AL+  N +Y  G    G  GQG +    TK  +VM +D   +  I+A    S    AL  D  V +W
Sbjct:  422 TFVIAVDGSVRACGKGSYGRLGLGDSNNQSTLKKLTFEPQRAVKKISSSRGSDGHTLAVTMEGEVFSWGDGDYGKLGHG--NSSTQKYPKLIQGPLQGKVVVCVSAGYRHSASVTEDGELYTWG--EGDFGRLGHGDSNSRNIP--TLVKDISNVGQVACGSSHTIAVSQDGRIVWSFGGGDNGKLGHGDTNRVYKPKVIEALQGMFIR--------KVC---AGSQSSLALTSTGQLYAWGCGACLGCGSSE------ATALRP--KLIEDLACTRIVDISCGDSHCLALTHDNEVYAWGNNSMGQCGQGHSTSPVTKPKKVMGMDGISVQQISAGTSHSLAWTALPTDRQVVAW 752          

HSP 2 Score: 78.9518 bits (193), Expect = 2.354e-15
Identity = 55/191 (28.80%), Postives = 89/191 (46.60%), Query Frame = 3
Query:  792 AGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAF--------------GQHHTIALSASNRIYVIGRGEYGNLGQGDN--EHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRDIV 1316
            AG +CT   +  G V  CG  +Y +LG            LG+ NN +   KK  F                 HT+A++    ++  G G+YG LG G++  +   K  +  L    ++ ++A  R S ++  DG +Y+WG G   +LGHGD    N+PT +  K +SN  + +++ G  H +  + D  IV
Sbjct:  417 AGQYCTFVIAVDGSVRACGKGSYGRLG------------LGDSNN-QSTLKKLTFEPQRAVKKISSSRGSDGHTLAVTMEGEVFSWGDGDYGKLGHGNSSTQKYPKLIQGPLQGKVVVCVSAGYRHSASVTEDGELYTWGEGDFGRLGHGDSNSRNIPTLV--KDISN--VGQVACGSSHTIAVSQDGRIV 590          

HSP 3 Score: 64.6994 bits (156), Expect = 5.914e-11
Identity = 45/161 (27.95%), Postives = 78/161 (48.45%), Query Frame = 3
Query:  819 STTGEVYGCGLNNYKQL--GVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTS----YALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQH 1283
            S T EVY  G N+  QL  G +E ++Q  M S   F N +        GQ+ T  ++    +   G+G YG LG GD+ +++   ++  +    +   + +R S     A+  +G V+SWG G   +LGHG+      P K++   +    ++ +S G++H
Sbjct:  376 SETSEVYVWGSNSSHQLAEGAQEKILQPKMAS--GFANAQ----TIEAGQYCTFVIAVDGSVRACGKGSYGRLGLGDSNNQSTLKKLTFEPQRAVKKISSSRGSDGHTLAVTMEGEVFSWGDGDYGKLGHGNSSTQKYP-KLIQGPLQGKVVVCVSAGYRH 529          

HSP 4 Score: 55.0694 bits (131), Expect = 5.435e-8
Identity = 71/285 (24.91%), Postives = 121/285 (42.46%), Query Frame = 3
Query:  459 SSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGS-FCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKK------FAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDG-TVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVL 1289
            S +++E  +VY+WGS   +    G     EKI    +         I +G+    +++ +G +   G    G+LG    NN     +    P           +VK      GS   T+A +  GEV+  G  +Y +LG      Q       ++  L +   +       + G  H+ +++    +Y  G G++G LG GD+  R   T V  D +++  +A  +  + A+  DG  V+S+G G + +LGHGD   V  P   V + +  M I ++  G Q  L
Sbjct:  372 SPVVSETSEVYVWGSNSSHQLAEG---AQEKILQPKMASGFANAQTIEAGQYCTFVIAVDGSVRACGKGSYGRLGLGDSNNQSTLKKLTFEPQ---------RAVKKISSSRGSDGHTLAVTMEGEVFSWGDGDYGKLGHGNSSTQ-------KYPKLIQGPLQGKVVVCVSAGYRHSASVTEDGELYTWGEGDFGRLGHGDSNSRNIPTLVK-DISNVGQVACGSSHTIAVSQDGRIVWSFGGGDNGKLGHGDTNRVYKPK--VIEALQGMFIRKVCAGSQSSL 634          
BLAST of Regulator of chromosome condensation vs. Ensembl Sea Lamprey
Match: rcc2 (regulator of chromosome condensation 2 [Source:NCBI gene;Acc:406455])

HSP 1 Score: 72.7886 bits (177), Expect = 7.295e-14
Identity = 74/304 (24.34%), Postives = 122/304 (40.13%), Query Frame = 3
Query:  294 HSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSAT-LVPVDKKIIKIASGENHFAMLSD-NGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCG--LNNYKQLGVEEDLIQLMMTSLGEFNNLKEDW-KKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEV-MLD--SNDILTIAACNRTSYALMNDGTVYSWGMGSSYQ 1181
            H + L+  GQVYT+G  D+G LG   ++  +A  P +      + V+    G +H+  +TE G V  +G   ++ G +GL      +P+   +V   + ++K+A G   F+ML D  G +++FGC E GQLG                                             +T G    C   L    +L     L+    T  G+ N +        A G +HT+   +  R++  G G YG LG  + +       V M D       ++ A    S+A++  G +Y WG  S+ +
Sbjct:   65 HCLLLTDLGQVYTWGRGDKGQLGHGDLKRVEAPRPVDALF--KLTVVAAACGRSHTLCITETGVVMAFG--ENHLGQLGLGTKSNAMPTPKQIVYSGQPVVKVACGAE-FSMLVDCKGNLYSFGCPEYGQLGH--------------------------------------------NTDGRFLACSNRLEFVCELAPRRVLVFTERTRDGKVNTVPAVCVTDIACGSNHTLVRDSQRRVFSWGFGGYGRLGHSEQKDEMLPRLVKMFDFPGRGAASVHAGYSCSFAIIETGALYFWGTSSTMR 319          

HSP 2 Score: 55.4546 bits (132), Expect = 2.185e-8
Identity = 43/158 (27.22%), Postives = 65/158 (41.14%), Query Frame = 3
Query:  102 AKFDLSYVEEECKRTFITQIPS--FVMSMGSGDTGQLGLGEDVLEKKRPA-LVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALG----------------------RTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWG 500
            A F L+ V   C R+    I     VM+ G    GQLGLG        P  +V + + V++V  G   S+ +   G +Y+FGC + G LG                      R ++   + T  G+V     + V DI  G NH+ +     +V+ WG
Sbjct:  102 ALFKLTVVAAACGRSHTLCITETGVVMAFGENHLGQLGLGTKSNAMPTPKQIVYSGQPVVKVACGAEFSMLVDCKGNLYSFGCPEYGQLGHNTDGRFLACSNRLEFVCELAPRRVLVFTERTRDGKVNTVPAVCVTDIACGSNHTLVRDSQRRVFSWG 259          
BLAST of Regulator of chromosome condensation vs. Ensembl Yeast
Match: SRM1 (Nucleotide exchange factor for Gsp1p; localizes to the nucleus, required for nucleocytoplasmic trafficking of macromolecules; suppressor of the pheromone response pathway; potentially phosphorylated by Cdc28p; human homolog of the RAN GEF, RCC1, can complement a temperature sensitive point mutant [Source:SGD;Acc:S000003065])

HSP 1 Score: 142.895 bits (359), Expect = 4.741e-37
Identity = 123/475 (25.89%), Postives = 207/475 (43.58%), Query Frame = 3
Query:   90 TQKKAKFDLSYV---EEECKRTFITQIPSFVMSMGSGDTGQLGLGEDVLEK--KRPALVSTL----KDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTI-------------------------VEDEDATVPGEV--KLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLK---PFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKED--WKKFAFGQHHTIALSASNRIYVIGRGEYGNLG----------QGDNEHRTKATEVMLDSNDI---LTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGD-DEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAV---DRDIVQEEDKIDE 1340
             +K +K   S++   +E+ K  +++  P  +   G+G   +LGLG     K  KRP L   L      +I    GGMH++ L +   V+++GCND GALGR                           +E   A +P E    L +  KV+ + A DN S  L  +G+VY WG+FR N G++G  +     +K P          I+++A G++H   L + G +F +G  +Q QLGR                  +         VK+  + +G     A +   ++   GLN + Q GV ED+    + +  +   L ++   +  A G+HH++ LS    +Y  GR +   +G            D   + +A  +    N++    ++AA +  S A+  +G  YSWG G +Y +G G  ++D  VPT++      +  II +  G Q  +   V   D D  +  D++D+
Sbjct:   18 AKKMSKTHASHIINAQEDYKHMYLSVQPLDIFCWGTGSMCELGLGPLAKNKEVKRPRLNPFLPRDEAKIISFAVGGMHTLALDEESNVWSWGCNDVGALGRDTSNAKEQLKDMDADDSSDDEDGDLNELESTPAKIPRESFPPLAEGHKVVQLAATDNMSCALFSNGEVYAWGTFRCNEGILGFYQDKIKIQKTPWKVPTFSKYNIVQLAPGKDHILFLDEEGMVFAWGNGQQNQLGR--------KVMERFRLKTLDPRPFGLRHVKY--IASGENHCFALTKDNKLVSWGLNQFGQCGVSEDVEDGALVTKPKRLALPDNVVIRSIAAGEHHSLILSQDGDLYSCGRLDMFEVGIPKDNLPEYTYKDVHGKARAVPLPTKLNNVPKFKSVAAGSHHSVAVAQNGIAYSWGFGETYAVGLGPFEDDTEVPTRIKNTATQDHNIILVGCGGQFSVSGGVKLSDEDAEKRADEMDD 482          
BLAST of Regulator of chromosome condensation vs. Ensembl Nematostella
Match: EDO33245 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSP6])

HSP 1 Score: 297.745 bits (761), Expect = 4.003e-94
Identity = 188/441 (42.63%), Postives = 269/441 (61.00%), Query Frame = 3
Query:   48 RSTPQKRRQDSV-----GGTQKKAKFDLSYVEEECKRTFITQIPSF-VMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDV--IEVRAGGMHSICLSKSGQVYTFGCNDEGALGR-TIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKP--FEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTG-EVYGCGLNNYKQLG---VEEDLIQLMMTSLGEFNNLKEDWK-KFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTK--ATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDE-DVNVPTKMVGKQVSN--MKIIEISPGFQHVLFRAVDR 1307
            R+ P KR+ D       GG + K K       +E +  F + + S   +++G GD GQLGLG D LE+K+PA+   L+ V  ++V +GGMH++ LSK G+VYT+GCND+GALGR T  E E+   PG V +PDD+ ++ ++AGD+H++ L++ G VY WG++RD +G IG L+P   +K P+  L     +IIKIASG +H A L+ +G +FT GCAEQGQLGRV      RGGR GL  +L P LVR +  +KF D++ GSF T   + TG +VY  GLNNY QLG   V+     + + SL + N  ++D     A GQHHTI    + ++Y +GR +YG LG GD    T   A    LD+  I  +A     S+A+ + G +YSWGMGS  QLG+G+DE DV  P K+ GK +++   +++ +S G QH +  A +R
Sbjct:    6 RAQPPKRKADGSTEEGSGGKRAKDK------TKEKQDVFTSSLESGQALTLGQGDVGQLGLGPDTLERKKPAVPIDLEGVPIVQVESGGMHTVALSKDGKVYTWGCNDDGALGRETTSEGEEEFQPGVVSMPDDVNIVMVSAGDSHTAALSDQGTVYAWGTYRDASGQIG-LQPDGVKKKPAVILTSESDRIIKIASGNDHTAALTTSGNLFTLGCAEQGQLGRVKECFSARGGRRGLAYILEPALVRSKKGLKFKDVFCGSFATFVVAKTGSDVYAWGLNNYGQLGTGDVQTWHFPVKVKSLSQLNKSEKDKHITIANGQHHTIVCDPNGKVYALGRADYGRLGLGDGAKETALPAHITSLDNEVIEKVACGECVSFAVSDKGELYSWGMGSCLQLGNGNDEDDVTTPAKVQGKNLNSETHRVLGVSAGGQHTVILAAER 439          
BLAST of Regulator of chromosome condensation vs. Ensembl Nematostella
Match: EDO34592 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNX9])

