Small conductance calcium-activated potassium channel protein

Overview
NameSmall conductance calcium-activated potassium channel protein
Smed IDSMED30004698
Length (bp)2588
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Small conductance calcium-activated potassium channel protein (SMED30004698) t-SNE clustered cells

Violin plots show distribution of expression levels for Small conductance calcium-activated potassium channel protein (SMED30004698) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Small conductance calcium-activated potassium channel protein (SMED30004698) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Small conductance calcium-activated potassium channel protein (SMED30004698) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004698

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30004698SMESG000076156.1 dd_Smed_v4_14006_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30004698SMESG000076156.1 dd_Smed_v4_14006_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004698SMESG000076156.1 dd_Smed_v4_14006_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30004698SMESG000076156.1 dd_Smed_v4_14006_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30004698SMESG000076156.1 SMED30004698smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN3 (potassium calcium-activated channel subfamily N member 3 [Source:HGNC Symbol;Acc:HGNC:6292])

HSP 1 Score: 403.29 bits (1035), Expect = 3.664e-128
Identity = 224/460 (48.70%), Postives = 322/460 (70.00%), Query Frame = 1
Query: 1045 QTYLPNPNQ-----------KSTCYTRGSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
            QT L +PN             ST + + ++    R  +++GY+LG R+ L+EKR R+SD++L F +FGI+VMVI+TEL W G+Y K S++S+ LK   SL +I  + L+         LF  D+  +DWRIA+T++ +  + LE+L+C+IHPIPG +   ++F T +         R E+ ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++LWI+ +WT+R+CE   D     +N L  MWLI++TFLSIGYGD+VPHT CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK+TKL+K ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDL+K QN +Y+ +TE+      LE +I  +E  L +L     SLP ++ + +
Sbjct:  231 QTLLHHPNATHNHQHAGTTASSTTFPKANK----RKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEY---KFFWTARL-AFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTL 681          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN3 (potassium calcium-activated channel subfamily N member 3 [Source:HGNC Symbol;Acc:HGNC:6292])

HSP 1 Score: 399.823 bits (1026), Expect = 1.056e-126
Identity = 225/476 (47.27%), Postives = 325/476 (68.28%), Query Frame = 1
Query: 1045 QTYLPNPNQ-----------KSTCYTRGSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPKH-----------------ANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
            QT L +PN             ST + + ++    R  +++GY+LG R+ L+EKR R+SD++L F +FGI+VMVI+TEL W G+Y K S++S+ LK   SL +I  + L+         LF  D+  +DWRIA+T++ +  + LE+L+C+IHPIPG +   ++F T +         R E+ ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++LWI+ +WT+R+CE + +SP                   +N L  MWLI++TFLSIGYGD+VPHT CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK+TKL+K ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDL+K QN +Y+ +TE+      LE +I  +E  L +L     SLP ++ + +
Sbjct:  231 QTLLHHPNATHNHQHAGTTASSTTFPKANK----RKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEY---KFFWTARL-AFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCE-SPESPAQPSGSSLPAWYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTL 696          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN1 (potassium calcium-activated channel subfamily N member 1 [Source:HGNC Symbol;Acc:HGNC:6290])

HSP 1 Score: 390.578 bits (1002), Expect = 1.215e-125
Identity = 220/436 (50.46%), Postives = 308/436 (70.64%), Query Frame = 1
Query: 1093 GSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIH---GLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
              RQ AS    +VG+RLG R+ L+EKR R+SD++L F +FGI+VMV +TEL W G+Y K S+YS  LK   SL +   + L+ L  A    LF  D+  +DWRIA+T + V  + LEL +C+IHP+PG++  + +     F    SV    E+ ++ +L++PM LR Y++ R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++ WI+ +WT+R+CE   D  +  +N L  MWLI++TFLSIGYGD+VPHT CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK+T+LVK  + ++VR HQRKFL+AIH    LR +KI+Q K  D +NTL DLAKTQ  +Y+ V+E+   H  LE R++ +E  L  L   L++LP ++   I
Sbjct:   77 AGRQRASGKPSNVGHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESLYSFALKCLISLSTAILLGLVVLYHAREIQLFMVDNGADDWRIAMTCERVFLISLELAVCAIHPVPGHYRFT-WTARLAFTYAPSVA---EADVDVLLSIPMFLRLYLLGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQARVRKHQRKFLQAIHQAQKLRSVKIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEARLATLESRLDALGASLQALPGLIAQAI 507          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN1 (potassium calcium-activated channel subfamily N member 1 [Source:HGNC Symbol;Acc:HGNC:6290])

HSP 1 Score: 390.193 bits (1001), Expect = 1.920e-125
Identity = 220/436 (50.46%), Postives = 308/436 (70.64%), Query Frame = 1
Query: 1093 GSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHG---LRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
              RQ AS    +VG+RLG R+ L+EKR R+SD++L F +FGI+VMV +TEL W G+Y K S+YS  LK   SL +   + L+ L  A    LF  D+  +DWRIA+T + V  + LEL +C+IHP+PG++  + +     F    SV    E+ ++ +L++PM LR Y++ R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++ WI+ +WT+R+CE   D  +  +N L  MWLI++TFLSIGYGD+VPHT CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK+T+LVK  + ++VR HQRKFL+AIH    LR +KI+Q K  D +NTL DLAKTQ  +Y+ V+E+   H  LE R++ +E  L  L   L++LP ++   I
Sbjct:   77 AGRQRASGKPSNVGHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESLYSFALKCLISLSTAILLGLVVLYHAREIQLFMVDNGADDWRIAMTCERVFLISLELAVCAIHPVPGHYRFT-WTARLAFTYAPSVA---EADVDVLLSIPMFLRLYLLGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQARVRKHQRKFLQAIHQVQRLRSVKIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEARLATLESRLDALGASLQALPGLIAQAI 507          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN2 (potassium calcium-activated channel subfamily N member 2 [Source:HGNC Symbol;Acc:HGNC:6291])

HSP 1 Score: 389.808 bits (1000), Expect = 6.058e-125
Identity = 217/423 (51.30%), Postives = 307/423 (72.58%), Query Frame = 1
Query: 1123 KSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
            +++GY+LG R+ L+EKR R+SD++L F +FGI+VMVI+TEL W G Y K+S+YS+ LK   SL +I  + L+ +  A    LF  D+  +DWRIA+T++ +  + LE+L+C+IHPIPGN+  + +     F    S      + ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++LWI+ +WT+R CE   D     +N L  MWLI++TFLSIGYGD+VP+T CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK TKLVK ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDLAKTQN +Y+ ++++       E RI  +E  L  L   + +LP +++  I
Sbjct:  115 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GAYDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFT-WTARLAFSYAPSTT---TADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTI 532          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 315.849 bits (808), Expect = 1.207e-96
Identity = 186/418 (44.50%), Postives = 270/418 (64.59%), Query Frame = 1
Query: 1132 GYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCE---INTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEIL 2367
            G RL RR+ L+EKR  +SD +L+FAI GI++M+I+ EL  A + R  S  S LLK      + + +  +G        LF   +  +DW +A++++   Q+ LELLIC + P+P  F     F+  +F       D+    +   L++ M  R Y + R +LLHSR+F DA SRSI  +N+V+F+ RFILKTLMT+CPGT+L+ F   LWI+  W +R+CE   +  D     N +N +WL+A+TFLS+GYGDIVP TNCGR +AI  G++G+  ++++VAV ARKLEL++AEKHV  FM + Q+TK+LK+ AANVLRETW I+K+ KLV+  +  K+R HQRKFL AI+ +R+++ DQRK  +N  +L D+AKT +N YE V ++      L  RI+ IE  L ++  +L SL E+L
Sbjct:  201 GGRLIRREILHEKRRHVSDRALAFAIMGIILMIIENELRTAYVIRPGSSLSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAP--FMNDRFH------DKTLYAVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTYELVHDVHSTQEGLSLRITAIEHQLSDISRELSSLAELL 610          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 315.849 bits (808), Expect = 1.415e-96
Identity = 186/418 (44.50%), Postives = 270/418 (64.59%), Query Frame = 1
Query: 1132 GYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCE---INTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEIL 2367
            G RL RR+ L+EKR  +SD +L+FAI GI++M+I+ EL  A + R  S  S LLK      + + +  +G        LF   +  +DW +A++++   Q+ LELLIC + P+P  F     F+  +F       D+    +   L++ M  R Y + R +LLHSR+F DA SRSI  +N+V+F+ RFILKTLMT+CPGT+L+ F   LWI+  W +R+CE   +  D     N +N +WL+A+TFLS+GYGDIVP TNCGR +AI  G++G+  ++++VAV ARKLEL++AEKHV  FM + Q+TK+LK+ AANVLRETW I+K+ KLV+  +  K+R HQRKFL AI+ +R+++ DQRK  +N  +L D+AKT +N YE V ++      L  RI+ IE  L ++  +L SL E+L
Sbjct:  208 GGRLIRREILHEKRRHVSDRALAFAIMGIILMIIENELRTAYVIRPGSSLSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAP--FMNDRFH------DKTLYAVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTYELVHDVHSTQEGLSLRITAIEHQLSDISRELSSLAELL 617          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 315.849 bits (808), Expect = 1.835e-96
Identity = 186/418 (44.50%), Postives = 270/418 (64.59%), Query Frame = 1
Query: 1132 GYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCE---INTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEIL 2367
            G RL RR+ L+EKR  +SD +L+FAI GI++M+I+ EL  A + R  S  S LLK      + + +  +G        LF   +  +DW +A++++   Q+ LELLIC + P+P  F     F+  +F       D+    +   L++ M  R Y + R +LLHSR+F DA SRSI  +N+V+F+ RFILKTLMT+CPGT+L+ F   LWI+  W +R+CE   +  D     N +N +WL+A+TFLS+GYGDIVP TNCGR +AI  G++G+  ++++VAV ARKLEL++AEKHV  FM + Q+TK+LK+ AANVLRETW I+K+ KLV+  +  K+R HQRKFL AI+ +R+++ DQRK  +N  +L D+AKT +N YE V ++      L  RI+ IE  L ++  +L SL E+L
Sbjct:  208 GGRLIRREILHEKRRHVSDRALAFAIMGIILMIIENELRTAYVIRPGSSLSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAP--FMNDRFH------DKTLYAVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTYELVHDVHSTQEGLSLRITAIEHQLSDISRELSSLAELL 617          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 315.849 bits (808), Expect = 2.546e-96
Identity = 186/418 (44.50%), Postives = 270/418 (64.59%), Query Frame = 1
Query: 1132 GYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCE---INTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEIL 2367
            G RL RR+ L+EKR  +SD +L+FAI GI++M+I+ EL  A + R  S  S LLK      + + +  +G        LF   +  +DW +A++++   Q+ LELLIC + P+P  F     F+  +F       D+    +   L++ M  R Y + R +LLHSR+F DA SRSI  +N+V+F+ RFILKTLMT+CPGT+L+ F   LWI+  W +R+CE   +  D     N +N +WL+A+TFLS+GYGDIVP TNCGR +AI  G++G+  ++++VAV ARKLEL++AEKHV  FM + Q+TK+LK+ AANVLRETW I+K+ KLV+  +  K+R HQRKFL AI+ +R+++ DQRK  +N  +L D+AKT +N YE V ++      L  RI+ IE  L ++  +L SL E+L
Sbjct:  208 GGRLIRREILHEKRRHVSDRALAFAIMGIILMIIENELRTAYVIRPGSSLSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAP--FMNDRFH------DKTLYAVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTYELVHDVHSTQEGLSLRITAIEHQLSDISRELSSLAELL 617          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 315.464 bits (807), Expect = 3.414e-96
Identity = 189/418 (45.22%), Postives = 271/418 (64.83%), Query Frame = 1
Query: 1132 GYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCE---INTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEIL 2367
            G RL RR+ L+EKR  +SD +L+FAI GI++M+I+ EL  A + R  S  S LLK  I  +T  LL  +         LF   +  +DW +A++++   Q+ LELLIC + P+P  F     F+  +F       D+    +   L++ M  R Y + R +LLHSR+F DA SRSI  +N+V+F+ RFILKTLMT+CPGT+L+ F   LWI+  W +R+CE   +  D     N +N +WL+A+TFLS+GYGDIVP TNCGR +AI  G++G+  ++++VAV ARKLEL++AEKHV  FM + Q+TK+LK+ AANVLRETW I+K+ KLV+  +  K+R HQRKFL AI+ +R+++ DQRK  +N  +L D+AKT +N YE V ++      L  RI+ IE  L ++  +L SL E+L
Sbjct:  228 GGRLIRREILHEKRRHVSDRALAFAIMGIILMIIENELRTAYVIRPGSSLSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAP--FMNDRFH------DKTLYAVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTYELVHDVHSTQEGLSLRITAIEHQLSDISRELSSLAELL 637          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0300467)

