centrosomal protein of 70 kDa-like isoform X4

Overview
Namecentrosomal protein of 70 kDa-like isoform X4
Smed IDSMED30004697
Length (bp)2092
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of centrosomal protein of 70 kDa-like isoform X4 (SMED30004697) t-SNE clustered cells

Violin plots show distribution of expression levels for centrosomal protein of 70 kDa-like isoform X4 (SMED30004697) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of centrosomal protein of 70 kDa-like isoform X4 (SMED30004697) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for centrosomal protein of 70 kDa-like isoform X4 (SMED30004697) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004697

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30004697SMESG000052033.1 SmedASXL_013651SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
gutSMED30004697SMESG000052033.1 dd_Smed_v4_14545_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30004697SMESG000052033.1 dd_Smed_v4_14545_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30004697SMESG000052033.1 dd_Smed_v6_14545_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Human
Match: CEP70 (centrosomal protein 70 [Source:HGNC Symbol;Acc:HGNC:29972])

HSP 1 Score: 102.834 bits (255), Expect = 1.607e-22
Identity = 64/247 (25.91%), Postives = 131/247 (53.04%), Query Frame = 1
Query: 1312 YFGICSRLLQLIETPGLPVLVGFTDRTDTEKHS----DESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPW---NSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSL 2031
            YF +   +  +I  P  PV++    +   +  +     +  +  ++ V E W  QL S+ +L  S++ L++ L+PW       +N    +   + +V+ +++  E   +++N       QA  +V HFQKLF+ P++ GVY RMN +Y+R  EM N + +L+++L ++    L  LV+ V  L +++N    +++      +D++ ++ +LE++E F P F+   +++L  L +  +D ++P +K L
Sbjct:  196 YFQVLCSINSIIHNPRAPVIIYKQTKGGVQNFNKDLVQDCGFEHLVPVIEMWADQLTSLKDLYKSLKTLSAELVPWLNLKKQDENEGIKVEDLLFIVDTMLEEVENKEKDSNMPHFQTLQA--IVSHFQKLFDVPSLNGVYPRMNEVYTRLGEMNNAVRNLQELLELDSSSSLCVLVSTVGKLCRLINEDVNEQVMQVLGPEDLQSIIYKLEEHEEFFPAFQAFTNDLLEILEIDDLDAIVPAVKKL 440          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Human
Match: CEP70 (centrosomal protein 70 [Source:HGNC Symbol;Acc:HGNC:29972])

HSP 1 Score: 102.834 bits (255), Expect = 3.333e-22
Identity = 64/247 (25.91%), Postives = 131/247 (53.04%), Query Frame = 1
Query: 1312 YFGICSRLLQLIETPGLPVLVGFTDRTDTEKHS----DESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPW---NSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSL 2031
            YF +   +  +I  P  PV++    +   +  +     +  +  ++ V E W  QL S+ +L  S++ L++ L+PW       +N    +   + +V+ +++  E   +++N       QA  +V HFQKLF+ P++ GVY RMN +Y+R  EM N + +L+++L ++    L  LV+ V  L +++N    +++      +D++ ++ +LE++E F P F+   +++L  L +  +D ++P +K L
Sbjct:  348 YFQVLCSINSIIHNPRAPVIIYKQTKGGVQNFNKDLVQDCGFEHLVPVIEMWADQLTSLKDLYKSLKTLSAELVPWLNLKKQDENEGIKVEDLLFIVDTMLEEVENKEKDSNMPHFQTLQA--IVSHFQKLFDVPSLNGVYPRMNEVYTRLGEMNNAVRNLQELLELDSSSSLCVLVSTVGKLCRLINEDVNEQVMQVLGPEDLQSIIYKLEEHEEFFPAFQAFTNDLLEILEIDDLDAIVPAVKKL 592          

HSP 2 Score: 53.9138 bits (128), Expect = 8.367e-7
Identity = 54/238 (22.69%), Postives = 113/238 (47.48%), Query Frame = 1
Query:   97 SEKNHNSLAYEKNDRLDWDKIIYNLKLNGFSGITL--KFDENDNLYFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMES-SCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTF 801
            S+ +   +  ++ +  +W+ I   L ++G   ++L  + D  D + F+K  +  +R  +  L+ E + + + I++L  +N +L++ +          E+   +L + +   K K+ E+E  S     H  N           +I  +   +++ Q+    Y   +K   EQ E I SLQ+++ +L   E+ R   QN +F  L  + P  +  LD++LL +I+ YESK+ ++ +   +
Sbjct:   12 SQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRTDLKDLIIFDKQSSQRMRQNLKLLVEETSCQQNMIQELIETNQQLRNELQLEQSRAANQEQRANDLEQIMESVKSKIGELEDESLSRACHQQN-----------KIKDLQKEQKTLQVKCQHY---KKKRTEQEETIASLQMEVCRLKKEEEDRIVTQNRVFAYLCKRVP--HTVLDRQLLCLIDYYESKIRKIHTQRQY 233          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Human
Match: CEP70 (centrosomal protein 70 [Source:HGNC Symbol;Acc:HGNC:29972])