HSP 1 Score: 122.094 bits (305), Expect = 1.283e-28
Identity = 107/377 (28.38%), Postives = 167/377 (44.30%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEK-KRPALVSTLK---DVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGL----LKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRT-SYALM-NDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISP 1271
            +   G    GQLG+GE   E    P L+  L+   +V EV  G  H+  L K G VYT G N+ G LG    +++  T P  V   +   +  +T G  H+  +++ G V+ WG   ++ G IGL     +  + IP          +++IA G NH   L+ +G +F +G    GQLG                 +  P  V   + V F  + AG   + A S++G ++G G N Y QLGV +   + + T L    +  +     + G+ HT  L++   ++  G G  G LG   N H     +V      ++T  AC R  + AL+ + G VY++G G   QLG G   + N P    G  + +  I  + P
Sbjct:    1 MFCWGKCSEGQLGVGETEQEFISTPRLLENLEFSSNVREVSCGWNHTAFLCKDGTVYTCGSNEFGQLG----QEKSHTNPESVHAIETFTITKVTCGKAHTVAVSDQGLVFAWGD--NSYGQIGLGSKVKEKVQTIPKMLKGLAKMSVVQIACGCNHSMALTISGHLFCWGDNSSGQLG----------IGKTHSSMSEPAPVLSLNGVPFMLISAGGAHSFALSSSGALFGWGKNEYGQLGVHDTTDRPLPTLLKSLRS--QGVCYVSCGEKHTAVLTSDGGVFTFGCGTSGQLGHNSNHHEYTPRKVFELMGSVVTQIACGRAHTLALVPSSGRVYTFGRGGDGQLGLGVTNNCNSPMTAKGPWLRSNNIKSMLP 359          

HSP 2 Score: 84.3445 bits (207), Expect = 7.496e-17
Identity = 60/204 (29.41%), Postives = 96/204 (47.06%), Query Frame = 3
Query:  102 AKFDLSYVEEECKRTFITQIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDV--IEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGL-LKPFEKIPSATLVPVDKKIIKIASGENH-FAMLSDNGEIFTFGCAEQGQLGRVSPNN 701
            AK  +  +   C  +    I   +   G   +GQLG+G+       PA V +L  V  + + AGG HS  LS SG ++ +G N+ G LG  + +  D  +P  +K      V  ++ G+ H+++LT DG V+ +G     +G +G      E  P      +   + +IA G  H  A++  +G ++TFG    GQLG    NN
Sbjct:  138 AKMSVVQIACGCNHSMALTISGHLFCWGDNSSGQLGIGKTHSSMSEPAPVLSLNGVPFMLISAGGAHSFALSSSGALFGWGKNEYGQLG--VHDTTDRPLPTLLKSLRSQGVCYVSCGEKHTAVLTSDGGVFTFGC--GTSGQLGHNSNHHEYTPRKVFELMGSVVTQIACGRAHTLALVPSSGRVYTFGRGGDGQLGLGVTNN 337          
BLAST of Regulator of chromosome condensation vs. Ensembl Nematostella
Match: EDO37196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGI6])

HSP 1 Score: 97.0561 bits (240), Expect = 1.218e-20
Identity = 87/330 (26.36%), Postives = 143/330 (43.33%), Query Frame = 3
Query:  321 QVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGL--LKPFEKIPSA--TLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQH--HTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEV-MLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVL 1289
            +V+ +G ND+  LG   ++     VP   +    +KV  I  G      ++ DGKV+  G     NG +GL  L     +P     L     + + + SG  H   L+  G++F++G  E G+LG  +  N                           D+  GS  + A  ++GE+Y  GL  Y +LG  ++   L    +  F + +      A G     T+AL+    ++  G G++G LG+G +E  +    V  L    +  +A   + S AL   G V++WG G  Y+LGHG+D  V  P  + G  +   KI++++ G  H L
Sbjct: 2422 KVFVWGLNDKDQLGG--LKGSKIKVPVLSEFIGALKVQQIAGGSKTLFAVSHDGKVFACGE--STNGRLGLGPLSANVTVPRQIENLSSFMVRKVSVHSGGRHAMALTIEGKLFSWGEGEDGKLGHGNRMNCDHPKLIDTFKSSCVR-----------DMSCGSSHSAAILSSGELYTWGLGEYGRLGHGDNYTHLKPKKVQSFTSHRV--IDIACGSRDAQTLALTDDGTVWSWGDGDFGKLGRGGSEGCSVPNPVEKLQGQGVCKVACGAQFSLALSTSGLVWTWGKGDYYRLGHGNDTHVRKPQIVDG--LRGKKIVDVAVGALHCL 2732          

HSP 2 Score: 83.1889 bits (204), Expect = 2.649e-16
Identity = 82/312 (26.28%), Postives = 137/312 (43.91%), Query Frame = 3
Query:  288 GMHSICLSKSGQVYTFGCNDEGALGR--TIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPV------DKKIIKIA--SGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQL--GVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM-LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQL 1184
            G H + L++ G+VY++G  D G LG   T   +E   V G        +VI I+ G  HS+ +T +G++Y WG  R N G +G            LVPV         II +A  SG+ H    +D+G ++++G  + G+LGR   +               P  +     +  C ++ G+  ++A +  G V+  G     +L  G E+ +    +    +  ++ +     + G  H +AL+ +  +Y  GR + G LG  D + R + T V  L S  I+ IA     S+A    G    W +G+  Q 
Sbjct:   26 GKHFLALTREGEVYSWGSGDGGKLGHGDTSPREEPTLVTGLA----GKQVIRISCGSTHSAAVTSEGELYTWG--RGNYGRLG-----HGSSEDQLVPVLVSGLRGHHIIDVACGSGDAHTLAAADDGTVWSWGDGDYGKLGRGGSDG-----------CKNPKSIERLQGLGVCKVYCGAQFSLALTRDGSVWTWGKGEGFRLGHGTEDHVRHPKLVEALDGKHVVD----VSVGSIHCLALTDAGEVYCWGRNDQGQLGDIDCQIRPEPTLVSGLASKGIVGIACGPAQSFAWSCAG---QWSVGTRLQF 308          

HSP 3 Score: 82.4185 bits (202), Expect = 4.096e-16
Identity = 81/327 (24.77%), Postives = 138/327 (42.20%), Query Frame = 3
Query:  315 SGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSA-TLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEV-MLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVL 1289
            SG +Y +G N  G LG   +E     +P  ++    I+ + I  G+     +T +GKVY  G        +G       I    +L  V  + + + SG  H   LS +G+++++G  + G+LG  + N+  R      L                 D+  G   +   +   E+Y  G   Y +LG  +   QL+   +      +        G   T+ L+  + ++  G G+YG LG+G ++      +V  L    +  +   ++ S AL   G VY+WG G  Y+LGHG D+ V  P ++   Q    K+I I+ G  H +
Sbjct: 3353 SGTIYGWGHNHRGQLGS--LEGAKVKLPQTIEALASIRPVQIVGGEQTLFAVTAEGKVYATGYGHGGRLGLGGTDTVTSIKMLESLQHVVVRKVAVHSGGKHAMALSADGDVYSWGEGDDGKLGHGNRNSCDRPRVIEAL-----------RGKGVIDISCGGSHSACITQNHELYTWGKGRYGRLGHGDSEDQLLPKVVEALRGNRVIDVACGSGDAQTLCLTDDDCVWSWGDGDYGKLGRGGSDGCKIPMKVESLIGLGVSKVECGSQFSVALTRSGAVYTWGKGDYYRLGHGVDDHVRRPKRVAALQ--GKKVITIATGSLHCV 3664          

HSP 4 Score: 79.337 bits (194), Expect = 3.496e-15
Identity = 68/256 (26.56%), Postives = 119/256 (46.48%), Query Frame = 3
Query:  555 PSATLVPVDKK--IIKIASGEN--HFAMLSDNGEIFTFGCAEQGQLGR--VSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLG---VEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQG--DNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVL 1289
            P A L  + +K  I+++ +  +  HF  L+  GE++++G  + G+LG    SP        G     +I       HS              A ++ GE+Y  G  NY +LG    E+ L+ ++++ L   + +         G  HT+A +    ++  G G+YG LG+G  D     K+ E  L    +  +    + S AL  DG+V++WG G  ++LGHG ++ V  P K+V + +    ++++S G  H L
Sbjct:    4 PPAELECLSRKCEIVQVVTHTDGKHFLALTREGEVYSWGSGDGGKLGHGDTSPREEPTLVTGLAGKQVIRISCGSTHSA-------------AVTSEGELYTWGRGNYGRLGHGSSEDQLVPVLVSGLRGHHIID---VACGSGDAHTLAAADDGTVWSWGDGDYGKLGRGGSDGCKNPKSIE-RLQGLGVCKVYCGAQFSLALTRDGSVWTWGKGEGFRLGHGTEDHVRHP-KLV-EALDGKHVVDVSVGSIHCL 240          

HSP 5 Score: 75.485 bits (184), Expect = 5.411e-14
Identity = 71/242 (29.34%), Postives = 110/242 (45.45%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTL--KDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDIT--AGDNHSSILTEDGKVYIWGSFRDNNGLIGLL----KPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLG 872
            V S G GD G+LG G       RP ++  L  K VI++  GG HS C++++ ++YT+G    G LG    + ED  +P  V+     +VID+   +GD  +  LT+D  V+ WG     +G  G L        KIP      +   + K+  G      L+ +G ++T+G  +  +LG    ++           +  P  V      K   +  GS   +A + TGEVY  G N+  QLG
Sbjct: 3462 VYSWGEGDDGKLGHGNRN-SCDRPRVIEALRGKGVIDISCGGSHSACITQNHELYTWGKGRYGRLGHG--DSEDQLLPKVVEALRGNRVIDVACGSGDAQTLCLTDDDCVWSWG-----DGDYGKLGRGGSDGCKIPMKVESLIGLGVSKVECGSQFSVALTRSGAVYTWGKGDYYRLGHGVDDH-----------VRRPKRVAALQGKKVITIATGSLHCVASTDTGEVYTWGDNDEGQLG 3684          

HSP 6 Score: 75.0998 bits (183), Expect = 7.231e-14
Identity = 71/246 (28.86%), Postives = 111/246 (45.12%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTL--KDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDIT--AGDNHSSILTEDGKVYIWGSFRDNNGLIGL--------LKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLG 872
            V S GSGD G+LG G D   ++ P LV+ L  K VI +  G  HS  ++  G++YT+G  + G LG      ED  VP  V       +ID+   +GD H+    +DG V+ WG    + G +G          K  E++           + K+  G      L+ +G ++T+G  E  +LG  + ++        +    +   +  +H V   D+  GS   +A +  GEVY  G N+  QLG
Sbjct:   38 VYSWGSGDGGKLGHG-DTSPREEPTLVTGLAGKQVIRISCGSTHSAAVTSEGELYTWGRGNYGRLGHG--SSEDQLVPVLVSGLRGHHIIDVACGSGDAHTLAAADDGTVWSWGD--GDYGKLGRGGSDGCKNPKSIERLQGL-------GVCKVYCGAQFSLALTRDGSVWTWGKGEGFRLGHGTEDH--------VRHPKLVEALDGKHVV---DVSVGSIHCLALTDAGEVYCWGRNDQGQLG 260          