HSP 1 Score: 435.647 bits (1119), Expect = 1.301e-143
Identity = 240/438 (54.79%), Postives = 327/438 (74.66%), Query Frame = 1
Query: 1096 SRQIASRSMK---SVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXXXXXXXXXXX-----XXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYF-VTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIIT 2382
            SR+ ++ S K   +VGYRLG+RK L+EKR RISD++L   +FGI+VMVI+ EL  AG+Y K+S YS  LK+LIS+ST+I     +    L     LF  D+C +DWRIA+TWQ ++Q+ LEL IC+IHPIPG +    YF  T K               +  L++PM LR Y+I R +LLHS++F DA SRSIGA+N+++F+TRF+LKTLMT+CPGTVLL F+++LWI+ SWT+R CE   D  +HAN+LN MWLIA+TFLS+G+GDIVP+T CGRGIA+S G+MG+ CTALLVAV +RKLEL++AEKHV  FM++ Q+TK+LK  AANVLRETWLIYK+T+LVK VN  +VRTHQRKFL AI+ LRK+K+DQRK  DN+NT+ D+AKTQN +YE +++M      +E R++ +ED + ++ + ++SLP++L+  +T
Sbjct:   49 SRKPSTNSAKHKPNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYTKASFYSTALKTLISVSTVILLGLIVAYHALEVQVRLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEY----YFQWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDE-EHANLLNAMWLIAITFLSVGFGDIVPNTYCGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLSRCLT 481          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0344555)

HSP 1 Score: 438.728 bits (1127), Expect = 3.724e-142
Identity = 240/441 (54.42%), Postives = 334/441 (75.74%), Query Frame = 1
Query: 1096 SRQIASRSMK---SVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXXXXXXXXXXX-----XXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDR-LESMIEP---ILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIIT 2382
            SR+ ++ S K   +VGYRLG+RK L+EKR RISD++L   +FGI+VMVI+ EL  AG+Y K+S YS  LK+LIS+ST+I     +    L     LF  D+C +DWRIA+TWQ ++Q+ LEL IC+IHPIPG +    YF   ++   L+  ++ + + + P    L++PM LR Y+I R +LLHS++F DA SRSIGA+N+++F+TRF+LKTLMT+CPGTVLL F+++LWI+ SWT+R CE   D  +HAN+LN MWLIA+TFLS+G+GDIVP+T CGRGIA+S G+MG+ CTALLVAV +RKLEL++AEKHV  FM++ Q+TK+LK  AANVLRETWLIYK+T+LVK VN  +VRTHQRKFL AI+ LRK+K+DQRK  DN+NT+ D+AKTQN +YE +++M      +E R++ +ED + ++ + ++SLP++L+  +T
Sbjct:   49 SRKPSTNSAKHKPNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYTKASFYSTALKTLISVSTVILLGLIVAYHALEVQVRLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEY----YF---QWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDE-EHANLLNAMWLIAITFLSVGFGDIVPNTYCGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLSRCLT 481          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0301953)

HSP 1 Score: 440.269 bits (1131), Expect = 2.141e-140
Identity = 260/569 (45.69%), Postives = 372/569 (65.38%), Query Frame = 1
Query:  739 HHLSHNV-------ITQSRNMGIDEIGLDYMRANGAIPVYCLGFKQLHQPMSN----GNEQKSSVASLINIFTKNPXXXXXXXXXXXXXCNYLQSNMEXXXXXXXXXXXXXTPQTYLPNPNQKSTCYTRGSRQIASRSMK---SVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDR-LESMIEP---ILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIIT 2382
            H  SH V       + +S   GI  I  D +R NG +      FKQL +P S     G+ +  S+A+   I +                CN      E+ +      S     + Y+    +++      SR+ ++ S K   +VGYRLG+RK L+EKR RISD++L   +FGI+VMVI+ EL  AG+Y K+S        L S+ ++  + L+    A    LF  D+C +DWRIA+TWQ ++Q+ LEL IC+IHPIPG +    YF   ++   L+  ++ + + + P    L++PM LR Y+I R +LLHS++F DA SRSIGA+N+++F+TRF+LKTLMT+CPGTVLL F+++LWI+ SWT+R CE   D  +HAN+LN MWLIA+TFLS+G+GDIVP+T CGRGIA+S G+MG+ CTALLVAV +RKLEL++AEKHV  FM++ Q+TK+LK  AANVLRETWLIYK+T+LVK VN  +VRTHQRKFL AI+ LRK+K+DQRK  DN+NT+ D+AKTQN +YE +++M      +E R++ +ED + ++ + ++SLP++L+  +T
Sbjct:  351 HSHSHTVPNVSLKQLRESSGDGIAGIAADSLRINGGM----RPFKQLRKPASTLSIPGSMKTPSIANREQISSG---------------CNE-----EAAEALVGIHSDYPRYEMYM---EERALTGGNTSRKPSTNSAKHKPNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYTKASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEY----YF---QWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDE-EHANLLNAMWLIAITFLSVGFGDIVPNTYCGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLSRCLT 884          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0301949)

HSP 1 Score: 427.172 bits (1097), Expect = 2.510e-140
Identity = 238/436 (54.59%), Postives = 325/436 (74.54%), Query Frame = 1
Query: 1096 SRQIASRSMK---SVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYF-VTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIIT 2382
            SR+ ++ S K   +VGYRLG+RK L+EKR RISD++L   +FGI+VMVI+ EL  AG+Y K+S YS  LK+LIS+ST+ILL       A    LF  D+C +DWRIA+TWQ ++Q+ LEL IC+IHPIPG +    YF  T K               +  L++PM LR Y+I R +LLHS++F DA SRSIGA+N+++F+TRF+LKTLMT+CPGTVLL F+++LWI+ SWT+R CE   D  +HAN+LN MWL A+TFL +GYGDIVP+T CGRGI ++ G++G+ CTALLVAV +RKLEL++AEKHV  FM++ Q+TK+LK  AANVLRETWLIYK+T+LVK VN  +VRTHQRKFL AI+ LRK+K+DQRK  DN+NT+ D+AKTQN +YE +++M      +E R++ +ED + ++ + ++SLP++L+  +T
Sbjct:   49 SRKPSTNSAKHKPNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYTKASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEY----YFQWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDE-EHANLLNSMWLTAITFLCVGYGDIVPNTYCGRGITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLSRCLT 479          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0331604)

HSP 1 Score: 439.499 bits (1129), Expect = 5.112e-140
Identity = 240/441 (54.42%), Postives = 334/441 (75.74%), Query Frame = 1
Query: 1096 SRQIASRSMK---SVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXXXXXXXXXXX-----XXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDR-LESMIEP---ILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIIT 2382
            SR+ ++ S K   +VGYRLG+RK L+EKR RISD++L   +FGI+VMVI+ EL  AG+Y K+S YS  LK+LIS+ST+I     +    L     LF  D+C +DWRIA+TWQ ++Q+ LEL IC+IHPIPG +    YF   ++   L+  ++ + + + P    L++PM LR Y+I R +LLHS++F DA SRSIGA+N+++F+TRF+LKTLMT+CPGTVLL F+++LWI+ SWT+R CE   D  +HAN+LN MWLIA+TFLS+G+GDIVP+T CGRGIA+S G+MG+ CTALLVAV +RKLEL++AEKHV  FM++ Q+TK+LK  AANVLRETWLIYK+T+LVK VN  +VRTHQRKFL AI+ LRK+K+DQRK  DN+NT+ D+AKTQN +YE +++M      +E R++ +ED + ++ + ++SLP++L+  +T
Sbjct:  451 SRKPSTNSAKHKPNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYTKASFYSTALKTLISVSTVILLGLIVAYHALEVQVRLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEY----YF---QWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDE-EHANLLNAMWLIAITFLSVGFGDIVPNTYCGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLSRCLT 883          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn1a (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1a [Source:ZFIN;Acc:ZDB-GENE-070912-703])

HSP 1 Score: 407.527 bits (1046), Expect = 1.997e-132
Identity = 226/446 (50.67%), Postives = 320/446 (71.75%), Query Frame = 1
Query: 1060 NPNQKST-CYTRGSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIIT 2382
            +P++ S     R S     +  K +GY+LG R+ L+EKR R+SD++L F +FGI+VMV +TEL W G+Y K S YS  LK   SL ++  + L+ +  A    LF  D+  +DWRIA+T++ +  ++LELL+C+IHPIPG + +  +     F  V SV D   + ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++ WI+ +WT+R+CE   D  +  +N L  MWLI++TFLSIGYGD+VPHT CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+ K++K  AANVLRETWLIYK+TKLVK ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDLAKTQN +Y+ V+E++     L+ RI  +ED L  +   L++LP +++  IT
Sbjct:   53 DPSKASNESLVRESGNAPQKKNKDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTVILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFIVLELLVCAIHPIPGQY-VFTWTARLAFTYVPSVAD---ADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELDKRIGTLEDKLDAVTGSLQALPCLISQAIT 493          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn1b (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1b [Source:ZFIN;Acc:ZDB-GENE-060503-397])

HSP 1 Score: 400.593 bits (1028), Expect = 1.011e-129
Identity = 224/423 (52.96%), Postives = 313/423 (74.00%), Query Frame = 1
Query: 1123 KSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
            K +GY+LG R+ L+EKR R+SD++L F +FGI+VMV +TEL W G+Y K S YS  LK LIS+ST+ILL    +  A    LF  D+  +DWRIA+T++ +  ++LELL+C+IHPIPG + +  +     F    SV D   + ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++ WI+ +WT+ +CE   D  +  +N L  MWLI++TFLSIGYGD+VP+T CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+ K++K  AANVLRETWLIYK+TKLVK ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDLAKTQN +Y+ V+E++     LE RI  +E  L +++  L++LP +L+  I
Sbjct:   76 KDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTVILLCLIIMYHAREIQLFMVDNGADDWRIAMTYERILFIVLELLVCAIHPIPGQY-VFTWTARLAFTYTPSVAD---ADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVHVCERYHDKVEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELEKRIGHLETKLDSINSSLQALPGLLSQAI 493          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn1b (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1b [Source:ZFIN;Acc:ZDB-GENE-060503-397])

HSP 1 Score: 395.971 bits (1016), Expect = 8.321e-128
Identity = 224/426 (52.58%), Postives = 313/426 (73.47%), Query Frame = 1
Query: 1123 KSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIH---GLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
            K +GY+LG R+ L+EKR R+SD++L F +FGI+VMV +TEL W G+Y K S YS  LK LIS+ST+ILL    +  A    LF  D+  +DWRIA+T++ +  ++LELL+C+IHPIPG + +  +     F    SV D   + ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++ WI+ +WT+ +CE   D  +  +N L  MWLI++TFLSIGYGD+VP+T CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+ K++K  AANVLRETWLIYK+TKLVK ++ +KVR HQRKFL+AIH    LR +K++QRK  D +NTLVDLAKTQN +Y+ V+E++     LE RI  +E  L +++  L++LP +L+  I
Sbjct:   76 KDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTVILLCLIIMYHAREIQLFMVDNGADDWRIAMTYERILFIVLELLVCAIHPIPGQY-VFTWTARLAFTYTPSVAD---ADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVHVCERYHDKVEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQAQKLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELEKRIGHLETKLDSINSSLQALPGLLSQAI 496          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn1a (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1a [Source:ZFIN;Acc:ZDB-GENE-070912-703])