HSP 1 Score: 102.834 bits (255), Expect = 3.333e-22
Identity = 64/247 (25.91%), Postives = 131/247 (53.04%), Query Frame = 1
Query: 1312 YFGICSRLLQLIETPGLPVLVGFTDRTDTEKHS----DESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPW---NSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSL 2031
            YF +   +  +I  P  PV++    +   +  +     +  +  ++ V E W  QL S+ +L  S++ L++ L+PW       +N    +   + +V+ +++  E   +++N       QA  +V HFQKLF+ P++ GVY RMN +Y+R  EM N + +L+++L ++    L  LV+ V  L +++N    +++      +D++ ++ +LE++E F P F+   +++L  L +  +D ++P +K L
Sbjct:  348 YFQVLCSINSIIHNPRAPVIIYKQTKGGVQNFNKDLVQDCGFEHLVPVIEMWADQLTSLKDLYKSLKTLSAELVPWLNLKKQDENEGIKVEDLLFIVDTMLEEVENKEKDSNMPHFQTLQA--IVSHFQKLFDVPSLNGVYPRMNEVYTRLGEMNNAVRNLQELLELDSSSSLCVLVSTVGKLCRLINEDVNEQVMQVLGPEDLQSIIYKLEEHEEFFPAFQAFTNDLLEILEIDDLDAIVPAVKKL 592          

HSP 2 Score: 53.9138 bits (128), Expect = 8.367e-7
Identity = 54/238 (22.69%), Postives = 113/238 (47.48%), Query Frame = 1
Query:   97 SEKNHNSLAYEKNDRLDWDKIIYNLKLNGFSGITL--KFDENDNLYFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMES-SCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTF 801
            S+ +   +  ++ +  +W+ I   L ++G   ++L  + D  D + F+K  +  +R  +  L+ E + + + I++L  +N +L++ +          E+   +L + +   K K+ E+E  S     H  N           +I  +   +++ Q+    Y   +K   EQ E I SLQ+++ +L   E+ R   QN +F  L  + P  +  LD++LL +I+ YESK+ ++ +   +
Sbjct:   12 SQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRTDLKDLIIFDKQSSQRMRQNLKLLVEETSCQQNMIQELIETNQQLRNELQLEQSRAANQEQRANDLEQIMESVKSKIGELEDESLSRACHQQN-----------KIKDLQKEQKTLQVKCQHY---KKKRTEQEETIASLQMEVCRLKKEEEDRIVTQNRVFAYLCKRVP--HTVLDRQLLCLIDYYESKIRKIHTQRQY 233          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Human
Match: CEP70 (centrosomal protein 70 [Source:HGNC Symbol;Acc:HGNC:29972])

HSP 1 Score: 102.834 bits (255), Expect = 3.544e-22
Identity = 64/247 (25.91%), Postives = 131/247 (53.04%), Query Frame = 1
Query: 1312 YFGICSRLLQLIETPGLPVLVGFTDRTDTEKHS----DESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPW---NSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSL 2031
            YF +   +  +I  P  PV++    +   +  +     +  +  ++ V E W  QL S+ +L  S++ L++ L+PW       +N    +   + +V+ +++  E   +++N       QA  +V HFQKLF+ P++ GVY RMN +Y+R  EM N + +L+++L ++    L  LV+ V  L +++N    +++      +D++ ++ +LE++E F P F+   +++L  L +  +D ++P +K L
Sbjct:  330 YFQVLCSINSIIHNPRAPVIIYKQTKGGVQNFNKDLVQDCGFEHLVPVIEMWADQLTSLKDLYKSLKTLSAELVPWLNLKKQDENEGIKVEDLLFIVDTMLEEVENKEKDSNMPHFQTLQA--IVSHFQKLFDVPSLNGVYPRMNEVYTRLGEMNNAVRNLQELLELDSSSSLCVLVSTVGKLCRLINEDVNEQVMQVLGPEDLQSIIYKLEEHEEFFPAFQAFTNDLLEILEIDDLDAIVPAVKKL 574          