HSP 7 Score: 74.3294 bits (181), Expect = 1.248e-13
Identity = 72/293 (24.57%), Postives = 120/293 (40.96%), Query Frame = 3
Query:  423 IKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGS--FCTIAKSTTGEVYGCGLNNYKQLGVE-----------EDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM-LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVP---TKMVGKQVSNM 1250
            ++ + + +G  H+  L+ DG VY WG   D     G     ++ P        K +I I+ G +H A ++ N E++T+G    G+LG     + +       L              +  D+  GS    T+  +    V+  G  +Y +LG             E LI L ++             K   G   ++AL+ S  +Y  G+G+Y  LG G ++H  +   V  L    ++TIA  +    A  + G VY+WG     QLG G    +  P   T + GK++S +
Sbjct: 3441 VRKVAVHSGGKHAMALSADGDVYSWGEGDDGKLGHGNRNSCDR-PRVIEALRGKGVIDISCGGSHSACITQNHELYTWGKGRYGRLGHGDSEDQLLPKVVEALRGN-----------RVIDVACGSGDAQTLCLTDDDCVWSWGDGDYGKLGRGGSDGCKIPMKVESLIGLGVS-------------KVECGSQFSVALTRSGAVYTWGKGDYYRLGHGVDDHVRRPKRVAALQGKKVITIATGSLHCVASTDTGEVYTWGDNDEGQLGDGTTNAIARPRLVTALQGKKISRV 3708          

HSP 8 Score: 73.1738 bits (178), Expect = 3.080e-13
Identity = 74/285 (25.96%), Postives = 121/285 (42.46%), Query Frame = 3
Query:  423 IKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEH-RTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPG 1274
            ++V+  T G  H   LT +G+VY WGS        G   P E+ P+       K++I+I+ G  H A ++  GE++T+G    G+LG  S  + +       L           H +      +G   T+A +  G V+  G  +Y +LG           S+     L     K   G   ++AL+    ++  G+GE   LG G  +H R       LD   ++ ++  +    AL + G VY WG     QLG  D +    PT + G  +++  I+ I+ G
Sbjct:   18 VQVVTHTDG-KHFLALTREGEVYSWGSGDGGKLGHGDTSPREE-PTLVTGLAGKQVIRISCGSTHSAAVTSEGELYTWGRGNYGRLGHGSSEDQLVPVLVSGLRG---------HHIIDVACGSGDAHTLAAADDGTVWSWGDGDYGKLGRGGSDGCKNPKSIERLQGLGV--CKVYCGAQFSLALTRDGSVWTWGKGEGFRLGHGTEDHVRHPKLVEALDGKHVVDVSVGSIHCLALTDAGEVYCWGRNDQGQLGDIDCQIRPEPTLVSG--LASKGIVGIACG 287          

HSP 9 Score: 68.5514 bits (166), Expect = 7.079e-12
Identity = 65/260 (25.00%), Postives = 114/260 (43.85%), Query Frame = 3
Query:  270 IEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEK-IPSATLVPVDKKIIKIA--SGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQG 1040
            + V +GG H++ LS  G VY++G  D+G LG       D   P  ++      VIDI+ G +HS+ +T++ ++Y WG  R   G +G     ++ +P         ++I +A  SG+     L+D+  ++++G  + G+LGR   +      +   L             +    +  GS  ++A + +G VY  G  +Y +LG   D        +      K      A G  H +A + +  +Y  G  + G LG G
Sbjct: 3444 VAVHSGGKHAMALSADGDVYSWGEGDDGKLGHGNRNSCDR--PRVIEALRGKGVIDISCGGSHSACITQNHELYTWGKGR--YGRLGHGDSEDQLLPKVVEALRGNRVIDVACGSGDAQTLCLTDDDCVWSWGDGDYGKLGRGGSDGCKIPMKVESLI-----------GLGVSKVECGSQFSVALTRSGAVYTWGKGDYYRLGHGVDDHVRRPKRVAALQGKKV--ITIATGSLHCVASTDTGEVYTWGDNDEGQLGDG 3686          

HSP 10 Score: 68.1662 bits (165), Expect = 1.056e-11
Identity = 66/242 (27.27%), Postives = 111/242 (45.87%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTLKD--VIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAG--DNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDK----KIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLG 872
            + S G G+ G+LG G + +    P L+ T K   V ++  G  HS  +  SG++YT+G  + G LG    ++     P +V+     +VIDI  G  D  +  LT+DG V+ WG     +G  G L        +   PV+K     + K+A G      LS +G ++T+G  +  +LG  +  +           +  P +V      K  D+  G+   +A + +G+V+  G N++ Q G
Sbjct: 2530 LFSWGEGEDGKLGHG-NRMNCDHPKLIDTFKSSCVRDMSCGSSHSAAILSSGELYTWGLGEYGRLGHG--DNYTHLKPKKVQSFTSHRVIDIACGSRDAQTLALTDDGTVWSWG-----DGDFGKLGRGGSEGCSVPNPVEKLQGQGVCKVACGAQFSLALSTSGLVWTWGKGDYYRLGHGNDTH-----------VRKPQIVDGLRGKKIVDVAVGALHCLAVTDSGQVFAWGDNDHGQQG 2752          

HSP 11 Score: 63.5438 bits (153), Expect = 2.589e-10
Identity = 37/114 (32.46%), Postives = 58/114 (50.88%), Query Frame = 3
Query:  966 HTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM-LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVD 1304
            H +AL+    +Y  G G+ G LG GD   R + T V  L    ++ I+  +  S A+ ++G +Y+WG G+  +LGHG  ED  VP  + G +  ++  +    G  H L  A D
Sbjct:   28 HFLALTREGEVYSWGSGDGGKLGHGDTSPREEPTLVTGLAGKQVIRISCGSTHSAAVTSEGELYTWGRGNYGRLGHGSSEDQLVPVLVSGLRGHHIIDVACGSGDAHTLAAADD 141          
BLAST of Regulator of chromosome condensation vs. Ensembl Nematostella
Match: EDO49099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI68])

HSP 1 Score: 92.8189 bits (229), Expect = 1.052e-19
Identity = 88/312 (28.21%), Postives = 143/312 (45.83%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTL--KDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNN-GLIGLLKPFEKIPSATLVPV----DKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQ--LMMTSLGEFNNLKEDWK--KFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEV 1073
            + + G G  G LG GED  E   P +V  L  KD+ +V  G  H++ LSK G+V+++G    G LG+  + D     P  +   + + +  +   + HS+ +    K     SF +N+ G +G+  P +K+ ++ +  V    + KI ++A G  H A L+++G ++ +GC E GQLG     N        LL             V  C     +F T      G ++ CG N Y QLG   +  Q   +  ++     +  D++    A G  HT  ++    I+  GRG+ G LG GDN +R   TE+
Sbjct:  209 IYTWGEGTNGMLGHGEDTQEA-HPHVVEALLGKDIRKVACGATHTLALSKDGEVFSWGSGYGGRLGQGHLRDR--FTPIRICGLESLNLTQVACNEFHSAAVCACSKQGALFSFGENDYGQLGI--PEDKLLTSYIQCVSSLSEHKISRVACGSFHSAALAEHGSLWLWGCNESGQLGN---GNYTSTSLPSLLEAGNDLRHDAVMEVA-CGDQHSAFIT----KKGRMFCCGDNTYGQLGAHLNDNQDDHVTYNVAVRVRVPTDFRCVHVACGDSHTAVVTDGGEIFTWGRGKGGRLGHGDNLNRHLPTEI 507          

HSP 2 Score: 82.0333 bits (201), Expect = 2.994e-16
Identity = 89/324 (27.47%), Postives = 142/324 (43.83%), Query Frame = 3
Query:  324 VYTFGCNDEGALGRTIVEDEDATVPG--EVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGS-FRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAML---SDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDW-KKFAFGQHHTIALSASNRIYVIGRGEYGNLG------QGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGT-VYSWGMGSSYQLGHGDDEDVNVPTK----MVGKQV 1241
            +YT+G    G LG    ED     P   E  L  DI+   +  G  H+  L++DG+V+ WGS +    G   L   F  I    L  ++  + ++A  E H A +   S  G +F+FG  + GQLG   P + +       +  L           K   +  GSF + A +  G ++  G N   QLG        + + L   N+L+ D   + A G  H+  ++   R++  G   YG LG      Q D+     A  V + ++      AC  +  A++ DG  +++WG G   +LGHGD+ + ++PT+    M GK V
Sbjct:  209 IYTWGEGTNGMLGHG--EDTQEAHPHVVEALLGKDIR--KVACGATHTLALSKDGEVFSWGSGYGGRLGQGHLRDRFTPIRICGLESLN--LTQVACNEFHSAAVCACSKQGALFSFGENDYGQLG--IPEDKLLTSYIQCVSSLSEH--------KISRVACGSFHSAALAEHGSLWLWGCNESGQLGNGNYTSTSLPSLLEAGNDLRHDAVMEVACGDQHSAFITKKGRMFCCGDNTYGQLGAHLNDNQDDHVTYNVAVRVRVPTDFRCVHVACGDSHTAVVTDGGEIFTWGRGKGGRLGHGDNLNRHLPTEIEIGMEGKHV 516          

HSP 3 Score: 48.1358 bits (113), Expect = 9.922e-6
Identity = 30/87 (34.48%), Postives = 41/87 (47.13%), Query Frame = 3
Query:  996 IYVIGRGEYGNLGQGDN--EHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNM 1250
            IY  G G  G LG G++  E      E +L   DI  +A     + AL  DG V+SWG G   +LG G   D   P ++ G +  N+
Sbjct:  209 IYTWGEGTNGMLGHGEDTQEAHPHVVEALL-GKDIRKVACGATHTLALSKDGEVFSWGSGYGGRLGQGHLRDRFTPIRICGLESLNL 294          
BLAST of Regulator of chromosome condensation vs. Ensembl Nematostella
Match: EDO47874 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL61])

HSP 1 Score: 87.0409 bits (214), Expect = 5.042e-18
Identity = 108/386 (27.98%), Postives = 168/386 (43.52%), Query Frame = 3
Query:  240 PALVSTLKDVIEVR-----AGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIK---VIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFE-KIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGR-------VSPNNXXXXXXXXXXXXXXXXXXXXX------HSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSY-QLGHGDDEDVNVPTKMVGKQVS-NMKIIE---------ISPGFQHVLFRA 1298
            P L+STL   I VR         HSI + + G+V +FG ND+G LG    E  D  VP   K+ D +K   ++  + G  H+ ILT+ G V+ +G  +      G  KP     P   + P DKK+ K+  G     +L +NG+IF+FG  E GQLG        VS N +          L++               VK  D+  G+  T+A    G V+  G   Y +LG ++   + +   L  FN        FA G  +++A+    ++Y  G+ +      G+     K  + +  S   +    C+++S  +  D +V SWG   +Y +LG+G         K  G++ S N KI+E         ++ G  H LF A
Sbjct:  102 PHLISTLSG-IRVRHAASGPSACHSIIVCEDGRVMSFGRNDKGQLGHGTTERCD--VP---KVIDRLKMHNIVQASCGRGHTLILTDAGLVFGFGDNKLGQIGQGHQKPTSLPCPLQIMHPTDKKVTKVCCGAEFSMLLDENGDIFSFGSPEYGQLGHNTDGQYIVSSNKMGFQCEVLPRRLVVFVERNKDGFVNHIEGVKIKDVVCGNNHTMALDEQGRVFTWGFGGYGRLGHQQPKDEHVPRLLTFFNTKGNPSVIFA-GSTYSMAVCM-GQLYFWGQTKQ----SGEAAMYPKPVQDL--SGWQVRSVGCSKSSIVIAADDSVVSWGPSPTYGELGYG--------LKKGGQKSSTNPKIVEPLEDIYVHSVTCGMGHTLFIA 465          