HSP 1 Score: 406.757 bits (1044), Expect = 1.166e-127
Identity = 224/435 (51.49%), Postives = 315/435 (72.41%), Query Frame = 1
Query: 1090 RGSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIIT 2382
            R S     +  K +GY+LG R+ L+EKR R+SD++L F +FGI+VMV +TEL W G+Y K S YS  LK   SL ++  + L+ +  A    LF  D+  +DWRIA+T++ +  ++LELL+C+IHPIPG + +  +     F  V SV D   + ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++ WI+ +WT+R+CE   D  +  +N L  MWLI++TFLSIGYGD+VPHT CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+ K++K  AANVLRETWLIYK+TKLVK ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDLAKTQN +Y+ V+E++     L+ RI  +ED L  +   L++LP +++  IT
Sbjct:  442 RESGNAPQKKNKDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTVILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFIVLELLVCAIHPIPGQY-VFTWTARLAFTYVPSVAD---ADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELDKRIGTLEDKLDAVTGSLQALPCLISQAIT 871          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn2 (potassium calcium-activated channel subfamily N member 2 [Source:ZFIN;Acc:ZDB-GENE-091116-41])

HSP 1 Score: 382.874 bits (982), Expect = 1.021e-122
Identity = 215/424 (50.71%), Postives = 312/424 (73.58%), Query Frame = 1
Query: 1123 KSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIIT 2382
            +++G +LG R+ L+EKR R+SD++L F +FGI+VMVI+TEL W G Y K S+YS+ LK   SL +I  + L+ +  A    LF  D+  +DWRIA+T++ +  + LE+L+C+IHPIPGN+  + +     F    S  D   + ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++LWI+ +WT+R CE   D+    +N L  MWLI++TFL+IGYGD+VP+T CG+G+ +  G+MG+ CTAL+VAV A+KLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK TKLV+ ++ +KVR HQRKFL+AIH LR +K++QRK  D +N+LVDLAKTQN +Y+ V+++      +E RI+ +E  L  L   L++LP +++ +I+
Sbjct:  101 QNIGQKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GAYGKESLYSLALKCLISLSTIILLGLIIIYHAREIQLFMVDNAADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFT-WTARLAFSYAPSKTD---ADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFTISLWIIAAWTVRACERYHDNMDVTSNFLGAMWLISITFLTIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVAKKLELTKAEKHVHNFMMDTQLTKRVKNTAANVLRETWLIYKNTKLVRKMDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANSLVDLAKTQNVMYDLVSDLNERGEDMEKRIALLETKLETLLSNLQALPGLISQVIS 519          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: wdr17 (WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-1000178])

HSP 1 Score: 396.356 bits (1017), Expect = 3.338e-128
Identity = 231/476 (48.53%), Postives = 330/476 (69.33%), Query Frame = 1
Query: 1060 NPNQKSTCYTRG---SRQIASRSMK---SVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIITLKLNTPGSPRS*LVPIRHFPSIKSH 2457
            +P++ S    RG     Q A R  K   +VGY+LG R+ L+EKR R+SD++L F +FGI+VMV +TEL W G+Y K S YS  LK   SL +   + L+ +  A    LF  D+  +DWRIA+T++ +  + LEL +C+IHPIPG ++ + +     F    SV +   + I+ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++ WI+ +WT+R+CE   D  +  +N L  MWLI++TFLSIGYGD+VP+T CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q++K++K  AANVLRETWLIYK+TKLV+ ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDLAKTQN +Y+ ++E++  +  LE RI  +E  + +L+  L+SLP ++ + +  +   P  PR      R  PS   H
Sbjct:   50 DPSKASHRSLRGVEEGSQEAPRGQKKNQNVGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTAILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFITLELTVCAIHPIPGQYSFT-WTARLAFFYTTSVAN---ADIDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLSKRVKNAAANVLRETWLIYKHTKLVRKIDHAKVRKHQRKFLQAIHLLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLMSELQERNEDLEKRIITLETKIDSLNTSLQSLPGLIAHALLREQGDP--PRR-----RTSPSTAPH 513          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: wdr17 (WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-1000178])

HSP 1 Score: 395.201 bits (1014), Expect = 1.215e-127
Identity = 224/450 (49.78%), Postives = 322/450 (71.56%), Query Frame = 1
Query: 1060 NPNQKSTCYTRG---SRQIASRSMK---SVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
            +P++ S    RG     Q A R  K   +VGY+LG R+ L+EKR R+SD++L F +FGI+VMV +TEL W G+Y K S YS  LK   SL +   + L+ +  A    LF  D+  +DWRIA+T++ +  + LEL +C+IHPIPG ++ + +     F    SV +   + I+ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++ WI+ +WT+R+CE   D  +  +N L  MWLI++TFLSIGYGD+VP+T CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q++K++K  AANVLRETWLIYK+TKLV+ ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDLAKTQN +Y+ ++E++  +  LE RI  +E  + +L+  L+SLP ++ + +
Sbjct:   42 DPSKASHRSLRGVEEGSQEAPRGQKKNQNVGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTAILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFITLELTVCAIHPIPGQYSFT-WTARLAFFYTTSVAN---ADIDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLSKRVKNAAANVLRETWLIYKHTKLVRKIDHAKVRKHQRKFLQAIHLLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLMSELQERNEDLEKRIITLETKIDSLNTSLQSLPGLIAHAL 486          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: wdr17 (WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-1000178])

HSP 1 Score: 394.815 bits (1013), Expect = 2.013e-127
Identity = 224/450 (49.78%), Postives = 322/450 (71.56%), Query Frame = 1
Query: 1060 NPNQKSTCYTRG---SRQIASRSMK---SVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
            +P++ S    RG     Q A R  K   +VGY+LG R+ L+EKR R+SD++L F +FGI+VMV +TEL W G+Y K S YS  LK   SL +   + L+ +  A    LF  D+  +DWRIA+T++ +  + LEL +C+IHPIPG ++ + +     F    SV +   + I+ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++ WI+ +WT+R+CE   D  +  +N L  MWLI++TFLSIGYGD+VP+T CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q++K++K  AANVLRETWLIYK+TKLV+ ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDLAKTQN +Y+ ++E++  +  LE RI  +E  + +L+  L+SLP ++ + +
Sbjct:   50 DPSKASHRSLRGVEEGSQEAPRGQKKNQNVGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTAILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFITLELTVCAIHPIPGQYSFT-WTARLAFFYTTSVAN---ADIDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLSKRVKNAAANVLRETWLIYKHTKLVRKIDHAKVRKHQRKFLQAIHLLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLMSELQERNEDLEKRIITLETKIDSLNTSLQSLPGLIAHAL 494          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: wdr17 (WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-1000178])

HSP 1 Score: 394.815 bits (1013), Expect = 6.256e-127
Identity = 224/450 (49.78%), Postives = 322/450 (71.56%), Query Frame = 1
Query: 1060 NPNQKSTCYTRG---SRQIASRSMK---SVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
            +P++ S    RG     Q A R  K   +VGY+LG R+ L+EKR R+SD++L F +FGI+VMV +TEL W G+Y K S YS  LK   SL +   + L+ +  A    LF  D+  +DWRIA+T++ +  + LEL +C+IHPIPG ++ + +     F    SV +   + I+ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++ WI+ +WT+R+CE   D  +  +N L  MWLI++TFLSIGYGD+VP+T CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q++K++K  AANVLRETWLIYK+TKLV+ ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDLAKTQN +Y+ ++E++  +  LE RI  +E  + +L+  L+SLP ++ + +
Sbjct:   87 DPSKASHRSLRGVEEGSQEAPRGQKKNQNVGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTAILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFITLELTVCAIHPIPGQYSFT-WTARLAFFYTTSVAN---ADIDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLSKRVKNAAANVLRETWLIYKHTKLVRKIDHAKVRKHQRKFLQAIHLLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLMSELQERNEDLEKRIITLETKIDSLNTSLQSLPGLIAHAL 531          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: KCNN2 (potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 2 [Source:NCBI gene;Acc:100145581])

HSP 1 Score: 389.423 bits (999), Expect = 9.025e-124
Identity = 217/429 (50.58%), Postives = 309/429 (72.03%), Query Frame = 1
Query: 1123 KSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNIS-----QYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIIT 2382
            +++GY+LG R+ L+EKR R+SD++L F +FGI+VMVI+TEL W G Y K S+YS+ LK   SL +I  + L+ +  A    LF  D+  +DWRIA+T++ +  + LE+L+C+IHPIPGN+  +      +  TP      + D      ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++LWI+ +WT+R CE   D     +N L  MWLI++TFLSIGYGD+VP+T CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK TKLVK ++ ++VR HQRKFL+AIH LR +K++QRK  D +NTLVDLAKTQN +Y+ ++++       E RI  +E  L  L   +++LP +++  I+
Sbjct:  197 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GAYDKGSLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYTP---STTTAD------VDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHARVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVVLETKLETLIGSIQALPGLISQTIS 615          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn3 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3 [Source:MGI Symbol;Acc:MGI:2153183])

HSP 1 Score: 403.675 bits (1036), Expect = 1.711e-128
Identity = 224/456 (49.12%), Postives = 320/456 (70.18%), Query Frame = 1
Query: 1045 QTYLPNPN----QKSTCYTRGSRQIAS---RSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
            QT L +PN     +    T GS        R  +++GY+LG R+ L+EKR R+SD++L F +FGI+VMVI+TEL W G+Y K S++S+ LK   SL ++  + L+         LF  D+  +DWRIA+T++ +  + LE+L+C+IHPIPG +   ++F T +         R E+ ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++LWI+ +WT+R+CE   D     +N L  MWLI++TFLSIGYGD+VPHT CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK+TKL+K ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDL+K QN +Y+ +TE+      LE +I  +E  L +L     SLP ++ + +
Sbjct:  232 QTLLHHPNATHNHQHAGTTAGSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GLYSKDSMFSLALKCLISLSTVILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEY---KFFWTARL-AFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRGVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTL 682          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn1 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1 [Source:MGI Symbol;Acc:MGI:1933993])

HSP 1 Score: 390.193 bits (1001), Expect = 8.320e-126
Identity = 220/422 (52.13%), Postives = 310/422 (73.46%), Query Frame = 1
Query: 1126 SVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
            +V +RLG R+ L+EKR R+SD++L F +FGI+VMV +TEL W G+Y K S+ S  LK LIS+ST+ILLGL++   A    LF  D+  +DWRIA+TW+ V+ + LEL++C+IHP+PG++   ++  T +    L V    E+ ++ +L++PM LR Y++ R +LLHSR+F DA SRSIGA+N+V+F+TRF+ KTLMT+CPGTVLL F ++ WI+ +WT+R+CE   D  +  +N L  MWLI++TFLSIGYGD+VPHT CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK+T+LVK  +  +VR HQRKFL+AIH LR +KI+Q K  D +NTL +LAK Q+  YE V+E++     LE R++ +E  L  L   L++LP ++   I
Sbjct:   86 TVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAMTWERVSLISLELVVCAIHPVPGHY---RFTWTARLAFSL-VPSAAEADLDVLLSIPMFLRLYLLARVMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSVSSWIVAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQGRVRKHQRKFLQAIHQLRSVKIEQGKVNDQANTLAELAKAQSIAYEVVSELQAQQEELEARLAALESRLDVLGASLQALPGLIAQAI 502          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn1 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1 [Source:MGI Symbol;Acc:MGI:1933993])

HSP 1 Score: 390.193 bits (1001), Expect = 8.320e-126
Identity = 220/422 (52.13%), Postives = 310/422 (73.46%), Query Frame = 1
Query: 1126 SVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
            +V +RLG R+ L+EKR R+SD++L F +FGI+VMV +TEL W G+Y K S+ S  LK LIS+ST+ILLGL++   A    LF  D+  +DWRIA+TW+ V+ + LEL++C+IHP+PG++   ++  T +    L V    E+ ++ +L++PM LR Y++ R +LLHSR+F DA SRSIGA+N+V+F+TRF+ KTLMT+CPGTVLL F ++ WI+ +WT+R+CE   D  +  +N L  MWLI++TFLSIGYGD+VPHT CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK+T+LVK  +  +VR HQRKFL+AIH LR +KI+Q K  D +NTL +LAK Q+  YE V+E++     LE R++ +E  L  L   L++LP ++   I
Sbjct:   86 TVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAMTWERVSLISLELVVCAIHPVPGHY---RFTWTARLAFSL-VPSAAEADLDVLLSIPMFLRLYLLARVMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSVSSWIVAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQGRVRKHQRKFLQAIHQLRSVKIEQGKVNDQANTLAELAKAQSIAYEVVSELQAQQEELEARLAALESRLDVLGASLQALPGLIAQAI 502          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn2 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 [Source:MGI Symbol;Acc:MGI:2153182])