HSP 2 Score: 67.781 bits (164), Expect = 6.040e-12
Identity = 57/206 (27.67%), Postives = 91/206 (44.17%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGE----DVLEKKRPALVSTLK--DVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFR--------DNNGLIGLLK---PFEKIPSATLVPVDK------------KIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNN 701
            VMS G  D GQLG G     DV     P ++  LK  ++++   G  H++ L+ +G V+ FG N  G +G+   +      P ++  P D KV  +  G   S +L E+G ++ +GS          D   ++   K     E +P   +V V++            KI  +  G NH   L + G +FT+G    G+LG   P +
Sbjct:  134 VMSFGRNDKGQLGHGTTERCDV-----PKVIDRLKMHNIVQASCGRGHTLILTDAGLVFGFGDNKLGQIGQGHQKPTSLPCPLQIMHPTDKKVTKVCCGAEFSMLLDENGDIFSFGSPEYGQLGHNTDGQYIVSSNKMGFQCEVLPRRLVVFVERNKDGFVNHIEGVKIKDVVCGNNHTMALDEQGRVFTWGFGGYGRLGHQQPKD 334          
BLAST of Regulator of chromosome condensation vs. Ensembl Medaka
Match: rcc1 (regulator of chromosome condensation 1 [Source:NCBI gene;Acc:101159637])

HSP 1 Score: 340.117 bits (871), Expect = 2.401e-109
Identity = 181/425 (42.59%), Postives = 263/425 (61.88%), Query Frame = 3
Query:   36 STPTRSTPQKRRQDSVGGTQKKAKFDLSYVEEECKRTFITQIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRD 1310
            + P++ T  KR+  +V G  +  K  +S+    C        P  V+ +G GD GQLGLGED++++K+PAL+S  + V +V AGGMH++CLS+S  VYTFGCNDEGALGR   E+    VPG+V L +  KV+ ++AGD+H++ LTEDG VYIWGSFRDNNG+IGLL+P +  P    +P+ +  +KIASG +H  +++ +G ++T GCAEQGQLGRV  +   RGGR GL  LL+P +V+++  V F D + G++ T A S  G VYG GL+NY QLG +   +  +   L  F N    W  F+ GQHHT+ L +  ++Y +GR EYG LG G           +        ++     SYA+  +G+VY+WGMG++ QLG G+++D   P KM GKQ+   +++ +S G QH +    D+ 
Sbjct:   77 TMPSKKTAPKRKSAAVEGANEPKKVKVSH-GSHCNE------PGQVLVLGQGDVGQLGLGEDIIQRKKPALLSLPEKVFQVTAGGMHTVCLSESRHVYTFGCNDEGALGRDTTEEGSEMVPGKVTLGE--KVVQVSAGDSHTAALTEDGSVYIWGSFRDNNGVIGLLEPMKTCPVPVKIPIPEPAVKIASGNDHLVLVTRDGNLYTSGCAEQGQLGRVPEHFSNRGGRKGLERLLVPQMVKLKGKVHFIDAFCGAYFTFAVSQEGHVYGFGLSNYHQLGTKSTKMCFVPVKLTCFKNSTTTWVDFSGGQHHTLCLDSEGQVYSLGRAEYGRLGLGQGAEEKSVPTAVTGVEPAKGVSCGASVSYAVTREGSVYAWGMGTNLQLGTGEEDDEWGPVKMTGKQLEGREVLLVSSGGQHTVLLVKDKQ 492          
BLAST of Regulator of chromosome condensation vs. Ensembl Medaka
Match: herc4 (HECT and RLD domain containing E3 ubiquitin protein ligase 4 [Source:NCBI gene;Acc:101174618])

HSP 1 Score: 117.857 bits (294), Expect = 7.115e-27
Identity = 95/347 (27.38%), Postives = 158/347 (45.53%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLG---EDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFE---KIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALM--NDGTVYSWGMGSSYQLG 1187
            ++  G+   GQLGLG   E+++ + R       K V +V  G  H+  L + G VYT GCND G LG     ++    P +V   D   ++ ++ G++H+  L + G+V+ WG   D  G +G L  FE   ++P       D ++ ++A G  H   LS  G IF++G    GQLG                 + +P  ++    + F  + AG   + A + +G V+G G N + QLG+ +   +     L    + +  +   + G+ HT AL+    ++  G G YG LG     H     +V     +++T  AC R        + G + S+G+G + QLG
Sbjct:    1 MLCWGNASYGQLGLGGIDEEIVVEPRKCEFFHGKRVRDVGCGRRHTAFLLEDGTVYTCGCNDLGQLG----HEKSRKKPEQVVALDAQIIVALSCGESHTLALNDKGQVFSWGLGSD--GQLG-LNNFEECIRVPRNIKSLSDVQVAQVACGYWHSLALSKGGHIFSWGQNRYGQLG----------LGMTGQSISVPQHLQSLQGIPFAQIAAGGAHSFALTLSGAVFGWGRNKFGQLGLNDTNDRCFPALLKALRSQRVIY--ISCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTNHEVNPRKVFELMGNVVTQIACGRQHTLAFTPSSGKMDSFGLGGNGQLG 328          

HSP 2 Score: 73.9442 bits (180), Expect = 3.520e-13
Identity = 54/181 (29.83%), Postives = 88/181 (48.62%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDV--IEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKI-PSATLVPVDKKIIKIASGENH-FAMLSDNGEIFTFGCAEQGQLGRVSPNN 701
            + S G    GQLGLG        P  + +L+ +   ++ AGG HS  L+ SG V+ +G N  G LG  + +  D   P  +K     +VI I+ G++H++ LT++G V+ +G+     G +G      ++ P      +   + +IA G  H  A    +G++ +FG    GQLG  S  N
Sbjct:  158 IFSWGQNRYGQLGLGMTGQSISVPQHLQSLQGIPFAQIAAGGAHSFALTLSGAVFGWGRNKFGQLG--LNDTNDRCFPALLKALRSQRVIYISCGEDHTAALTKEGGVFTFGA--GGYGQLGHNSTNHEVNPRKVFELMGNVVTQIACGRQHTLAFTPSSGKMDSFGLGGNGQLGTRSTCN 334          

HSP 3 Score: 72.0182 bits (175), Expect = 1.308e-12
Identity = 63/240 (26.25%), Postives = 99/240 (41.25%), Query Frame = 3
Query:  582 KKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVE--EDLIQL--MMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM--LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQH 1283
            K++  +  G  H A L ++G ++T GC + GQLG                 +++       H             T+A +  G+V+  GL +  QLG+   E+ I++   + SL +         + A G  H++ALS    I+  G+  YG LG G         + +  L       IAA    S+AL   G V+ WG     QLG  D  D   P  +  K + + ++I IS G  H
Sbjct:   34 KRVRDVGCGRRHTAFLLEDGTVYTCGCNDLGQLGHEKSRKKPEQVVALDAQIIVALSCGESH-------------TLALNDKGQVFSWGLGSDGQLGLNNFEECIRVPRNIKSLSDVQV-----AQVACGYWHSLALSKGGHIFSWGQNRYGQLGLGMTGQSISVPQHLQSLQGIPFAQIAAGGAHSFALTLSGAVFGWGRNKFGQLGLNDTNDRCFPALL--KALRSQRVIYISCGEDH 253          

HSP 4 Score: 56.225 bits (134), Expect = 1.188e-7
Identity = 35/113 (30.97%), Postives = 62/113 (54.87%), Query Frame = 3
Query:  957 GQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM-LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDED-VNVPTKMVGKQVSNMKIIEISPGFQHVL 1289
            G+ HT  L     +Y  G  + G LG    + R K  +V+ LD+  I+ ++     + AL + G V+SWG+GS  QLG  + E+ + VP  +  K +S++++ +++ G+ H L
Sbjct:   42 GRRHTAFLLEDGTVYTCGCNDLGQLGH--EKSRKKPEQVVALDAQIIVALSCGESHTLALNDKGQVFSWGLGSDGQLGLNNFEECIRVPRNI--KSLSDVQVAQVACGYWHSL 150          
BLAST of Regulator of chromosome condensation vs. Ensembl Medaka
Match: herc4 (HECT and RLD domain containing E3 ubiquitin protein ligase 4 [Source:NCBI gene;Acc:101174618])

HSP 1 Score: 117.087 bits (292), Expect = 1.063e-26
Identity = 95/347 (27.38%), Postives = 158/347 (45.53%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLG---EDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFE---KIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALM--NDGTVYSWGMGSSYQLG 1187
            ++  G+   GQLGLG   E+++ + R       K V +V  G  H+  L + G VYT GCND G LG     ++    P +V   D   ++ ++ G++H+  L + G+V+ WG   D  G +G L  FE   ++P       D ++ ++A G  H   LS  G IF++G    GQLG                 + +P  ++    + F  + AG   + A + +G V+G G N + QLG+ +   +     L    + +  +   + G+ HT AL+    ++  G G YG LG     H     +V     +++T  AC R        + G + S+G+G + QLG
Sbjct:    1 MLCWGNASYGQLGLGGIDEEIVVEPRKCEFFHGKRVRDVGCGRRHTAFLLEDGTVYTCGCNDLGQLG----HEKSRKKPEQVVALDAQIIVALSCGESHTLALNDKGQVFSWGLGSD--GQLG-LNNFEECIRVPRNIKSLSDVQVAQVACGYWHSLALSKGGHIFSWGQNRYGQLG----------LGMTGQSISVPQHLQSLQGIPFAQIAAGGAHSFALTLSGAVFGWGRNKFGQLGLNDTNDRCFPALLKALRSQRVIY--ISCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTNHEVNPRKVFELMGNVVTQIACGRQHTLAFTPSSGKMDSFGLGGNGQLG 328          
BLAST of Regulator of chromosome condensation vs. Ensembl Medaka
Match: herc3 (HECT and RLD domain containing E3 ubiquitin protein ligase 3 [Source:NCBI gene;Acc:101155493])

HSP 1 Score: 113.235 bits (282), Expect = 1.749e-25
Identity = 100/363 (27.55%), Postives = 160/363 (44.08%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGED---VLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGL--LKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLG-------RVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM-LDSNDILTIAACNRTSYALM-NDGTVYSWGMGSSYQLGHGDDEDVNVP 1217
            ++  G+   GQLG+G +   V E  R   V + + + EV  GG H++ L + G VYT G N  G LG     D+    P  V   D  K+  ++ G  HS  + E G+V++WG+   + G +GL   +   +IP       D  I ++  G  H   LS +G++FT+G    GQLG       ++SP+ +                      +    + AG     A S +G V+G G N   QLG+ +   + +   +    + +  +   + G  HT AL+ S  ++  G G  G LG G + +      VM L   ++  I      + A + + GTVY++G  S  QLG G   D+  P
Sbjct:    1 MLCWGNARDGQLGIGVEGNPVFEP-RICHVFSGRGLKEVACGGQHTLFLLQDGSVYTCGSNSCGQLG----HDKAGNSPELVGALDTQKITMVSCGRAHSVAVNEQGQVFVWGA--GDGGQLGLETAETAVRIPRLLKKLCDHSISQVVCGNQHCIALSRDGQLFTWGQNSSGQLGLGKGETSKLSPSPVKSLA-----------------GIPLAQITAGGDHCFALSLSGAVFGWGKNKAGQLGLNDKQDRAVPCHIKFLRSQRVVY--ISCGDEHTAALTKSGGLFTFGDGSRGQLGHGSSNNELLPRRVMELMGTEVSQITCGRHHTLAFVPSSGTVYAFGCNSHGQLGTGILADLRSP 337          
BLAST of Regulator of chromosome condensation vs. Ensembl Medaka
Match: herc3 (HECT and RLD domain containing E3 ubiquitin protein ligase 3 [Source:NCBI gene;Acc:101155493])