HSP 1 Score: 389.808 bits (1000), Expect = 3.773e-125
Identity = 217/423 (51.30%), Postives = 307/423 (72.58%), Query Frame = 1
Query: 1123 KSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
            +++GY+LG R+ L+EKR R+SD++L F +FGI+VMVI+TEL W G Y K+S+YS+ LK   SL +I  + L+ +  A    LF  D+  +DWRIA+T++ +  + LE+L+C+IHPIPGN+  + +     F    S      + ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++LWI+ +WT+R CE   D     +N L  MWLI++TFLSIGYGD+VP+T CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK TKLVK ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDLAKTQN +Y+ ++++       E RI  +E  L  L   + +LP +++  I
Sbjct:  110 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GAYDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFT-WTARLAFSYAPSTT---TADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTI 527          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn2 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 [Source:MGI Symbol;Acc:MGI:2153182])

HSP 1 Score: 389.808 bits (1000), Expect = 3.773e-125
Identity = 217/423 (51.30%), Postives = 307/423 (72.58%), Query Frame = 1
Query: 1123 KSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
            +++GY+LG R+ L+EKR R+SD++L F +FGI+VMVI+TEL W G Y K+S+YS+ LK   SL +I  + L+ +  A    LF  D+  +DWRIA+T++ +  + LE+L+C+IHPIPGN+  + +     F    S      + ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++LWI+ +WT+R CE   D     +N L  MWLI++TFLSIGYGD+VP+T CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK TKLVK ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDLAKTQN +Y+ ++++       E RI  +E  L  L   + +LP +++  I
Sbjct:  110 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GAYDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFT-WTARLAFSYAPSTT---TADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTI 527          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|Q7KVW5|KCNN_DROME (Small conductance calcium-activated potassium channel protein OS=Drosophila melanogaster OX=7227 GN=SK PE=2 SV=2)

HSP 1 Score: 431.409 bits (1108), Expect = 6.420e-136
Identity = 229/439 (52.16%), Postives = 325/439 (74.03%), Query Frame = 1
Query: 1096 SRQIASRSMK---SVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDR-LESMIEP---ILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIIT 2382
            SR+ ++ S K   +VGYRLG+RK L+EKR RISD++L   +FGI+VMVI+ EL  AG+Y K+S        L S+ ++  + L+    A    LF  D+C +DWRIA+TWQ ++Q+ LEL IC+IHPIPG +    YF   ++   L+  ++ + + + P    L++PM LR Y+I R +LLHS++F DA SRSIGA+N+++F+TRF+LKTLMT+CPGTVLL F+++LWI+ SWT+R CE   D  +HAN+LN MWL A+TFL +GYGDIVP+T CGRGI ++ G++G+ CTALLVAV +RKLEL++AEKHV  FM++ Q+TK+LK  AANVLRETWLIYK+T+LVK VN  +VRTHQRKFL AI+ LRK+K+DQRK  DN+NT+ D+AKTQN +YE +++M      +E R++ +ED + ++ + ++SLP++L+  +T
Sbjct:  454 SRKPSTNSAKHKPNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYTKASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEY----YF---QWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDE-EHANLLNSMWLTAITFLCVGYGDIVPNTYCGRGITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLSRCLT 884          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|P58391|KCNN3_MOUSE (Small conductance calcium-activated potassium channel protein 3 OS=Mus musculus OX=10090 GN=Kcnn3 PE=1 SV=2)

HSP 1 Score: 403.675 bits (1036), Expect = 1.197e-127
Identity = 224/456 (49.12%), Postives = 320/456 (70.18%), Query Frame = 1
Query: 1045 QTYLPNPN----QKSTCYTRGSRQIAS---RSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
            QT L +PN     +    T GS        R  +++GY+LG R+ L+EKR R+SD++L F +FGI+VMVI+TEL W G+Y K S++S+ LK   SL ++  + L+         LF  D+  +DWRIA+T++ +  + LE+L+C+IHPIPG +   ++F T +         R E+ ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++LWI+ +WT+R+CE   D     +N L  MWLI++TFLSIGYGD+VPHT CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK+TKL+K ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDL+K QN +Y+ +TE+      LE +I  +E  L +L     SLP ++ + +
Sbjct:  232 QTLLHHPNATHNHQHAGTTAGSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GLYSKDSMFSLALKCLISLSTVILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEY---KFFWTARL-AFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRGVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTL 682          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|Q9UGI6|KCNN3_HUMAN (Small conductance calcium-activated potassium channel protein 3 OS=Homo sapiens OX=9606 GN=KCNN3 PE=1 SV=2)

HSP 1 Score: 403.29 bits (1035), Expect = 1.760e-127
Identity = 224/460 (48.70%), Postives = 322/460 (70.00%), Query Frame = 1
Query: 1045 QTYLPNPNQ-----------KSTCYTRGSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
            QT L +PN             ST + + ++    R  +++GY+LG R+ L+EKR R+SD++L F +FGI+VMVI+TEL W G+Y K S++S+ LK   SL +I  + L+         LF  D+  +DWRIA+T++ +  + LE+L+C+IHPIPG +   ++F T +         R E+ ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++LWI+ +WT+R+CE   D     +N L  MWLI++TFLSIGYGD+VPHT CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK+TKL+K ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDL+K QN +Y+ +TE+      LE +I  +E  L +L     SLP ++ + +
Sbjct:  231 QTLLHHPNATHNHQHAGTTASSTTFPKANK----RKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEY---KFFWTARL-AFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTL 681          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|P70605|KCNN3_RAT (Small conductance calcium-activated potassium channel protein 3 OS=Rattus norvegicus OX=10116 GN=Kcnn3 PE=2 SV=3)

HSP 1 Score: 403.29 bits (1035), Expect = 1.907e-127
Identity = 225/456 (49.34%), Postives = 320/456 (70.18%), Query Frame = 1
Query: 1045 QTYLPNPN----QKSTCYTRGSRQIAS---RSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
            QT L +PN     +    T GS        R  +++GY+LG R+ L+EKR R+SD++L F +FGI+VMVI+TEL W G+Y K S++S+ LK   SL +I  + L+         LF  D+  +DWRIA+T++ +  + LE+L+C+IHPIPG +   ++F T +         R E+ ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++LWI+ +WT+R+CE   D     +N L  MWLI++TFLSIGYGD+VPHT CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK+TKL+K ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDL+K QN +Y+ +TE+      LE +I  +E  L +L     SLP ++ + +
Sbjct:  232 QTLLHHPNATHNHQHAGTTAGSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEY---KFFWTARL-AFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRGVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTL 682          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|P58392|KCNN3_PIG (Small conductance calcium-activated potassium channel protein 3 OS=Sus scrofa OX=9823 GN=KCNN3 PE=2 SV=1)

HSP 1 Score: 402.905 bits (1034), Expect = 2.016e-127
Identity = 224/460 (48.70%), Postives = 322/460 (70.00%), Query Frame = 1
Query: 1045 QTYLPNPNQ-----------KSTCYTRGSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
            QT L +PN             ST + + ++    R  +++GY+LG R+ L+EKR R+SD++L F +FGI+VMVI+TEL W G+Y K S++S+ LK   SL +I  + L+         LF  D+  +DWRIA+T++ +  + LE+L+C+IHPIPG +   ++F T +         R E+ ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++LWI+ +WT+R+CE   D     +N L  MWLI++TFLSIGYGD+VPHT CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK+TKL+K ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDL+K QN +Y+ +TE+      LE +I  +E  L +L     SLP ++ + +
Sbjct:  224 QTLLHHPNATHNHQHAGTTASSTTFPKANK----RKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEY---KFFWTARL-AFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTL 674          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: R7TXT1 (CaMBD domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_155299 PE=4 SV=1)

HSP 1 Score: 457.218 bits (1175), Expect = 9.425e-149
Identity = 247/431 (57.31%), Postives = 331/431 (76.80%), Query Frame = 1
Query: 1096 SRQIASR--SMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRK---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTN 2373
            +++IAS+  S  +VGYRLGRRK L+EKR RISD++L F +FGI+VMV++TEL  A +Y K    SI    L S+ +I  + L+    A    LF+ D+C+EDWRIA++ Q VAQ+L+EL +C+IHPIPG+F+ +  + T    GV +V  R  + ++ +L++PM LR Y+I R +LLHS++F DA SRSIGA+N+++F+TRF+LKTLMT+CPGTVLL F+L+LWI+ SW +R CE   D  KH N+LN MW+I++TFLSIGYGDIVP+T CGRG+A++ GVMG+  TAL+VAV ARKLEL++AEKHV  FM++ Q+TK+LK  AANVLRETWLIYKYTKLV+ VNASKVRTHQRKFL AIH LRK+K+DQRK  DN+NTLVD+AKTQ N+YE V EM    + +++R+  IE+NL  L +QL +LP I+ +
Sbjct:   35 AKEIASKTPSKPNVGYRLGRRKVLFEKRKRISDYALVFGMFGIIVMVVETELSMAHVYDKDSFYSIALKSLISVSTIILLGLILAYHALEVQLFATDNCVEDWRIALSMQRVAQILVELTVCAIHPIPGSFSFT--WTTVHANGV-TVTSR-PTPVDLLLSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMLSLWIIASWVLRACESYHDV-KHKNLLNSMWMISITFLSIGYGDIVPNTYCGRGVAVATGVMGAGVTALVVAVLARKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKYTKLVRKVNASKVRTHQRKFLHAIHSLRKVKMDQRKLNDNANTLVDMAKTQTNMYELVLEMSQRQNSVDSRVDLIEENLRQLQNQLDALPSIIAH 460          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: A0A1J1HUV0 (CLUMA_CG005469, isoform B OS=Clunio marinus OX=568069 GN=CLUMA_CG005469 PE=4 SV=1)

HSP 1 Score: 450.284 bits (1157), Expect = 1.129e-144
Identity = 237/427 (55.50%), Postives = 317/427 (74.24%), Query Frame = 1
Query: 1129 VGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRK---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPI------LAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIIT 2382
            VGYRLGRRK L+EKR RISD++L   +FGI+VMVI+ EL  AG+Y K    S     L S+ ++  + L+    A    LF  D+C +DWRIA+TWQ + Q+ LEL+IC+IHPIPG++         KFK    + ++ + + E I      L++PM  R Y+I R +LLHS++F DA SRSIGA+N+++F+TRF+LKTLMT+CPGTVLL F+++LWI+ SWT+R CE   D  +HAN+LN MWLIA+TFLS+G+GDIVP+T CGRGIA+S G+MG+ CTALLVAV +RKLEL++AEKHV  FM++ Q+TK+LK  AANVLRETWLIYK+T+LVK VN  +VRTHQRKFL AI+ LRK+K+DQRK  DN+NT+ D+AKTQN +YE V++M      LE RIS +E+ +  + +QL+SLPE+LT  +T
Sbjct:   81 VGYRLGRRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYTKHEFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRITQIALELVICAIHPIPGDY---------KFKWTTKLSNKNKELGEAIVPLDVALSLPMFFRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDD-EHANLLNSMWLIAITFLSVGFGDIVPNTYCGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIVSDMSTRQDALEERISSLEEKIQTVQEQLESLPEVLTRCLT 497          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: A0A1J1HUU6 (CLUMA_CG005469, isoform A OS=Clunio marinus OX=568069 GN=CLUMA_CG005469 PE=4 SV=1)