HSP 1 Score: 112.464 bits (280), Expect = 2.925e-25
Identity = 106/393 (26.97%), Postives = 170/393 (43.26%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGED---VLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGL--LKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLG-------RVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM-LDSNDILTIAACNRTSYALM-NDGTVYSWGMGSSYQLGHGDDEDVNVP--------TKMVGKQVSNMKIIEISPGFQH 1283
            ++  G+   GQLG+G +   V E  R   V + + + EV  GG H++ L + G VYT G N  G LG     D+    P  V   D  K+  ++ G  HS  + E G+V++WG+   + G +GL   +   +IP       D  I ++  G  H   LS +G++FT+G    GQLG       ++SP+ +                      +    + AG     A S +G V+G G N   QLG+ +   + +   +    + +  +   + G  HT AL+ S  ++  G G  G LG G + +      VM L   ++  I      + A + + GTVY++G  S  QLG G   D+  P        T  + K +    +I+I  G  H
Sbjct:    1 MLCWGNARDGQLGIGVEGNPVFEP-RICHVFSGRGLKEVACGGQHTLFLLQDGSVYTCGSNSCGQLG----HDKAGNSPELVGALDTQKITMVSCGRAHSVAVNEQGQVFVWGA--GDGGQLGLETAETAVRIPRLLKKLCDHSISQVVCGNQHCIALSRDGQLFTWGQNSSGQLGLGKGETSKLSPSPVKSLA-----------------GIPLAQITAGGDHCFALSLSGAVFGWGKNKAGQLGLNDKQDRAVPCHIKFLRSQRVVY--ISCGDEHTAALTKSGGLFTFGDGSRGQLGHGSSNNELLPRRVMELMGTEVSQITCGRHHTLAFVPSSGTVYAFGCNSHGQLGTGILADLRSPHPVKNDFLTLNLRKDLRKYTVIKIICGGDH 367          
BLAST of Regulator of chromosome condensation vs. Planmine SMEST
Match: SMESG000019132.1 (SMESG000019132.1)

HSP 1 Score: 1192.95 bits (3085), Expect = 0.000e+0
Identity = 623/628 (99.20%), Postives = 625/628 (99.52%), Query Frame = 3
Query:    3 MENRTRSSVVKSTPTRSTPQKRRQDSVGGTQKKAKFDLSYVEEECKRTFITQIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRDIVQEEDKIDEVAENQNEKLEPAENPNLESKNEMEVEITVTEPEISIPIETDISEETVNPEEREDKSIIIEEPMPLSLXXXXXXXXXXXXXXXQSIIIEKPMPLSLDTVPVVIVTAPEDETSTILETVPEETAVSVTNQEELTTAEEPKPIVLETIAETTDEPVEEKESDKGEINDTNNNALDQMEVEENQES 1886
            MENRTRSSVVKSTPTRSTPQKRRQDSVGGTQKKAKFDLSYVEEECKRTFITQIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEK+ SATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNLVRGGRGGLLPLLIPGLVRVRHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRDIVQEEDKIDEVAENQNEKLEPAENPNLESKNEMEVEITVTEPEISIPIETDISEETVNPEE+EDKSIIIEEPMPLSLETVPEE VNPEEKENQSIIIEKPMPLSLDTVPVVIVTAPEDETSTI ETVPEETAVSVTNQEELTTAEEPKPIVLETIAETTDEPVEEKESDKGEINDTNNNALDQMEVEENQES
Sbjct:    1 MENRTRSSVVKSTPTRSTPQKRRQDSVGGTQKKAKFDLSYVEEECKRTFITQIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKLSSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNLVRGGRGGLLPLLIPGLVRVRHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRDIVQEEDKIDEVAENQNEKLEPAENPNLESKNEMEVEITVTEPEISIPIETDISEETVNPEEKEDKSIIIEEPMPLSLETVPEEMVNPEEKENQSIIIEKPMPLSLDTVPVVIVTAPEDETSTIFETVPEETAVSVTNQEELTTAEEPKPIVLETIAETTDEPVEEKESDKGEINDTNNNALDQMEVEENQES 628          
BLAST of Regulator of chromosome condensation vs. Planmine SMEST
Match: SMESG000033113.1 (SMESG000033113.1)

HSP 1 Score: 111.309 bits (277), Expect = 7.804e-25
Identity = 94/351 (26.78%), Postives = 164/351 (46.72%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGL---GEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLG----VEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM--LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGD 1196
            + S G+   GQLG+    +D     +     +  D+ ++  G  H++ L K+G++Y+ G N+   LG     D +   P ++++ D  K+ID +AG +H++++T+ G V+ WG  +++ G +G  K  +             I+++A G +H   L+ N EIF++G    GQLG                 +  P  ++   ++    + AG   +   + +G +Y  G NNY QLG       + + LM+  L      K+     + GQ+H  ALS    ++  G G YG LG  + E+++    VM  L S         N T   +++ GTVY++G+G   QLG  D
Sbjct:  420 IFSFGAASYGQLGIDPRNKDYYSYPQKIDKISSSDIEKISCGFDHTLFLLKNGKLYSCGNNEFKKLG----HDCNKFKPNQIQMLDAHKLIDASAGYDHNAVVTDLGLVFTWG--KNSFGELGRDKLSDFSIKLVQSLTGHFIVQVACGHDHTLALTKNSEIFSWGANTCGQLG----------LGDNFDMVSTPQQIKNLSNLPIKSITAGDKFSFVLTPSGFLYSWGSNNYGQLGRDLTTSYESLPLMVKHLR-----KQPIVYVSVGQNHVAALSIDGGVFTWGHGRYGQLGHNNFENKSIPCIVMDLLGSKVSQIECGMNHTLAYMVSTGTVYAFGLGKFGQLGICD 749          

HSP 2 Score: 90.1225 bits (222), Expect = 2.482e-18
Identity = 73/241 (30.29%), Postives = 114/241 (47.30%), Query Frame = 3
Query:  168 FVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKD--VIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIG--LLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKS-TTGEVYGCGLNNYKQLGV 875
             V + G    G+LG   D L      LV +L    +++V  G  H++ L+K+ +++++G N  G LG     D  +T P ++K   ++ +  ITAGD  S +LT  G +Y WGS  +N G +G  L   +E +P        + I+ ++ G+NH A LS +G +FT+G    GQLG  +  N         L              K   +  G   T+A   +TG VY  GL  + QLG+
Sbjct:  523 LVFTWGKNSFGELG--RDKLSDFSIKLVQSLTGHFIVQVACGHDHTLALTKNSEIFSWGANTCGQLGLGDNFDMVST-PQQIKNLSNLPIKSITAGDKFSFVLTPSGFLYSWGS--NNYGQLGRDLTTSYESLPLMVKHLRKQPIVYVSVGQNHVAALSIDGGVFTWGHGRYGQLGHNNFENKSIPCIVMDLL-----------GSKVSQIECGMNHTLAYMVSTGTVYAFGLGKFGQLGI 747          

HSP 3 Score: 80.4925 bits (197), Expect = 2.697e-15
Identity = 86/347 (24.78%), Postives = 145/347 (41.79%), Query Frame = 3
Query:  300 ICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVD-KKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSF-----C----TIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKE-DWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM---LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPT---KMVGKQVSNMKIIEISPGFQHVL 1289
            I + K   +++FG    G LG      +  + P ++       +  I+ G +H+  L ++GK+Y  G    NN    L     K     +  +D  K+I  ++G +H A+++D G +FT+G    G+LGR                           S+K      G F     C    T+A +   E++  G N   QLG+ ++    M+++  +  NL     K    G   +  L+ S  +Y  G   YG LG+ D     ++  +M   L    I+ ++       AL  DG V++WG G   QLGH + E+ ++P     ++G +VS     +I  G  H L
Sbjct:  412 IIILKMISIFSFGAASYGQLGIDPRNKDYYSYPQKIDKISSSDIEKISCGFDHTLFLLKNGKLYSCG----NNEFKKLGHDCNKFKPNQIQMLDAHKLIDASAGYDHNAVVTDLGLVFTWGKNSFGELGR---------------------DKLSDFSIKLVQSLTGHFIVQVACGHDHTLALTKNSEIFSWGANTCGQLGLGDNFD--MVSTPQQIKNLSNLPIKSITAGDKFSFVLTPSGFLYSWGSNNYGQLGR-DLTTSYESLPLMVKHLRKQPIVYVSVGQNHVAALSIDGGVFTWGHGRYGQLGHNNFENKSIPCIVMDLLGSKVS-----QIECGMNHTL 725          

HSP 4 Score: 61.2326 bits (147), Expect = 2.657e-9
Identity = 64/246 (26.02%), Postives = 103/246 (41.87%), Query Frame = 3
Query:  594 KIASGENHFAMLSDNGEIFTFGCAEQGQLG----RVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLG---VEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM--LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVD 1304
            KI+ G +H   L  NG++++ G  E  +LG    +  PN +                       K  D  AG       +  G V+  G N++ +LG   + +  I+L+ +  G F        + A G  HT+AL+ ++ I+  G    G LG GDN       + +  L +  I +I A ++ S+ L   G +YSWG  +  QLG            MV K +    I+ +S G  HV   ++D
Sbjct:  457 KISCGFDHTLFLLKNGKLYSCGNNEFKKLGHDCNKFKPNQIQMLDAH-----------------KLIDASAGYDHNAVVTDLGLVFTWGKNSFGELGRDKLSDFSIKLVQSLTGHF------IVQVACGHDHTLALTKNSEIFSWGANTCGQLGLGDNFDMVSTPQQIKNLSNLPIKSITAGDKFSFVLTPSGFLYSWGSNNYGQLGRDLTTSYESLPLMV-KHLRKQPIVYVSVGQNHVAALSID 678          
BLAST of Regulator of chromosome condensation vs. Planmine SMEST
Match: SMESG000033113.1 (SMESG000033113.1)

HSP 1 Score: 109.383 bits (272), Expect = 2.792e-24
Identity = 95/359 (26.46%), Postives = 170/359 (47.35%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGL---GEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVD----KKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLG----VEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM--LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDV 1208
            + S G+   GQLG+    +D     +     +  D+ ++  G  H++ L K+G++Y+ G N+   LG     D +   P ++++ D  K+ID +AG +H++++T+ G V+ WG  +++ G +G     +K+   ++  V       I+++A G +H   L+ N EIF++G    GQLG                 +  P  ++   ++    + AG   +   + +G +Y  G NNY QLG       + + LM+  L      K+     + GQ+H  ALS    ++  G G YG LG  + E+++    VM  L S         N T   +++ GTVY++G+G   QLG  D  ++
Sbjct:  136 IFSFGAASYGQLGIDPRNKDYYSYPQKIDKISSSDIEKISCGFDHTLFLLKNGKLYSCGNNEFKKLG----HDCNKFKPNQIQMLDAHKLIDASAGYDHNAVVTDLGLVFTWG--KNSFGELGR----DKLSDFSIKLVQSLTGHFIVQVACGHDHTLALTKNSEIFSWGANTCGQLG----------LGDNFDMVSTPQQIKNLSNLPIKSITAGDKFSFVLTPSGFLYSWGSNNYGQLGRDLTTSYESLPLMVKHLR-----KQPIVYVSVGQNHVAALSIDGGVFTWGHGRYGQLGHNNFENKSIPCIVMDLLGSKVSQIECGMNHTLAYMVSTGTVYAFGLGKFGQLGICDTVEI 469          

HSP 2 Score: 78.1814 bits (191), Expect = 1.409e-14
Identity = 86/347 (24.78%), Postives = 145/347 (41.79%), Query Frame = 3
Query:  300 ICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVD-KKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSF-----C----TIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKE-DWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM---LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPT---KMVGKQVSNMKIIEISPGFQHVL 1289
            I + K   +++FG    G LG      +  + P ++       +  I+ G +H+  L ++GK+Y  G    NN    L     K     +  +D  K+I  ++G +H A+++D G +FT+G    G+LGR                           S+K      G F     C    T+A +   E++  G N   QLG+ ++    M+++  +  NL     K    G   +  L+ S  +Y  G   YG LG+ D     ++  +M   L    I+ ++       AL  DG V++WG G   QLGH + E+ ++P     ++G +VS     +I  G  H L
Sbjct:  128 IIILKMISIFSFGAASYGQLGIDPRNKDYYSYPQKIDKISSSDIEKISCGFDHTLFLLKNGKLYSCG----NNEFKKLGHDCNKFKPNQIQMLDAHKLIDASAGYDHNAVVTDLGLVFTWGKNSFGELGR---------------------DKLSDFSIKLVQSLTGHFIVQVACGHDHTLALTKNSEIFSWGANTCGQLGLGDNFD--MVSTPQQIKNLSNLPIKSITAGDKFSFVLTPSGFLYSWGSNNYGQLGR-DLTTSYESLPLMVKHLRKQPIVYVSVGQNHVAALSIDGGVFTWGHGRYGQLGHNNFENKSIPCIVMDLLGSKVS-----QIECGMNHTL 441          

HSP 3 Score: 59.6918 bits (143), Expect = 7.175e-9
Identity = 64/246 (26.02%), Postives = 103/246 (41.87%), Query Frame = 3
Query:  594 KIASGENHFAMLSDNGEIFTFGCAEQGQLG----RVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLG---VEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM--LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVD 1304
            KI+ G +H   L  NG++++ G  E  +LG    +  PN +                       K  D  AG       +  G V+  G N++ +LG   + +  I+L+ +  G F        + A G  HT+AL+ ++ I+  G    G LG GDN       + +  L +  I +I A ++ S+ L   G +YSWG  +  QLG            MV K +    I+ +S G  HV   ++D
Sbjct:  173 KISCGFDHTLFLLKNGKLYSCGNNEFKKLGHDCNKFKPNQIQMLDAH-----------------KLIDASAGYDHNAVVTDLGLVFTWGKNSFGELGRDKLSDFSIKLVQSLTGHF------IVQVACGHDHTLALTKNSEIFSWGANTCGQLGLGDNFDMVSTPQQIKNLSNLPIKSITAGDKFSFVLTPSGFLYSWGSNNYGQLGRDLTTSYESLPLMV-KHLRKQPIVYVSVGQNHVAALSID 394          
BLAST of Regulator of chromosome condensation vs. Planmine SMEST
Match: SMESG000033113.1 (SMESG000033113.1)

HSP 1 Score: 107.457 bits (267), Expect = 8.376e-24
Identity = 95/359 (26.46%), Postives = 170/359 (47.35%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGL---GEDVLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVD----KKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLG----VEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM--LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDV 1208
            + S G+   GQLG+    +D     +     +  D+ ++  G  H++ L K+G++Y+ G N+   LG     D +   P ++++ D  K+ID +AG +H++++T+ G V+ WG  +++ G +G     +K+   ++  V       I+++A G +H   L+ N EIF++G    GQLG                 +  P  ++   ++    + AG   +   + +G +Y  G NNY QLG       + + LM+  L      K+     + GQ+H  ALS    ++  G G YG LG  + E+++    VM  L S         N T   +++ GTVY++G+G   QLG  D  ++
Sbjct:    4 IFSFGAASYGQLGIDPRNKDYYSYPQKIDKISSSDIEKISCGFDHTLFLLKNGKLYSCGNNEFKKLG----HDCNKFKPNQIQMLDAHKLIDASAGYDHNAVVTDLGLVFTWG--KNSFGELGR----DKLSDFSIKLVQSLTGHFIVQVACGHDHTLALTKNSEIFSWGANTCGQLG----------LGDNFDMVSTPQQIKNLSNLPIKSITAGDKFSFVLTPSGFLYSWGSNNYGQLGRDLTTSYESLPLMVKHLR-----KQPIVYVSVGQNHVAALSIDGGVFTWGHGRYGQLGHNNFENKSIPCIVMDLLGSKVSQIECGMNHTLAYMVSTGTVYAFGLGKFGQLGICDTVEI 337          

HSP 2 Score: 75.485 bits (184), Expect = 8.890e-14
Identity = 84/339 (24.78%), Postives = 142/339 (41.89%), Query Frame = 3
Query:  324 VYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVD-KKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSF-----C----TIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMMTSLGEFNNLKE-DWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM---LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPT---KMVGKQVSNMKIIEISPGFQHVL 1289
            +++FG    G LG      +  + P ++       +  I+ G +H+  L ++GK+Y  G    NN    L     K     +  +D  K+I  ++G +H A+++D G +FT+G    G+LGR                           S+K      G F     C    T+A +   E++  G N   QLG+ ++    M+++  +  NL     K    G   +  L+ S  +Y  G   YG LG+ D     ++  +M   L    I+ ++       AL  DG V++WG G   QLGH + E+ ++P     ++G +VS     +I  G  H L
Sbjct:    4 IFSFGAASYGQLGIDPRNKDYYSYPQKIDKISSSDIEKISCGFDHTLFLLKNGKLYSCG----NNEFKKLGHDCNKFKPNQIQMLDAHKLIDASAGYDHNAVVTDLGLVFTWGKNSFGELGR---------------------DKLSDFSIKLVQSLTGHFIVQVACGHDHTLALTKNSEIFSWGANTCGQLGLGDNFD--MVSTPQQIKNLSNLPIKSITAGDKFSFVLTPSGFLYSWGSNNYGQLGR-DLTTSYESLPLMVKHLRKQPIVYVSVGQNHVAALSIDGGVFTWGHGRYGQLGHNNFENKSIPCIVMDLLGSKVS-----QIECGMNHTL 309          

HSP 3 Score: 58.151 bits (139), Expect = 1.873e-8
Identity = 64/246 (26.02%), Postives = 103/246 (41.87%), Query Frame = 3
Query:  594 KIASGENHFAMLSDNGEIFTFGCAEQGQLG----RVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLG---VEEDLIQLMMTSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVM--LDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVD 1304
            KI+ G +H   L  NG++++ G  E  +LG    +  PN +                       K  D  AG       +  G V+  G N++ +LG   + +  I+L+ +  G F        + A G  HT+AL+ ++ I+  G    G LG GDN       + +  L +  I +I A ++ S+ L   G +YSWG  +  QLG            MV K +    I+ +S G  HV   ++D
Sbjct:   41 KISCGFDHTLFLLKNGKLYSCGNNEFKKLGHDCNKFKPNQIQMLDAH-----------------KLIDASAGYDHNAVVTDLGLVFTWGKNSFGELGRDKLSDFSIKLVQSLTGHFI------VQVACGHDHTLALTKNSEIFSWGANTCGQLGLGDNFDMVSTPQQIKNLSNLPIKSITAGDKFSFVLTPSGFLYSWGSNNYGQLGRDLTTSYESLPLMV-KHLRKQPIVYVSVGQNHVAALSID 262          
BLAST of Regulator of chromosome condensation vs. Planmine SMEST
Match: SMESG000054104.1 (SMESG000054104.1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.048e-19
Identity = 93/345 (26.96%), Postives = 162/345 (46.96%), Query Frame = 3
Query:  318 GQVYTFGCNDEGALGRTIVEDEDATVPGEVKLP------DDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVP-----VDKK-IIKIA--SGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQL---MMTSLGEFNNLKEDWKKFAFGQH--HTIALSASNRIYVIGRGEYGNLGQGDNEHRT--KATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVL 1289
             ++Y +G ND+  LG             +VKLP       ++  + I+ G      +T  GKVY+ G    +NG +G+    +      + P     +DK  I+K+A  SG  H   L+ NGE F++G  + G+LG  S            L L  P  ++     +  D+  GS  + A    G +Y  GL +Y +LG  +  ++L   ++ SL ++  ++      A G     T+AL++   ++  G G++G LG+G +      +  E M  SN ++ I    ++S+AL  +G V++WG G  Y+LGHG D+ +  P ++  + +   KI+ ++ G  H L
Sbjct: 3123 SKIYVWGLNDKDQLG--------CEATSKVKLPILNEALSELDCVSISGGSKSLFCVTRTGKVYVAGD--SSNGRLGIGSDTDITAEVIIGPKRLEALDKYFIVKVAVHSGGRHAIALTKNGETFSWGEGDDGKLGHNS-----------RLKLNYPRKIKYFKGKRVVDVACGSSHSAAIVFGGHLYTWGLGDYGRLGHGDTAMRLHPELVKSLRDYKVVQ-----VACGSRDAQTLALTSDFTVWSWGDGDFGKLGRGGSSGCLIPQKIECMSLSN-VIQIECGAQSSFALTENGQVWTWGKGDYYRLGHGTDKHIREPMQI--EDLKKTKIVHLAVGALHCL 3438          

HSP 2 Score: 82.4185 bits (202), Expect = 7.680e-16
Identity = 92/346 (26.59%), Postives = 158/346 (45.66%), Query Frame = 3
Query:  309 SKSG-QVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVP--VDKKIIKIA--SGENHFAMLSDNGEIFTFGCAEQGQLG---RVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGV---EEDLIQLMMTSLGEFNNL-----KEDWKKFAFGQHH--TIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEV-MLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVL 1289
            S SG +V+++G N  G LG   VE     VP   +    ++   I  G+    I++ DG+VY  G    NNG +G+    E + +  LV    +K ++K+A  SG  H   L +NG ++ +G AE  +LG   RV P   V         +            +  D+ AG   + A S +GE+Y  G   Y +LG    ++     ++ +L  ++ +       D +     ++    I L  +  ++  G G+YG LG+G  +      ++  L+   ++ +   ++ S  L   G VY+WG G  ++LGHG D  V  P K+   Q++  KII+++ G  H +
Sbjct: 4126 SASGLEVWSWGHNHRGQLGG--VEGSKIKVPVLCEHLSALRPRQIIGGEQSLFIVSIDGRVYATGF--GNNGRLGI-GSTESVQTPILVSGLEEKIVVKVAVNSGGKHCLALCNNGLVYAWGDAEDNKLGLDIRVQPGEDVLTPTLVKSLV----------KAEIIDIAAGGSHSAAISRSGELYTWGKGRYGRLGHGNGDDQPFPKIVEALRGYHVIGVACGSGDAQTLCITKNEDSRIDLVPNTSVWSWGDGDYGKLGRGGFDICKLPMKIETLEGAGVIKVDCGSQFSLVLTASGEVYTWGKGDYFRLGHGSDNHVRKPEKVA--QLNRKKIIDVACGSLHCI 4454          