HSP 1 Score: 448.358 bits (1152), Expect = 1.556e-144
Identity = 237/434 (54.61%), Postives = 319/434 (73.50%), Query Frame = 1
Query: 1108 ASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRK---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPI------LAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIIT 2382
              +   +VGYRLGRRK L+EKR RISD++L   +FGI+VMVI+ EL  AG+Y K    S     L S+ ++  + L+    A    LF  D+C +DWRIA+TWQ + Q+ LEL+IC+IHPIPG++         KFK    + ++ + + E I      L++PM  R Y+I R +LLHS++F DA SRSIGA+N+++F+TRF+LKTLMT+CPGTVLL F+++LWI+ SWT+R CE   D  +HAN+LN MWLIA+TFLS+G+GDIVP+T CGRGIA+S G+MG+ CTALLVAV +RKLEL++AEKHV  FM++ Q+TK+LK  AANVLRETWLIYK+T+LVK VN  +VRTHQRKFL AI+ LRK+K+DQRK  DN+NT+ D+AKTQN +YE V++M      LE RIS +E+ +  + +QL+SLPE+LT  +T
Sbjct:   74 GGKQKPNVGYRLGRRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYTKHEFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRITQIALELVICAIHPIPGDY---------KFKWTTKLSNKNKELGEAIVPLDVALSLPMFFRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDD-EHANLLNSMWLIAITFLSVGFGDIVPNTYCGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIVSDMSTRQDALEERISSLEEKIQTVQEQLESLPEVLTRCLT 497          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: A0A2T7NDV0 (CaMBD domain-containing protein (Fragment) OS=Pomacea canaliculata OX=400727 GN=C0Q70_19833 PE=4 SV=1)

HSP 1 Score: 450.284 bits (1157), Expect = 3.905e-144
Identity = 243/432 (56.25%), Postives = 320/432 (74.07%), Query Frame = 1
Query: 1084 YTRGSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILT 2370
            YT    Q  SR   +VGYRLG+R+ LY+KR +ISD+ L   +FGI+ MV++TEL  A +Y KS   S     L SL ++  + L+    A    LF+ D+C+EDWRIAI+W+ + QL +E+LIC+IHPIPGNF      +  + K  ++   R+ S ++ +L++PM LR Y+I R +LLHSR+F DA SRSIGA+N++ FDT+F+LKTLMT+CPGTVLL F+LTLWI+  W +R CE + D   HAN+LN  W+IA+TFLSIGYGDIVP+T CGR IAIS G MG+  TAL+VAV ARKLELS+AEKHV  FM++ Q+TK+LK  AANVLRETWLIYKYTKLVK VN SKVR+HQRKFL+AIH LR++K+DQRK ++N +TLVD+AKTQ NI+E V+EM  + + LE R++KIED L  L   L +LPE+++
Sbjct:  150 YTDERLQHKSRQKPNVGYRLGKRRALYQKRKKISDYCLVCGMFGIVAMVLETELSMADVYDKSDFASLFIKSLISLSTVILLGLILAYHALEVKLFAVDNCVEDWRIAISWRRMIQLFVEILICAIHPIPGNFTFEWTVIKAEDKASVA---RVVS-VDVLLSIPMFLRLYLICRVMLLHSRLFTDASSRSIGALNRIHFDTKFVLKTLMTICPGTVLLVFMLTLWIIAGWLLRACERHHDE-NHANILNSFWMIAITFLSIGYGDIVPNTYCGRFIAISVGTMGAGVTALVVAVIARKLELSRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKYTKLVKKVNPSKVRSHQRKFLQAIHSLRRVKMDQRKLEENQSTLVDMAKTQTNIHEMVSEMHTNQTNLEKRVNKIEDKLATLQIHLDALPELIS 576          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: A0A5N4AVT1 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_05793 PE=4 SV=1)

HSP 1 Score: 442.58 bits (1137), Expect = 7.111e-144
Identity = 235/426 (55.16%), Postives = 316/426 (74.18%), Query Frame = 1
Query: 1126 SVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRK---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIITLKLN 2394
            +VGYRLGRRK L+EKR RISD++L   +FGI++MVI+ EL  AG+YRK    SI    L S+ ++  + L+    A    LF  D+C +DWRIA+TWQ + Q+ +EL IC++HPIPGN   +Q+  T K         +     +  L++PM LR Y+I R +LLHS++F DA SRSIGA+N+++F+TRF+LKTLMT+CPGTVLL F+++LWI+ SWT+R CE   D  +HAN+LN MWLIA+TFLS+G+GDIVP+T CGRGIA+S G+MG+ CTALLVAV +RKLEL++AEKHV  FM++ Q+TK+LK  AANVLRETWLIYK+T+LVK VN  +VRTHQRKFL AI+ LRK+K+DQRK  DN+NT+ D+AKTQN +YE V++M      LE+R++ +ED LV L +QL  LP+++   I  + N
Sbjct:   24 NVGYRLGRRKALFEKRKRISDYALVMGMFGIIIMVIENELSSAGVYRKDEFYSIALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRIGQISMELAICAVHPIPGN---NQFVWTTKLANKNGGIGKKCVPYDVPLSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDE-EHANLLNAMWLIAITFLSVGFGDIVPNTYCGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIVSDMSTRQDTLEDRLATVEDKLVTLQEQLDLLPDLIATRIQAQEN 445          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Match: kcnn3 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3 [Source:ZFIN;Acc:ZDB-GENE-100921-56])

HSP 1 Score: 390.963 bits (1003), Expect = 7.113e-124
Identity = 218/427 (51.05%), Postives = 308/427 (72.13%), Query Frame = 1
Query: 1114 RSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIIT 2382
            R  +++GY+LG R+ L+EKR R+SD++L F +FGI+VMVI+TEL W G+Y KSS+YS+ LK   SL +I  + L+    A    LF  D+  +DWRIA+T + V  + LELL+ ++HP+PG+F     FV         +  + E+ ++ +L+VPM LR Y+I R +LLHS++F DA SRSIGA+NKV F+TRF++KTLMT+CPGTVLL F ++LWI+ +WT+R+CE   D+    +N L  MWLI++TFLSIGYGD+VPHT CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK+TKL+K ++ S+VR HQRKFL+AIH LR +K++QRK  D +NTLVDL+K Q+ +YE ++E+      LE ++  +E  +  L     +LP  LT  ++
Sbjct:  241 RKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GVYSKSSMYSLALKCLISLSTIILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELLVSAVHPVPGDFK----FVWRARLAFTYIPSQAEADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKIDHSRVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQSVMYELMSELNDRSEDLERQMLSLEQRVEQLTAGFSALPAHLTATLS 662          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Match: kcnn2 (potassium calcium-activated channel subfamily N member 2 [Source:ZFIN;Acc:ZDB-GENE-091116-41])

HSP 1 Score: 383.645 bits (984), Expect = 2.717e-123
Identity = 210/424 (49.53%), Postives = 308/424 (72.64%), Query Frame = 1
Query: 1123 KSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIIT 2382
            +++G +LG R+ L+EKR R+SD++L F +FGI+VMVI+TEL W G Y K S+YS+ LK   SL +I  + L+ +  A    LF  D+  +DWRIA+T++ +  + LE+L+C+IHPIPG +     F             + ++ ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++LWI+ +WT+R CE   D+    +N L  MWLI++TFL+IGYGD+VP+T CG+G+ +  G+MG+ CTAL+VAV A+KLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK TKLV+ ++ ++VR HQRKFL+AIH LR +K++QRK  D +N+LVDLAKTQN +Y+ ++++       E RI+ +E  L  L   L++LP +++ +I+
Sbjct:   84 QNIGQKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GAYGKESLYSLALKCLISLSTIILLGLIIIYHAREIQLFMVDNAADDWRIAMTYERIFFICLEILVCAIHPIPGKYT----FTWTARLAFYYTSSKTDADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFTISLWIIAAWTVRACERYHDNQDVTSNFLGAMWLISITFLTIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVAKKLELTKAEKHVHNFMMDTQLTKRVKNTAANVLRETWLIYKNTKLVRKMDHARVRKHQRKFLQAIHQLRSVKMEQRKLNDQANSLVDLAKTQNIMYDLISDLNERGEDTEKRIAVLETKLETLLSNLQALPGLISQLIS 502          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Match: kcnn1b (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1b [Source:ZFIN;Acc:ZDB-GENE-060503-397])

HSP 1 Score: 337.421 bits (864), Expect = 4.806e-106
Identity = 207/456 (45.39%), Postives = 302/456 (66.23%), Query Frame = 1
Query: 1057 PNPNQKSTCYTRGSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPKHANMLN-CMWLIAVTFLSIGYGDIVPHTNCGRGIA-ISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIITLKLNTPGSP 2409
            P    + +    G      +  K +GY+LG R+ L+EKR R+SD++L F +FGI+VMV +TEL W G+Y K S YS  LK   SL ++  + L+ +  A    LF  D+  +DWRIA+T++ +  ++LELL+C+IHPIPG++ +  +     F    SV D   + ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++ WI+ +WT+R+           N+L   +WL+ V F  +  G  VP     + +A +     G+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+ K++K  AANVLRETWLIYK+TKLVK ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDLAKTQN +Y+ V+E++     L+ RI ++E+ L ++   L++LP +   +  L  + PG P
Sbjct:   54 PGKASRESLVREGGSNAPQKRNKDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTLILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERILFIVLELLVCAIHPIPGHY-VFTWTARLAFTYAPSVAD---ADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVFLFWYPQ----NILPIALWLVYVIFSKLQTGSSVPF---WKAVAFLLQPFRGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELDKRIGQLEEKLDSITSSLQALP-VGHFLRPLHPSEPGHP 496          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Match: kcnn4 (potassium calcium-activated channel subfamily N member 4 [Source:NCBI gene;Acc:103046778])

HSP 1 Score: 231.106 bits (588), Expect = 1.414e-66
Identity = 168/428 (39.25%), Postives = 249/428 (58.18%), Query Frame = 1
Query: 1135 YRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSV----------DDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNII 2379
            YRL  RK L E + R+  ++L  A+ GIL+M+   EL  A +Y+  SIY+I +  LIS ST  LL LI+A       LF  D    DWRIA+T   V  + LELL+C++HP+            P  K   SV          +  LE  IE +L+  M LR Y++ R++LLHS++   A  RSIG++N ++F  RF+LK LM   P   LL FI+  W+  +W +R+CE   +  +  +M   +WLIA+TFL++GYGD+ P T+CG+ + +  GVMG ACTA+LVAV  +KL L+K EKHV  FM++ Q++K+++  AANVLRE WL+++ T+     N  + R HQR  L+AI   R L++ QRK +D ++ +VDL+K Q  + +        +  LE RI  +E  L  L    +S  ++L+  +
Sbjct:   55 YRLRDRKFLLEDKRRLCAWALGAAMLGILLMIGHAELCPA-VYQPGSIYAISINGLISFSTGCLLILIIAFHYKDIRLFIIDHNQVDWRIAMTTNRVLGISLELLVCAVHPVASYLGPDVGVQVPVLKWNSSVTPICLCQSHRETWLE--IELLLSGLMFLRLYLVHRAILLHSKVLLSASYRSIGSLNNINFTFRFVLKVLMNKYPARTLLVFIMLFWLSAAWMLRLCERQAEV-ETGDMGTALWLIAITFLTVGYGDVSPCTSCGKVVCLFTGVMGVACTAMLVAVVTKKLALNKGEKHVHFFMMDIQISKEIRNAAANVLRECWLLHRTTQAKN--NNGEHRHHQRCLLEAIRVFRHLRLKQRKLRDYTSEMVDLSKMQMIMCDLSANWNNSYRELEQRIISMEQKLDELGQSFQSTSQLLSQAL 476          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Match: KCNQ4 (potassium voltage-gated channel subfamily Q member 4 [Source:NCBI gene;Acc:103034244])