HSP 3 Score: 74.3294 bits (181), Expect = 2.867e-13
Identity = 93/432 (21.53%), Postives = 183/432 (42.36%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGED--------VLEKKRPALVSTLKDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKI-PSATLVPVDKKIIKIASG--ENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNXXXXXXXXXXXXXXXXXXXXXHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQL--GVEEDLIQLMMTSLGEFNNLKEDWKK-----FAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGH-GDDEDVNVPTKMVG-----KQVS-NMKIIEISPGFQHVLFRA------------VDRDIVQEEDKIDEVAENQ 1355
            V   G    G+LG+G D        +  K+  AL       + V +GG H+I L+K+G+ +++G  D+G LG           P ++K     +V+D+  G +HS+ +   G +Y WG    + G +G      ++ P       D K++++A G  +     L+ +  ++++G  + G+LGR   +  +   +   + L     +             G+  + A +  G+V+  G  +Y +L  G ++ + + M           ED KK      A G  H +A++   ++Y  G  ++G  G G   +  + T V                  ALM D  +     GSS+ +     D D  +P++ +      K++S ++ +++ SP    +LF+             +D++I Q+ ++ DE  +++
Sbjct: 3177 VYVAGDSSNGRLGIGSDTDITAEVIIGPKRLEALDKYFIVKVAVHSGGRHAIALTKNGETFSWGEGDDGKLGHN--SRLKLNYPRKIKYFKGKRVVDVACGSSHSAAIVFGGHLYTWG--LGDYGRLGHGDTAMRLHPELVKSLRDYKVVQVACGSRDAQTLALTSDFTVWSWGDGDFGKLGRGGSSGCLIPQKIECMSLSNVIQIE-----------CGAQSSFALTENGQVWTWGKGDYYRLGHGTDKHIREPMQI---------EDLKKTKIVHLAVGALHCLAVTDRGQVYSWGDNDHGQQGNGTVTYNMRPTLVS-----------------ALM-DNKIAHVACGSSHSVAWTASDLDSFLPSQALNRWPHIKEMSYSLSVLDFSP----LLFKFNPDPLGAGDVFDIDKNIFQKRNRSDETTQSK 3562          

HSP 4 Score: 71.2478 bits (173), Expect = 2.391e-12
Identity = 68/245 (27.76%), Postives = 102/245 (41.63%), Query Frame = 3
Query:  168 FVMSMGSGDTGQLGL------GEDVLEKKRPALVSTL--KDVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGR---------------------------------TIVEDEDA---TVPGE--------------------VKLPDDIK------VIDITAGDNHSSILTEDGKVYIWGS---FRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLG 683
             V + G  +  +LGL      GEDVL    P LV +L   ++I++ AGG HS  +S+SG++YT+G    G LG                                   I ++ED+    VP                       KLP  I+      VI +  G   S +LT  G+VY WG    FR  +G    ++  EK+         KKII +A G  H    +++GE++++G  ++GQLG
Sbjct: 4237 LVYAWGDAEDNKLGLDIRVQPGEDVLT---PTLVKSLVKAEIIDIAAGGSHSAAISRSGELYTWGKGRYGRLGHGNGDDQPFPKIVEALRGYHVIGVACGSGDAQTLCITKNEDSRIDLVPNTSVWSWGDGDYGKLGRGGFDICKLPMKIETLEGAGVIKVDCGSQFSLVLTASGEVYTWGKGDYFRLGHGSDNHVRKPEKVAQLN----RKKIIDVACGSLHCICCTEDGEVYSWGDNDEGQLG 4474          

HSP 5 Score: 68.5514 bits (166), Expect = 1.454e-11
Identity = 61/179 (34.08%), Postives = 87/179 (48.60%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVI--EVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVK-LPDDIKV-IDITAGDNHSSILTEDGKVYIWGSFRDNN-GLIGLLKPFEKIPSATLVP--VDKKIIKIASGENHFAMLSDNGEIFTFGCAEQGQLGR 686
            V S G    GQLG G +  + K P L   L  +   ++  G      +S  G+VY  G  + G LG  I   E    P  V  L + I V + + +G  H   L  +G VY WG   DN  GL   ++P E + + TLV   V  +II IA+G +H A +S +GE++T+G    G+LG 
Sbjct: 4132 VWSWGHNHRGQLG-GVEGSKIKVPVLCEHLSALRPRQIIGGEQSLFIVSIDGRVYATGFGNNGRLG--IGSTESVQTPILVSGLEEKIVVKVAVNSGGKHCLALCNNGLVYAWGDAEDNKLGLDIRVQPGEDVLTPTLVKSLVKAEIIDIAAGGSHSAAISRSGELYTWGKGRYGRLGH 4307          

HSP 6 Score: 65.4698 bits (158), Expect = 1.548e-10
Identity = 44/121 (36.36%), Postives = 65/121 (53.72%), Query Frame = 3
Query:  171 VMSMGSGDTGQLGLGEDVLEKKRPALVSTLK----DVIEVRAGGMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKV-IDITAGDNHSSI-LTEDGKVYIWGSFRDN 515
            V S G+  +G+LG G D  ++KRP ++ T       V +V  G  HS+ L++SG +Y+ G N  G LG   V+D    +P  +   D I V +   A D H S+ L+ DG ++ WGS  DN
Sbjct:  540 VYSWGTNTSGKLGQG-DTKDRKRPTIIDTFSRCHLQVKQVACGEEHSLILTQSGDIYSCGRNHMGQLGHGDVKDRH--LPIRITASDLIGVLVKQIAVDGHQSMCLSNDGAIFTWGSTFDN 657          

HSP 7 Score: 52.7582 bits (125), Expect = 1.062e-6
Identity = 28/80 (35.00%), Postives = 40/80 (50.00%), Query Frame = 3
Query:  957 GQHHTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEV-MLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHG 1193
            G   ++ L+AS  +Y  G+G+Y  LG G + H  K  +V  L+   I+ +A  +        DG VYSWG     QLG G
Sbjct: 4397 GSQFSLVLTASGEVYTWGKGDYFRLGHGSDNHVRKPEKVAQLNRKKIIDVACGSLHCICCTEDGEVYSWGDNDEGQLGDG 4476          

HSP 8 Score: 51.2174 bits (121), Expect = 2.866e-6
Identity = 44/171 (25.73%), Postives = 78/171 (45.61%), Query Frame = 3
Query:  966 HTIALSASNRIYVIGRGEYGNLGQGDNEHRTKATEVMLDSNDILTI--AACNR-TSYALMNDGTVYSWGMGSSYQLGHGDDEDVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRDIVQEEDKIDEVAE---NQNEKLEPAENPNLESKNEMEVEITVTEPEISIPIET 1460
            H +A++ + ++Y  G    G LGQGD + R + T +   S   L +   AC    S  L   G +YS G     QLGHGD +D ++P ++    +  + + +I+      +  + D  I       D       N + K+E   N   E +NE++ +I V +   S+ +++
Sbjct:  530 HVLAVTEAGQVYSWGTNTSGKLGQGDTKDRKRPTIIDTFSRCHLQVKQVACGEEHSLILTQSGDIYSCGRNHMGQLGHGDVKDRHLPIRITASDLIGVLVKQIAVDGHQSMCLSNDGAIFTWGSTFDNCRRHLSNWSPKIETCVN---EYRNEID-QIQVHDSTYSVLLKS 696          

HSP 9 Score: 50.447 bits (119), Expect = 5.460e-6
Identity = 42/139 (30.22%), Postives = 75/139 (53.96%), Query Frame = 3
Query:  267 VIEVRAG--GMHSICLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGDNHSSILTEDGKVYIWGSFRDNNGLIGL--LKPFE---KIPSATLVPVDKKIIKIASGENHFAM-LSDNGEIFTFG 659
            VI+V A     H + ++++GQVY++G N  G LG+   +D       +      ++V  +  G+ HS ILT+ G +Y  G  R++ G +G   +K      +I ++ L+ V   ++K  + + H +M LS++G IFT+G
Sbjct:  519 VIDVDANIYSSHVLAVTEAGQVYSWGTNTSGKLGQGDTKDRKRPTIIDTFSRCHLQVKQVACGEEHSLILTQSGDIYSCG--RNHMGQLGHGDVKDRHLPIRITASDLIGV---LVKQIAVDGHQSMCLSNDGAIFTWG 652          
The following BLAST results are available for this feature:
BLAST of Regulator of chromosome condensation vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RCC15.521e-11141.57regulator of chromosome condensation 1 [Source:HGN... [more]
RCC15.521e-11141.57regulator of chromosome condensation 1 [Source:HGN... [more]
RCC15.521e-11141.57regulator of chromosome condensation 1 [Source:HGN... [more]
RCC11.276e-11043.04regulator of chromosome condensation 1 [Source:HGN... [more]
RCC11.276e-11043.04regulator of chromosome condensation 1 [Source:HGN... [more]
back to top
BLAST of Regulator of chromosome condensation vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ran-37.517e-3931.69Regulator of chromosome condensation [Source:UniP... [more]
herc-12.537e-2228.48HECT and RCC domain E3 ubiquitin ligase [Source:U... [more]
herc-12.537e-2228.48HECT and RCC domain E3 ubiquitin ligase [Source:U... [more]
rpm-13.292e-1133.70E3 ubiquitin-protein ligase rpm-1 [Source:UniProt... [more]
F07B7.123.306e-1133.70pep chromosome:WBcel235:V:8854993:8862049:-1 gene:... [more]
back to top
BLAST of Regulator of chromosome condensation vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rcc11.674e-8040.25gene:FBgn0002638 transcript:FBtr0077075[more]
Rcc11.674e-8040.25gene:FBgn0002638 transcript:FBtr0077076[more]
Rcc11.674e-8040.25gene:FBgn0002638 transcript:FBtr0077074[more]
Herc41.225e-2930.35gene:FBgn0035207 transcript:FBtr0072670[more]
Herc41.225e-2930.35gene:FBgn0035207 transcript:FBtr0072671[more]
back to top
BLAST of Regulator of chromosome condensation vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rcc14.504e-11344.14regulator of chromosome condensation 1 [Source:ZFI... [more]
herc42.465e-2626.16HECT and RLD domain containing E3 ubiquitin protei... [more]
herc37.134e-2226.93HECT and RLD domain containing E3 ubiquitin protei... [more]
herc27.008e-2126.50HECT and RLD domain containing E3 ubiquitin protei... [more]
herc28.981e-2126.50HECT and RLD domain containing E3 ubiquitin protei... [more]
back to top
BLAST of Regulator of chromosome condensation vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sema3d5.156e-10543.93semaphorin 3D [Source:Xenbase;Acc:XB-GENE-490694][more]
sema3d8.817e-10543.93semaphorin 3D [Source:Xenbase;Acc:XB-GENE-490694][more]
sema3d9.065e-10543.93semaphorin 3D [Source:Xenbase;Acc:XB-GENE-490694][more]
sema3d1.321e-10443.93semaphorin 3D [Source:Xenbase;Acc:XB-GENE-490694][more]
sema3d3.503e-10443.34semaphorin 3D [Source:Xenbase;Acc:XB-GENE-490694][more]
back to top
BLAST of Regulator of chromosome condensation vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rcc13.774e-11244.07regulator of chromosome condensation 1 [Source:MGI... [more]
Rcc13.774e-11244.07regulator of chromosome condensation 1 [Source:MGI... [more]
Rcc16.921e-11244.07regulator of chromosome condensation 1 [Source:MGI... [more]
Herc42.044e-3128.42hect domain and RLD 4 [Source:MGI Symbol;Acc:MGI:1... [more]
Herc42.567e-3128.42hect domain and RLD 4 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Regulator of chromosome condensation vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P23800|RCC1_MESAU1.560e-11143.70Regulator of chromosome condensation OS=Mesocricet... [more]
sp|Q8VE37|RCC1_MOUSE2.640e-11144.07Regulator of chromosome condensation OS=Mus muscul... [more]
sp|P18754|RCC1_HUMAN2.652e-11041.57Regulator of chromosome condensation OS=Homo sapie... [more]
sp|P25183|RCC1_XENLA1.448e-10442.82Regulator of chromosome condensation OS=Xenopus la... [more]
sp|P25171|RCC1_DROME1.678e-7940.25Regulator of chromosome condensation OS=Drosophila... [more]
back to top
BLAST of Regulator of chromosome condensation vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2K6F3977.701e-11043.81Regulator of chromosome condensation 1 OS=Propithe... [more]
Q6NY651.008e-10944.14Regulator of chromosome condensation 1 OS=Danio re... [more]
A0A2K6F3931.770e-10943.81Regulator of chromosome condensation 1 OS=Propithe... [more]
F7I7F57.104e-10943.30Regulator of chromosome condensation isoform c OS=... [more]
U3BWS98.711e-10943.30Regulator of chromosome condensation isoform c OS=... [more]
back to top
BLAST of Regulator of chromosome condensation vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rcc16.597e-6849.54regulator of chromosome condensation 1 [Source:ZFI... [more]
rcc11.399e-6749.54regulator of chromosome condensation 1 [Source:ZFI... [more]
herc41.288e-2627.01HECT and RLD domain containing E3 ubiquitin protei... [more]
herc41.781e-2627.01HECT and RLD domain containing E3 ubiquitin protei... [more]
herc33.356e-2325.35HECT and RLD domain containing E3 ubiquitin protei... [more]
back to top
BLAST of Regulator of chromosome condensation vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rcc14.566e-10945.08regulator of chromosome condensation 1 [Source:ZFI... [more]
ENSPMAT00000007593.11.487e-5555.70pep scaffold:Pmarinus_7.0:GL489435:1357:4090:-1 ge... [more]
rcc22.672e-2025.00regulator of chromosome condensation 2 [Source:NCB... [more]
ENSPMAT00000001275.11.068e-1727.53pep scaffold:Pmarinus_7.0:GL476529:184068:212443:-... [more]
rcc27.295e-1424.34regulator of chromosome condensation 2 [Source:NCB... [more]
back to top
BLAST of Regulator of chromosome condensation vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SRM14.741e-3725.89Nucleotide exchange factor for Gsp1p; localizes to... [more]
back to top
BLAST of Regulator of chromosome condensation vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO332454.003e-9442.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345921.283e-2828.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371961.218e-2026.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490991.052e-1928.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478745.042e-1827.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Regulator of chromosome condensation vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rcc12.401e-10942.59regulator of chromosome condensation 1 [Source:NCB... [more]
herc47.115e-2727.38HECT and RLD domain containing E3 ubiquitin protei... [more]
herc41.063e-2627.38HECT and RLD domain containing E3 ubiquitin protei... [more]
herc31.749e-2527.55HECT and RLD domain containing E3 ubiquitin protei... [more]
herc32.925e-2526.97HECT and RLD domain containing E3 ubiquitin protei... [more]
back to top
BLAST of Regulator of chromosome condensation vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019132.10.000e+099.20SMESG000019132.1[more]
SMESG000033113.17.804e-2526.78SMESG000033113.1[more]
SMESG000033113.12.792e-2426.46SMESG000033113.1[more]
SMESG000033113.18.376e-2426.46SMESG000033113.1[more]
SMESG000054104.11.048e-1926.96SMESG000054104.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004700 ID=SMED30004700|Name=Regulator of chromosome condensation|organism=Schmidtea mediterranea sexual|type=transcript|length=2011bp
ATATGGAAAATAGAACTAGATCGTCTGTGGTCAAATCAACACCAACTAGA
TCTACTCCTCAGAAACGTAGACAAGATTCCGTTGGTGGCACACAAAAAAA
AGCTAAATTTGATTTATCATATGTTGAGGAGGAATGTAAAAGAACATTTA
TCACACAAATTCCTTCGTTTGTTATGTCAATGGGTAGTGGTGACACAGGT
CAATTAGGTCTCGGTGAAGATGTTTTAGAAAAGAAAAGACCCGCTCTTGT
TTCTACTTTAAAGGATGTAATTGAAGTTCGCGCTGGTGGAATGCATTCAA
TTTGTTTGTCAAAAAGTGGGCAAGTATATACATTTGGCTGTAATGATGAA
GGAGCTTTGGGTAGAACTATCGTCGAAGATGAAGACGCAACAGTTCCAGG
CGAAGTTAAATTACCAGATGATATTAAAGTTATTGATATAACTGCTGGTG
ATAATCATAGTTCTATTCTGACAGAAGATGGAAAAGTTTATATTTGGGGT
AGTTTCAGAGACAATAATGGTCTAATCGGACTATTGAAACCGTTTGAAAA
AATACCATCAGCAACACTAGTTCCGGTCGATAAGAAAATCATCAAAATTG
CTTCGGGCGAAAATCATTTTGCTATGCTTTCTGATAATGGAGAAATTTTT
ACATTTGGCTGTGCGGAACAAGGTCAACTTGGTCGAGTAAGCCCGAATAA
TTTAGTGCGAGGCGGTCGTGGGGGGTTGTTGCCACTATTGATTCCTGGGC
TAGTTAGGGTGCGCCATTCGGTGAAATTCTGTGATTTATGGGCTGGTTCG
TTTTGCACCATCGCAAAATCGACTACTGGGGAAGTCTACGGATGCGGACT
GAATAATTACAAGCAATTAGGAGTCGAGGAAGATCTCATTCAGTTAATGA
TGACGAGTTTGGGAGAATTTAATAATCTGAAAGAAGATTGGAAGAAATTT
GCATTCGGTCAACATCATACAATTGCGCTTAGCGCGTCCAACCGAATTTA
CGTCATTGGTCGAGGTGAATATGGCAATCTCGGACAAGGTGACAATGAGC
ACAGGACAAAAGCTACCGAGGTGATGCTGGATTCAAACGACATTCTGACA
ATCGCAGCTTGTAATCGGACCTCATATGCATTGATGAATGATGGAACGGT
TTATTCATGGGGAATGGGCAGCAGTTATCAGTTGGGTCACGGAGATGACG
AGGACGTTAATGTTCCCACAAAAATGGTTGGCAAACAAGTCTCTAACATG
AAAATCATCGAAATAAGTCCTGGTTTCCAACACGTGTTATTCAGAGCTGT
TGATAGAGACATAGTCCAAGAGGAGGACAAAATCGATGAGGTTGCTGAAA
ACCAAAACGAAAAATTGGAACCGGCTGAAAATCCAAACTTAGAATCCAAA
AATGAAATGGAAGTTGAAATTACCGTAACTGAACCTGAGATTTCTATTCC
AATAGAAACCGATATTTCCGAAGAAACAGTCAACCCAGAAGAGAGAGAAG
ACAAATCAATAATCATTGAAGAACCGATGCCGTTGTCACTGGAAACTGTT
CCAGAAGAAACGGTCAACCCAGAAGAGAAAGAAAACCAATCAATAATCAT
TGAAAAACCGATGCCGTTGTCATTAGATACTGTTCCAGTAGTGATAGTCA
CAGCTCCGGAAGACGAAACATCAACAATATTGGAAACAGTTCCAGAAGAA
ACAGCAGTATCAGTCACGAATCAAGAAGAATTGACAACTGCCGAGGAACC
AAAACCGATTGTGTTGGAAACTATTGCTGAAACTACAGATGAACCCGTTG
AAGAAAAAGAATCTGATAAAGGTGAAATAAATGATACGAACAACAACGCA
CTTGATCAAATGGAAGTTGAAGAGAACCAAGAGAGCTAAATTTGACATTT
TACCTTGGCTGAAAATAAAAATTTATTGTGAAATCTAAATAAAATTAACA
ATTTAATTTAATGTTATAAATGCATTTTGACGCTATCATTTGCTGAGGGA
TTGTCTGTGAG
back to top

protein sequence of SMED30004700-orf-1

>SMED30004700-orf-1 ID=SMED30004700-orf-1|Name=SMED30004700-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=629bp
MENRTRSSVVKSTPTRSTPQKRRQDSVGGTQKKAKFDLSYVEEECKRTFI
TQIPSFVMSMGSGDTGQLGLGEDVLEKKRPALVSTLKDVIEVRAGGMHSI
CLSKSGQVYTFGCNDEGALGRTIVEDEDATVPGEVKLPDDIKVIDITAGD
NHSSILTEDGKVYIWGSFRDNNGLIGLLKPFEKIPSATLVPVDKKIIKIA
SGENHFAMLSDNGEIFTFGCAEQGQLGRVSPNNLVRGGRGGLLPLLIPGL
VRVRHSVKFCDLWAGSFCTIAKSTTGEVYGCGLNNYKQLGVEEDLIQLMM
TSLGEFNNLKEDWKKFAFGQHHTIALSASNRIYVIGRGEYGNLGQGDNEH
RTKATEVMLDSNDILTIAACNRTSYALMNDGTVYSWGMGSSYQLGHGDDE
DVNVPTKMVGKQVSNMKIIEISPGFQHVLFRAVDRDIVQEEDKIDEVAEN
QNEKLEPAENPNLESKNEMEVEITVTEPEISIPIETDISEETVNPEERED
KSIIIEEPMPLSLETVPEETVNPEEKENQSIIIEKPMPLSLDTVPVVIVT
APEDETSTILETVPEETAVSVTNQEELTTAEEPKPIVLETIAETTDEPVE
EKESDKGEINDTNNNALDQMEVEENQES*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005694chromosome
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000408Reg_chr_condens
IPR009091RCC1/BLIP-II
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0005085guanyl-nucleotide exchange factor activity
GO:0031492nucleosomal DNA binding
Vocabulary: biological process
TermDefinition
GO:0007049cell cycle
GO:0007059chromosome segregation
GO:0007067mitotic nuclear division
GO:0043547positive regulation of GTPase activity
GO:0051225spindle assembly
GO:0051301cell division
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000408Regulator of chromosome condensation, RCC1PRINTSPR00633RCCNDNSATIONcoord: 108..124
score: 69.61
coord: 199..215
score: 37.25
coord: 319..337
score: 44.74
coord: 160..176
score: 63.73
coord: 376..397
score: 53.79
coord: 215..229
score: 65.56
coord: 56..72
score: 56.86
coord: 89..102
score: 50.0
IPR000408Regulator of chromosome condensation, RCC1PFAMPF00415RCC1coord: 380..429
e-value: 3.6E-10
score: 40.3
coord: 212..271
e-value: 3.4E-5
score: 24.4
coord: 105..154
e-value: 3.8E-12
score: 46.6
coord: 59..102
e-value: 2.6E-6
score: 27.9
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS50012RCC1_3coord: 213..275
score: 9.921
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS50012RCC1_3coord: 160..212
score: 12.474
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS50012RCC1_3coord: 106..159
score: 16.092
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS50012RCC1_3coord: 381..434
score: 13.941
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS50012RCC1_3coord: 330..380
score: 10.042
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS50012RCC1_3coord: 276..329
score: 10.424
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS50012RCC1_3coord: 55..105
score: 13.861
IPR009091Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein IIGENE3DG3DSA:2.130.10.30coord: 43..437
e-value: 1.2E-120
score: 404.7
IPR009091Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein IISUPERFAMILYSSF50985RCC1/BLIP-IIcoord: 57..432
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 568..628
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..30
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..25
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 595..609
NoneNo IPR availablePANTHERPTHR45982FAMILY NOT NAMEDcoord: 23..435
NoneNo IPR availablePANTHERPTHR45982:SF1REGULATOR OF CHROMOSOME CONDENSATIONcoord: 23..435