HSP 1 Score: 51.6026 bits (122), Expect = 3.757e-6
Identity = 30/101 (29.70%), Postives = 49/101 (48.51%), Query Frame = 1
Query: 1783 EINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIY 2085
            +INT+   +A+ L   W   +T  +IGYGD  PHT  GR +A    ++G +  AL   +      L   E+H        +  +K +  AAN+++  W +Y
Sbjct:  259 DINTEFSTYADSL---WWGTITLTTIGYGDKTPHTWLGRLLAAGFALLGVSFFALPAGILGSGFALKVQEQH------RQKHFEKRRTPAANLIQAAWRLY 350          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010066.1 (pep scaffold:Pmarinus_7.0:GL480376:18291:27660:1 gene:ENSPMAG00000009109.1 transcript:ENSPMAT00000010066.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 183.341 bits (464), Expect = 1.356e-53
Identity = 100/190 (52.63%), Postives = 139/190 (73.16%), Query Frame = 1
Query: 1360 FSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVM 1926
            F  D+  +DWRIA+T+Q +  + LELLIC+IHPIPGN+    +     F  V SV    E+ ++ +L++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++LWI+ +WT+R CE   D     +N L  MWLI++TFL+IGYGD+VPHT CGRG+ +  G+M
Sbjct:    3 FIVDNGADDWRIAMTYQRIFNIGLELLICAIHPIPGNYTF-MWTARLAFTYVSSVK---EADVDIVLSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDPQDITSNFLAAMWLISITFLTIGYGDMVPHTYCGRGVCLLTGIM 188          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004465.1 (pep scaffold:Pmarinus_7.0:GL499141:545:1291:-1 gene:ENSPMAG00000004066.1 transcript:ENSPMAT00000004465.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 6.592e-12
Identity = 27/49 (55.10%), Postives = 41/49 (83.67%), Query Frame = 1
Query: 1123 KSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRK 1269
            +++GY+LG R+ L+EKR R+SD++L F +FGI+VMVI+TEL W+ +Y K
Sbjct:  104 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWS-VYDK 151          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009413.1 (pep scaffold:Pmarinus_7.0:GL479604:29420:34785:-1 gene:ENSPMAG00000008520.1 transcript:ENSPMAT00000009413.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 3.339e-11
Identity = 28/64 (43.75%), Postives = 43/64 (67.19%), Query Frame = 1
Query: 2167 LRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLP 2358
            LR +K++QRK  D +NTLVDLAKTQN +Y+ V+++   +   E R++ +E  L  + D + SLP
Sbjct:    2 LRSVKMEQRKLTDQANTLVDLAKTQNVMYDLVSDLNERNEEFEKRLATMEGKLEAMADCITSLP 65          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Nematostella
Match: EDO49636 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFP0])

HSP 1 Score: 51.6026 bits (122), Expect = 1.292e-6
Identity = 26/95 (27.37%), Postives = 51/95 (53.68%), Query Frame = 1
Query: 1822 NCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVK 2106
            + +W++ VT  ++G+GDIVP +   RG+   A ++G    AL ++V    L+L+  EK +  ++ +    ++    AA  ++  W   +Y + VK
Sbjct:  412 DTVWMMVVTMTTLGFGDIVPVSVVARGLVGFASILGIFLMALFISVVHEYLQLTNQEKRILAYIEKADHQQEKMEKAAACIQSCW---RYRQFVK 503          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: kcnn1a (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101164003])

HSP 1 Score: 401.364 bits (1030), Expect = 3.930e-129
Identity = 218/416 (52.40%), Postives = 307/416 (73.80%), Query Frame = 1
Query: 1123 KSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLP 2358
            + +GY+LG R+ L+EKR R+SD++L F +FGI+VMV +TEL W G+Y K S YS  LK   SL ++  + L+ +  A    LF  D+  +DWRIA+T++ +  ++LELL+C+IHPIPG + +  +     F    SV D   + ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++ WI+ +WT+R+CE   D  +  +N L  MWLI++TFLSIGYGD+VPHT CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+ K++K  AANVLRETWLIYK+TKLVK ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDLAKTQN +Y+ V+E++     L+ RI  +ED L ++   L++LP
Sbjct:  146 RDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTVILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFIVLELLVCAIHPIPGQY-VFTWTARLAFTYTPSVAD---ADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELDKRIGTLEDKLDSVTGSLQALP 556          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: kcnn2 (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101174204])

HSP 1 Score: 386.341 bits (991), Expect = 1.437e-124
Identity = 216/424 (50.94%), Postives = 311/424 (73.35%), Query Frame = 1
Query: 1123 KSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIIT 2382
            +++G +LG R+ L+EKR R+SD++L F +FGI+VMVI+TEL W G Y K S+YS+ LK   SL +I  + L+ +  A    LF  D+  +DWRIA+T++ +  + LE+L+C+IHPIPGN+     F          V  R ++ ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++LWI+ +WT+R CE   D+    +N L  MWLI++TFL+IGYGD+VPHT CG+G+ +  G+MG+ CTAL+VAV A+KLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK TKLV+ ++ ++VR HQRKFL+AIH LR +K++QRK  D +N+LVDLAKTQN +Y+ V+++      +E RI+ +E  L  L   L++LP +++ +IT
Sbjct:   65 QNIGEKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GAYGKESLYSLALKCLISLSTIILLGLIIIYHAREIQLFMVDNAADDWRIAMTYERIFFICLEILVCAIHPIPGNYT----FTWTARLAYSYVPSRTDADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFTISLWIIAAWTVRACERYHDNQDITSNFLGAMWLISITFLTIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVAKKLELTKAEKHVHNFMMDTQLTKRVKNTAANVLRETWLIYKNTKLVRKMDHARVRKHQRKFLQAIHQLRSVKMEQRKLNDQANSLVDLAKTQNIMYDMVSDLNERGEDMEKRIALLETKLETLLSNLQALPGLISQVIT 483          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: kcnn1a (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101164003])

HSP 1 Score: 400.208 bits (1027), Expect = 2.609e-124
Identity = 218/416 (52.40%), Postives = 307/416 (73.80%), Query Frame = 1
Query: 1123 KSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLP 2358
            + +GY+LG R+ L+EKR R+SD++L F +FGI+VMV +TEL W G+Y K S YS  LK   SL ++  + L+ +  A    LF  D+  +DWRIA+T++ +  ++LELL+C+IHPIPG + +  +     F    SV D   + ++ IL++PM LR Y+I R +LLHS++F DA SRSIGA+NK++F+TRF++KTLMT+CPGTVLL F ++ WI+ +WT+R+CE   D  +  +N L  MWLI++TFLSIGYGD+VPHT CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+ K++K  AANVLRETWLIYK+TKLVK ++ +KVR HQRKFL+AIH LR +K++QRK  D +NTLVDLAKTQN +Y+ V+E++     L+ RI  +ED L ++   L++LP
Sbjct:  536 RDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTVILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFIVLELLVCAIHPIPGQY-VFTWTARLAFTYTPSVAD---ADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELDKRIGTLEDKLDSVTGSLQALP 946          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: kcnn3 (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101156116])

HSP 1 Score: 392.504 bits (1007), Expect = 3.340e-124
Identity = 223/447 (49.89%), Postives = 319/447 (71.36%), Query Frame = 1
Query: 1063 PNQKSTCYTRG---SRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIIT 2382
            P+  ST Y RG   + + + R  +++GY+LG R+ L+EKR R+SD++L F +FGI+VMVI+TEL W G+Y KSS+YS+ LK   SL ++  + L+    A    LF  D+  +DWRIA+T + V  + LELL+ ++HP+PG+F   Q+     F    S   + E+ ++ +L+VPM LR Y+I R +LLHS++F DA SRSIGA+NKV F+TRF++KTLMT+CPGTVLL F ++LWI+ +WT+R+CE   D+    +N L  MWLI++TFLSIGYGD+VPHT CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK+TKL+K ++ S+VR HQRKFL+AIH LR +K++QRK  D +NTLVDL+K Q+ +YE ++E+      LE ++  +E  +  L     +LP  L+  ++
Sbjct:  207 PSAYST-YPRGGGSTSKASKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GVYSKSSMYSLALKCLISLSTVILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELLVSAVHPVPGDFKF-QWRARLAFSYAPS---QAEADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKIDHSRVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQSVMYELMSELNDRSEDLERQMLSLEQRVEQLTAGFNALPAHLSATLS 647          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: kcnn3 (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101156116])

HSP 1 Score: 392.889 bits (1008), Expect = 2.118e-123
Identity = 222/439 (50.57%), Postives = 315/439 (71.75%), Query Frame = 1
Query: 1087 TRGSRQIAS-RSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPK-HANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIITLK 2388
             RGS   AS R  +++GY+LG R+ L+EKR R+SD++L F +FGI+VMVI+TEL W G+Y KSS+YS+ LK   SL ++  + L+    A    LF  D+  +DWRIA+T + V  + LELL+ ++HP+PG+F   Q+     F    S   + E+ ++ +L+VPM LR Y+I R +LLHS++F DA SRSIGA+NKV F+TRF++KTLMT+CPGTVLL F ++LWI+ +WT+R+CE   D+    +N L  MWLI++TFLSIGYGD+VPHT CG+G+ +  G+MG+ CTAL+VAV ARKLEL+KAEKHV  FM++ Q+TK++K  AANVLRETWLIYK+TKL+K ++ S+VR HQRKFL+AIH LR +K++QRK  D +NTLVDL+K Q+ +YE ++E+      LE ++  +E  +  L     +LP  L+  ++ +
Sbjct:  303 ARGSTSKASKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GVYSKSSMYSLALKCLISLSTVILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELLVSAVHPVPGDFKF-QWRARLAFSYAPS---QAEADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKIDHSRVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQSVMYELMSELNDRSEDLERQMLSLEQRVEQLTAGFNALPAHLSATLSAQ 736          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000076156.1 (SMESG000076156.1)

HSP 1 Score: 1287.32 bits (3330), Expect = 0.000e+0
Identity = 697/714 (97.62%), Postives = 698/714 (97.76%), Query Frame = 1
Query:  283 MMHDVCSWRQWSMNNEETDSLIDSKKEKPMELRSFSFSRIQNPTTISSTNLLCPSEEPSLGNISNLANQERSPEQSFIPQTKNDTCSLVIPSASFSIPNNELNIITSSGNYESSIGRRYSDIIFASHDKRESDSFPNNYLKSSMRNIHKRAPHHLSHNVITQSRNMGIDEIGLDYMRANGAIPVYCLGFKQLHQPMSNGNEQKSSVASLINIFTKNPXXXXXXXXXXXXXCNYLQSNMEXXXXXXXXXXXXXTPQTYLPNPNQKSTCYTRGSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIITLKLNTPGSPRS 2415
            MMHDVCSWRQWSMNNEETDSLIDSKKEKPMELRSFSFSRIQNPTTISSTNLLCPSEEPSLGNISNLANQERSPEQSFIPQTKNDTCSLVIPSASFSIPNNELNIITSSGNYESSIGRRYSDIIFASHDKRESDSFPNNYLKSSMRNIHKRAPHHLSHNVITQSRNMGIDEIGLDYMRANGAIP    GFKQLHQPMSNGNEQKSSVASLINIFTKNPFSSASHSFDKSHSCNYLQSNMESNDNSKDPSSKDKTPQTYLPNPNQKSTCYTRGSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKSSIYSILLKSLISISTIILL       A    LFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGTVLLTFILTLWILLSWTMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLV LHDQLKSLPEILTNIITLKLN+PGSPRS
Sbjct:    1 MMHDVCSWRQWSMNNEETDSLIDSKKEKPMELRSFSFSRIQNPTTISSTNLLCPSEEPSLGNISNLANQERSPEQSFIPQTKNDTCSLVIPSASFSIPNNELNIITSSGNYESSIGRRYSDIIFASHDKRESDSFPNNYLKSSMRNIHKRAPHHLSHNVITQSRNMGIDEIGLDYMRANGAIP----GFKQLHQPMSNGNEQKSSVASLINIFTKNPFSSASHSFDKSHSCNYLQSNMESNDNSKDPSSKDKTPQTYLPNPNQKSTCYTRGSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKSSIYSILLKSLISISTIILLGLILAYHALVIQLFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGTVLLTFILTLWILLSWTMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVTLHDQLKSLPEILTNIITLKLNSPGSPRS 710          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000076156.1 (SMESG000076156.1)

HSP 1 Score: 1286.55 bits (3328), Expect = 0.000e+0
Identity = 704/710 (99.15%), Postives = 705/710 (99.30%), Query Frame = 1
Query:  286 MHDVCSWRQWSMNNEETDSLIDSKKEKPMELRSFSFSRIQNPTTISSTNLLCPSEEPSLGNISNLANQERSPEQSFIPQTKNDTCSLVIPSASFSIPNNELNIITSSGNYESSIGRRYSDIIFASHDKRESDSFPNNYLKSSMRNIHKRAPHHLSHNVITQSRNMGIDEIGLDYMRANGAIPVYCLGFKQLHQPMSNGNEQKSSVASLINIFTKNPXXXXXXXXXXXXXCNYLQSNMEXXXXXXXXXXXXXTPQTYLPNPNQKSTCYTRGSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIITLKLNTPGSPRS 2415
            MHDVCSWRQWSMNNEETDSLIDSKKEKPMELRSFSFSRIQNPTTISSTNLLCPSEEPSLGNISNLANQERSPEQSFIPQTKNDTCSLVIPSASFSIPNNELNIITSSGNYESSIGRRYSDIIFASHDKRESDSFPNNYLKSSMRNIHKRAPHHLSHNVITQSRNMGIDEIGLDYMRANGAIP    GFKQLHQPMSNGNEQKSSVASLINIFTKNPFSSASHSFDKSHSCNYLQSNMESNDNSKDPSSKDKTPQTYLPNPNQKSTCYTRGSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKSSIYSILLKSLISISTIILLGLILAYHALLFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGTVLLTFILTLWILLSWTMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLV LHDQLKSLPEILTNIITLKLN+PGSPRS
Sbjct:    1 MHDVCSWRQWSMNNEETDSLIDSKKEKPMELRSFSFSRIQNPTTISSTNLLCPSEEPSLGNISNLANQERSPEQSFIPQTKNDTCSLVIPSASFSIPNNELNIITSSGNYESSIGRRYSDIIFASHDKRESDSFPNNYLKSSMRNIHKRAPHHLSHNVITQSRNMGIDEIGLDYMRANGAIP----GFKQLHQPMSNGNEQKSSVASLINIFTKNPFSSASHSFDKSHSCNYLQSNMESNDNSKDPSSKDKTPQTYLPNPNQKSTCYTRGSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKSSIYSILLKSLISISTIILLGLILAYHALLFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGTVLLTFILTLWILLSWTMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVTLHDQLKSLPEILTNIITLKLNSPGSPRS 706          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000046614.1 (SMESG000046614.1)

HSP 1 Score: 461.455 bits (1186), Expect = 9.389e-152
Identity = 288/561 (51.34%), Postives = 383/561 (68.27%), Query Frame = 1
Query:  730 RAPHHLSH--NVITQSRNMGIDEIGLDYMRANGAIPVYCLGFKQLH--QPMSNGNEQKSSVASLINIFTKNPXXXXXXXXXXXXXCNYLQSNMEXXXXXXXXXXXXXTPQTYLPNPNQKST---CYTRGSRQIASRSMKS---VGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTN 2373
            + P HL +    I      G++ IG+D+MR NGA+     GFKQL   +     + QK  + S+ N     P +             +  S+ +   +     S++   +  + N +   +   C  R      +R+ K+   VGYRLG+RKEL+EKR R++D+SL FA+FG+ +M++D EL    +Y  +SIYSI +K LI IST+IL+            +FS DD IEDWRIAITWQ +AQ++ E+ ICS+ PIPG       + T K++ V +V+  +   I  +L++PMLLR Y+I R LLLHS++F DAGSRSIGAMNKVSF+  F+LKT+MT  PGTVLL FIL +W++ SWTMR+CE+  D  +H N+ N MWLI+VTFLSIGYGDIVPHT CGRGIAI+ GV GSACTAL+VAVFAR+LELSKAEKHV  FM ENQ+TK+LK YAANVLRETWLIYKYTKLVKH+N  KVR HQRKFL+AIHG+R++KIDQRK QDNSNTLVDLAKTQ++IYETVTEMR+  +YL + +  ++ NL+ L + ++ LP+++ +
Sbjct:  123 KNPSHLVYPTGAIKDKMKTGLETIGVDFMRVNGAVS----GFKQLKRAEEFKTAHRQKKLIKSISN--ASQPQND----------VKFKPSDSDYRTSFGTLKSEEVQEECKVQNDHSGESAALCRRRDDYNNNNRTHKTNKNVGYRLGKRKELFEKRKRVTDYSLMFAVFGVFIMILDLELSMYNLYHPTSIYSITMKGLILISTVILVGLIMAYHVLEIKIFSWDDSIEDWRIAITWQRIAQMIAEVFICSVQPIPG-------YYTFKWR-VRNVEKDVNLNI--VLSLPMLLRLYLILRVLLLHSKLFSDAGSRSIGAMNKVSFNISFVLKTVMTTNPGTVLLVFILFIWLVFSWTMRICEVVYDD-QHGNLFNSMWLISVTFLSIGYGDIVPHTYCGRGIAIATGVTGSACTALVVAVFARRLELSKAEKHVIHFMFENQLTKQLKNYAANVLRETWLIYKYTKLVKHINPMKVRVHQRKFLRAIHGMRQVKIDQRKLQDNSNTLVDLAKTQSSIYETVTEMRIEQNYLHHTLEILDQNLLKLQECIECLPKVMKD 656          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000046614.1 (SMESG000046614.1)

HSP 1 Score: 461.455 bits (1186), Expect = 1.469e-151
Identity = 288/561 (51.34%), Postives = 383/561 (68.27%), Query Frame = 1
Query:  730 RAPHHLSH--NVITQSRNMGIDEIGLDYMRANGAIPVYCLGFKQLH--QPMSNGNEQKSSVASLINIFTKNPXXXXXXXXXXXXXCNYLQSNMEXXXXXXXXXXXXXTPQTYLPNPNQKST---CYTRGSRQIASRSMKS---VGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTN 2373
            + P HL +    I      G++ IG+D+MR NGA+     GFKQL   +     + QK  + S+ N     P +             +  S+ +   +     S++   +  + N +   +   C  R      +R+ K+   VGYRLG+RKEL+EKR R++D+SL FA+FG+ +M++D EL    +Y  +SIYSI +K LI IST+IL+            +FS DD IEDWRIAITWQ +AQ++ E+ ICS+ PIPG       + T K++ V +V+  +   I  +L++PMLLR Y+I R LLLHS++F DAGSRSIGAMNKVSF+  F+LKT+MT  PGTVLL FIL +W++ SWTMR+CE+  D  +H N+ N MWLI+VTFLSIGYGDIVPHT CGRGIAI+ GV GSACTAL+VAVFAR+LELSKAEKHV  FM ENQ+TK+LK YAANVLRETWLIYKYTKLVKH+N  KVR HQRKFL+AIHG+R++KIDQRK QDNSNTLVDLAKTQ++IYETVTEMR+  +YL + +  ++ NL+ L + ++ LP+++ +
Sbjct:  131 KNPSHLVYPTGAIKDKMKTGLETIGVDFMRVNGAVS----GFKQLKRAEEFKTAHRQKKLIKSISN--ASQPQND----------VKFKPSDSDYRTSFGTLKSEEVQEECKVQNDHSGESAALCRRRDDYNNNNRTHKTNKNVGYRLGKRKELFEKRKRVTDYSLMFAVFGVFIMILDLELSMYNLYHPTSIYSITMKGLILISTVILVGLIMAYHVLEIKIFSWDDSIEDWRIAITWQRIAQMIAEVFICSVQPIPG-------YYTFKWR-VRNVEKDVNLNI--VLSLPMLLRLYLILRVLLLHSKLFSDAGSRSIGAMNKVSFNISFVLKTVMTTNPGTVLLVFILFIWLVFSWTMRICEVVYDD-QHGNLFNSMWLISVTFLSIGYGDIVPHTYCGRGIAIATGVTGSACTALVVAVFARRLELSKAEKHVIHFMFENQLTKQLKNYAANVLRETWLIYKYTKLVKHINPMKVRVHQRKFLRAIHGMRQVKIDQRKLQDNSNTLVDLAKTQSSIYETVTEMRIEQNYLHHTLEILDQNLLKLQECIECLPKVMKD 664          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000046926.1 (SMESG000046926.1)

HSP 1 Score: 426.402 bits (1095), Expect = 1.436e-138
Identity = 254/547 (46.44%), Postives = 354/547 (64.72%), Query Frame = 1
Query:  781 GIDEIGLDYMRANGAIPVYCLGFKQLHQPMSNGNEQKSSVASLINIFTKNPXXXXXXXXXXXXXCNYLQSNMEXXXXXXXXXXXXXTPQTYLPNPNQKSTCYTRGSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKXXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIP--GNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGXXXXXXXXXXXXXXXXXMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAK-----------------------TQNNIYETVTEMRLHHSYLENRISKIEDNLVNLH 2337
             +DEI +D ++AN +      GFKQL +  +   E K+   + I+I   NP  S                ++E+  N+ +        Q+     +  S+   R + +I        G+RLG RK L E+R RISD+SL  A+FGI+ M++ TE  WAG+ +++S        L +L ++  II +         LFSCDDC+EDWRI ITWQ + Q++LEL +C+IHPIP   N ++    +    + +L +DD++   ++ IL++PM LR Y++FR +LLHS++F DAG RSIGA+NKV+FDTRF+LKTL+T+CP TV + F+L++W+  SW +R CEI  D P+H ++LN  WLIA+TFLS+GYG++VPHT CGR IAIS+GVMGSACTAL+VAV A+KLEL+KAE+HVT F+L N++ KK+K  AANVLRETWLIYK+TKLV+ V+ S++R HQRKFLKAIHGLRK+KIDQRK  DNSNTLVD AK                       TQ++I++TVTEMR  ++    RI  IE +++NL 
Sbjct:  104 ALDEISIDILKANCSFG----GFKQLQKVNNVKKECKNEEQNTISIINGNPKVSV--------------GDLENVSNNSENFKMPHDAQS--NRFSMTSSTAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFLKSLITLSTLVLIIFILTYHVLVIQLFSCDDCLEDWRITITWQRIGQMILELGVCAIHPIPFLANTDVKMAILDISHQHML-LDDQVS--LDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVD-PRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILNNKIKKKMKNCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQ 626          
The following BLAST results are available for this feature:
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNN33.664e-12848.70potassium calcium-activated channel subfamily N me... [more]
KCNN31.056e-12647.27potassium calcium-activated channel subfamily N me... [more]
KCNN11.215e-12550.46potassium calcium-activated channel subfamily N me... [more]
KCNN11.920e-12550.46potassium calcium-activated channel subfamily N me... [more]
KCNN26.058e-12551.30potassium calcium-activated channel subfamily N me... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnl-21.207e-9644.50KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-21.415e-9644.50KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-21.835e-9644.50KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-22.546e-9644.50KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-23.414e-9645.22KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SK1.301e-14354.79gene:FBgn0029761 transcript:FBtr0300467[more]
SK3.724e-14254.42gene:FBgn0029761 transcript:FBtr0344555[more]
SK2.141e-14045.69gene:FBgn0029761 transcript:FBtr0301953[more]
SK2.510e-14054.59gene:FBgn0029761 transcript:FBtr0301949[more]
SK5.112e-14054.42gene:FBgn0029761 transcript:FBtr0331604[more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnn1a1.997e-13250.67potassium intermediate/small conductance calcium-a... [more]
kcnn1b1.011e-12952.96potassium intermediate/small conductance calcium-a... [more]
kcnn1b8.321e-12852.58potassium intermediate/small conductance calcium-a... [more]
kcnn1a1.166e-12751.49potassium intermediate/small conductance calcium-a... [more]
kcnn21.021e-12250.71potassium calcium-activated channel subfamily N me... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr173.338e-12848.53WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-10... [more]
wdr171.215e-12749.78WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-10... [more]
wdr172.013e-12749.78WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-10... [more]
wdr176.256e-12749.78WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-10... [more]
KCNN29.025e-12450.58potassium channel, calcium activated intermediate/... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnn31.711e-12849.12potassium intermediate/small conductance calcium-a... [more]
Kcnn18.320e-12652.13potassium intermediate/small conductance calcium-a... [more]
Kcnn18.320e-12652.13potassium intermediate/small conductance calcium-a... [more]
Kcnn23.773e-12551.30potassium intermediate/small conductance calcium-a... [more]
Kcnn23.773e-12551.30potassium intermediate/small conductance calcium-a... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7KVW5|KCNN_DROME6.420e-13652.16Small conductance calcium-activated potassium chan... [more]
sp|P58391|KCNN3_MOUSE1.197e-12749.12Small conductance calcium-activated potassium chan... [more]
sp|Q9UGI6|KCNN3_HUMAN1.760e-12748.70Small conductance calcium-activated potassium chan... [more]
sp|P70605|KCNN3_RAT1.907e-12749.34Small conductance calcium-activated potassium chan... [more]
sp|P58392|KCNN3_PIG2.016e-12748.70Small conductance calcium-activated potassium chan... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TXT19.425e-14957.31CaMBD domain-containing protein OS=Capitella telet... [more]
A0A1J1HUV01.129e-14455.50CLUMA_CG005469, isoform B OS=Clunio marinus OX=568... [more]
A0A1J1HUU61.556e-14454.61CLUMA_CG005469, isoform A OS=Clunio marinus OX=568... [more]
A0A2T7NDV03.905e-14456.25CaMBD domain-containing protein (Fragment) OS=Poma... [more]
A0A5N4AVT17.111e-14455.16Uncharacterized protein OS=Photinus pyralis OX=705... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnn37.113e-12451.05potassium intermediate/small conductance calcium-a... [more]
kcnn22.717e-12349.53potassium calcium-activated channel subfamily N me... [more]
kcnn1b4.806e-10645.39potassium intermediate/small conductance calcium-a... [more]
kcnn41.414e-6639.25potassium calcium-activated channel subfamily N me... [more]
KCNQ43.757e-629.70potassium voltage-gated channel subfamily Q member... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000010066.11.356e-5352.63pep scaffold:Pmarinus_7.0:GL480376:18291:27660:1 g... [more]
ENSPMAT00000004465.16.592e-1255.10pep scaffold:Pmarinus_7.0:GL499141:545:1291:-1 gen... [more]
ENSPMAT00000009413.13.339e-1143.75pep scaffold:Pmarinus_7.0:GL479604:29420:34785:-1 ... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO496361.292e-627.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnn1a3.930e-12952.40small conductance calcium-activated potassium chan... [more]
kcnn21.437e-12450.94small conductance calcium-activated potassium chan... [more]
kcnn1a2.609e-12452.40small conductance calcium-activated potassium chan... [more]
kcnn33.340e-12449.89small conductance calcium-activated potassium chan... [more]
kcnn32.118e-12350.57small conductance calcium-activated potassium chan... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076156.10.000e+097.62SMESG000076156.1[more]
SMESG000076156.10.000e+099.15SMESG000076156.1[more]
SMESG000046614.19.389e-15251.34SMESG000046614.1[more]
SMESG000046614.11.469e-15151.34SMESG000046614.1[more]
SMESG000046926.11.436e-13846.44SMESG000046926.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004698 ID=SMED30004698|Name=Small conductance calcium-activated potassium channel protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2588bp
CAACTGTCATTGTTGCCCAGATACACACAGTGATACACACACATCGATTG
ACATACATTTGGAATTATAAATACATTCGACTCTCTCTATGTGTGTACAT
GTTTCAATATCAGTGGTAAATTTTGCTTCCCTTTTATATCAATGTTGTAA
CCACATTGACTTGACAATTCCAATTCTGAACGGAGAGATTATTAGTACTG
TTTCATTTATTCATTAAAAAACAATCAATTTACAAAATCTTTGATTTAAA
TTAATTAAAGACGAGACGAATTTCATTTTCCTATGATGCATGATGTGTGT
AGTTGGCGGCAATGGTCAATGAATAACGAAGAAACAGATTCATTAATTGA
TTCGAAAAAAGAAAAACCCATGGAATTAAGATCATTTTCTTTCAGTAGAA
TTCAAAATCCCACCACGATTTCCAGCACAAATCTTTTATGCCCATCAGAG
GAGCCGTCATTAGGAAATATATCGAATTTAGCAAATCAGGAAAGGTCACC
AGAACAAAGTTTTATACCTCAGACGAAAAACGACACCTGCTCTTTGGTGA
TTCCATCAGCATCATTCTCGATTCCTAATAATGAGCTGAACATCATTACT
TCCTCTGGAAATTATGAATCCTCGATCGGTCGACGGTACAGTGACATTAT
TTTCGCCAGTCACGATAAGCGCGAAAGTGATTCATTTCCCAATAATTATT
TAAAAAGTAGCATGAGGAATATTCACAAACGAGCACCGCATCATTTATCT
CATAACGTTATAACCCAAAGCCGTAACATGGGCATCGATGAAATTGGATT
GGATTATATGCGAGCAAACGGAGCGATACCAGTTTACTGTTTAGGATTTA
AACAACTTCATCAACCAATGTCAAATGGAAATGAACAGAAATCTTCAGTG
GCCTCATTGATCAACATATTCACAAAGAATCCATTTAGTAGTGCGTCGCA
CAGTTTTGACAAATCCCACAGTTGTAATTACTTACAAAGTAACATGGAAA
GCAATGACAATTCTAAAGATCCAAGTTCTAAAGATAAAACTCCTCAGACT
TATTTGCCCAATCCAAATCAGAAATCAACGTGTTATACAAGAGGCAGTCG
TCAAATAGCTTCCAGATCCATGAAAAGTGTTGGCTATCGGTTAGGCCGTC
GAAAAGAGTTGTATGAAAAACGGATGAGAATTTCTGATTTTTCACTATCA
TTTGCAATATTCGGGATTCTCGTGATGGTAATTGATACAGAACTTTTGTG
GGCCGGCATTTACAGAAAGAGTTCTATTTATTCGATTCTTCTCAAATCAC
TGATATCTATTTCTACTATCATTTTACTGGGTTTAATTTTGGCCTACCAT
GCTTTGTTGTTTTCATGCGACGATTGTATTGAAGACTGGAGAATAGCAAT
AACCTGGCAAAGTGTTGCTCAGTTACTACTGGAGCTTCTGATATGTTCAA
TCCATCCAATACCAGGAAATTTCAATATTTCACAATATTTTGTTACTCCA
AAATTCAAAGGGGTTTTGAGTGTTGATGATCGGTTAGAAAGTATGATTGA
ACCAATACTTGCTGTGCCAATGCTACTACGATTTTATATGATATTTCGTT
CTTTATTATTACATTCACGAATGTTTCGTGATGCAGGATCGAGAAGTATA
GGTGCAATGAACAAAGTCAGTTTTGACACAAGATTCATCCTTAAAACACT
TATGACAATGTGTCCAGGAACTGTTCTTTTAACGTTCATTTTAACTCTCT
GGATACTGCTTAGTTGGACGATGAGAATGTGCGAAATCAATACTGATTCA
CCTAAACATGCAAATATGTTGAATTGTATGTGGTTAATAGCGGTGACTTT
TCTGAGTATTGGATACGGAGATATTGTTCCTCATACGAATTGTGGGAGAG
GAATTGCGATTAGTGCTGGAGTTATGGGATCAGCATGCACCGCTCTACTA
GTTGCTGTTTTTGCAAGAAAGTTGGAACTGTCCAAAGCTGAAAAGCACGT
AACGCAATTCATGTTGGAAAATCAAATGACAAAAAAATTGAAATATTATG
CTGCGAATGTACTTCGAGAAACATGGCTGATTTATAAATATACAAAATTG
GTTAAGCATGTTAATGCATCAAAAGTGAGAACGCACCAGAGAAAGTTTTT
GAAAGCCATTCACGGGCTACGAAAATTAAAGATTGATCAGAGGAAGTTTC
AAGACAATTCCAACACATTAGTAGACTTGGCAAAGACCCAGAACAATATT
TATGAAACTGTGACTGAGATGAGGTTGCATCACTCGTATTTGGAAAATAG
AATATCAAAAATAGAGGATAATCTTGTTAATTTACATGACCAATTGAAGT
CTCTTCCAGAAATTTTGACAAATATAATCACATTAAAATTGAATACCCCC
GGTTCTCCCAGGAGTTGACTAGTGCCTATTAGACATTTTCCTTCAATCAA
ATCTCATATGATGTGCCATTTTATTTTTATAATCTATCTGTAATTTTGTT
GCAAACTGAGCATCATGATTTCTCCTTACTGTAAAGTTTTATTTTAGATT
GTTTATTACTTTTTATTCATTTTCTTACAAAAAATCGG
back to top

protein sequence of SMED30004698-orf-1

>SMED30004698-orf-1 ID=SMED30004698-orf-1|Name=SMED30004698-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=712bp
MMHDVCSWRQWSMNNEETDSLIDSKKEKPMELRSFSFSRIQNPTTISSTN
LLCPSEEPSLGNISNLANQERSPEQSFIPQTKNDTCSLVIPSASFSIPNN
ELNIITSSGNYESSIGRRYSDIIFASHDKRESDSFPNNYLKSSMRNIHKR
APHHLSHNVITQSRNMGIDEIGLDYMRANGAIPVYCLGFKQLHQPMSNGN
EQKSSVASLINIFTKNPFSSASHSFDKSHSCNYLQSNMESNDNSKDPSSK
DKTPQTYLPNPNQKSTCYTRGSRQIASRSMKSVGYRLGRRKELYEKRMRI
SDFSLSFAIFGILVMVIDTELLWAGIYRKSSIYSILLKSLISISTIILLG
LILAYHALLFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNFNIS
QYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRD
AGSRSIGAMNKVSFDTRFILKTLMTMCPGTVLLTFILTLWILLSWTMRMC
EINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGS
ACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLI
YKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLA
KTQNNIYETVTEMRLHHSYLENRISKIEDNLVNLHDQLKSLPEILTNIIT
LKLNTPGSPRS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036122CaM-bd_dom_sf
IPR015449K_chnl_Ca-activ_SK
IPR004178CaM-bd_dom
IPR013099K_chnl_dom
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0007165signal transduction
GO:0016057regulation of membrane potential in photoreceptor cell
GO:0071805potassium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0016286small conductance calcium-activated potassium channel activity
GO:0005516calmodulin binding
GO:0015269calcium-activated potassium channel activity
GO:0009881photoreceptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0016020membrane
GO:0043025neuronal cell body
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015449Potassium channel, calcium-activated, SKPRINTSPR01451SKCHANNELcoord: 384..402
score: 47.37
coord: 286..306
score: 53.06
IPR015449Potassium channel, calcium-activated, SKPFAMPF03530SK_channelcoord: 286..396
e-value: 4.3E-41
score: 139.5
IPR015449Potassium channel, calcium-activated, SKPANTHERPTHR10153SMALL CONDUCTANCE CALCIUM-ACTIVATED POTASSIUM CHANNELcoord: 247..699
IPR004178Calmodulin-binding domainSMARTSM01053CaMBD_2coord: 579..655
e-value: 2.3E-39
score: 146.8
IPR004178Calmodulin-binding domainPFAMPF02888CaMBDcoord: 579..653
e-value: 1.4E-32
score: 111.6
IPR013099Potassium channel domainPFAMPF07885Ion_trans_2coord: 486..564
e-value: 1.7E-14
score: 53.5
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 565..660
e-value: 1.4E-42
score: 145.8
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 468..564
e-value: 7.1E-15
score: 56.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 238..264
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 250..264
NoneNo IPR availablePANTHERPTHR10153:SF40SMALL CONDUCTANCE CALCIUM-ACTIVATED POTASSIUM CHANNEL PROTEIN 3coord: 247..699
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 432..603
NoneNo IPR availableTMHMMTMhelixcoord: 371..393
NoneNo IPR availableTMHMMTMhelixcoord: 303..325
NoneNo IPR availableTMHMMTMhelixcoord: 473..495
NoneNo IPR availableTMHMMTMhelixcoord: 421..443
NoneNo IPR availableTMHMMTMhelixcoord: 340..359
NoneNo IPR availableTMHMMTMhelixcoord: 510..532
NoneNo IPR availableTMHMMTMhelixcoord: 539..561
IPR036122SK, calmodulin-binding domain superfamilySUPERFAMILYSSF81327Small-conductance potassium channelcoord: 562..653