HSP 2 Score: 53.9138 bits (128), Expect = 8.970e-7
Identity = 53/231 (22.94%), Postives = 111/231 (48.05%), Query Frame = 1
Query:  118 LAYEKNDRLDWDKIIYNLKLNGFSGITL--KFDENDNLYFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMES-SCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTF 801
            +  ++ +  +W+ I   L ++G   ++L  + D  D + F+K  +  +R  +  L+ E + + + I++L  +N +L++ +          E+   +L + +   K K+ E+E  S     H  N           +I  +   +++ Q+    Y   +K   EQ E I SLQ+++ +L   E+ R   QN +F  L  + P++   LD++LL +I+ YESK+ ++ +   +
Sbjct:    1 MTEKQQEEAEWESINVLLMMHGLKPLSLVKRTDLKDLIIFDKQSSQRMRQNLKLLVEETSCQQNMIQELIETNQQLRNELQLEQSRAANQEQRANDLEQIMESVKSKIGELEDESLSRACHQQN-----------KIKDLQKEQKTLQVKCQHY---KKKRTEQEETIASLQMEVCRLKKEEEDRIVTQNRVFAYLCKRVPHT--VLDRQLLCLIDYYESKIRKIHTQRQY 215          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Human
Match: CEP70 (centrosomal protein 70 [Source:HGNC Symbol;Acc:HGNC:29972])

HSP 1 Score: 77.0258 bits (188), Expect = 5.533e-14
Identity = 44/162 (27.16%), Postives = 83/162 (51.23%), Query Frame = 1
Query: 1312 YFGICSRLLQLIETPGLPVLVGFTDRTDTEKHS----DESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPW---NSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLK 1776
            YF +   +  +I  P  PV++    +   +  +     +  +  ++ V E W  QL S+ +L  S++ L++ L+PW       +N    +   + +V+ +++  E   +++N       QA  +V HFQKLF+ P++ GVY RMN +Y+R  EM N + +L+
Sbjct:  348 YFQVLCSINSIIHNPRAPVIIYKQTKGGVQNFNKDLVQDCGFEHLVPVIEMWADQLTSLKDLYKSLKTLSAELVPWLNLKKQDENEGIKVEDLLFIVDTMLEEVENKEKDSNMPHFQTLQA--IVSHFQKLFDVPSLNGVYPRMNEVYTRLGEMNNAVRNLQ 507          

HSP 2 Score: 53.9138 bits (128), Expect = 7.684e-7
Identity = 53/231 (22.94%), Postives = 110/231 (47.62%), Query Frame = 1
Query:  118 LAYEKNDRLDWDKIIYNLKLNGFSGITL--KFDENDNLYFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMES-SCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTF 801
            +  ++ +  +W+ I   L ++G   ++L  + D  D + F+K  +  +R  +  L+ E + + + I++L  +N +L++ +          E+   +L + +   K K+ E+E  S     H  N           +I  +   +++ Q+    Y   +K   EQ E I SLQ+++ +L   E+ R   QN +F  L  + P  +  LD++LL +I+ YESK+ ++ +   +
Sbjct:   19 MTEKQQEEAEWESINVLLMMHGLKPLSLVKRTDLKDLIIFDKQSSQRMRQNLKLLVEETSCQQNMIQELIETNQQLRNELQLEQSRAANQEQRANDLEQIMESVKSKIGELEDESLSRACHQQN-----------KIKDLQKEQKTLQVKCQHY---KKKRTEQEETIASLQMEVCRLKKEEEDRIVTQNRVFAYLCKRVP--HTVLDRQLLCLIDYYESKIRKIHTQRQY 233          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Zebrafish
Match: cep70 (centrosomal protein 70 [Source:ZFIN;Acc:ZDB-GENE-070705-311])

HSP 1 Score: 136.732 bits (343), Expect = 3.097e-33
Identity = 162/666 (24.32%), Postives = 312/666 (46.85%), Query Frame = 1
Query:  127 EKNDRLDWDKIIYNLKLNGFSGITLK-FDENDNL----YFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICD-------EQREEINSLQLKLSKLTSIEKARNRRQNEIFHQL--RNKAPNSYNALDKRLLDVIESYESKVLQLESHLTFFSNLGFSLPNDDAPLNMADXXXXXXASTYQSHKSELSHEYKILXXXXXXXXXXXXXXXXXXXXXXXXXXXXFESKPSLVEMKEVLNKLKEYKRLLEIHNIRPEREKSLRKSNQTFKRYEYPNSI-PDIEFLPMKTCQKYLIDFCVHLNSKSIT--------------EAFKTLADLLKMNVLYPTYFGICSRLLQLIETPGLPVLVGFTDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQI--SLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSL 2031
            E+ ++ +WD +   L+ +GF  ++     EN NL       +  A ++R ++  +L+++ ++   I++L  SN +LK  +  +     R  +    L   L   K K++++E                    +S I+  +   +  Q +     + EK C        +++++ + LQ KL      E+ R  RQ + F Q+  R+  PNS N  D+++LD+I+ YES++ QL + L  +     S  N     +  D    + +STY           K L++  QE++++ + ++E+L+ + + LK + ES+P++ E+K    +L+   R+++  N+R  +E  L+  + T    E P++    I+ L + TC++ L D C  L+ ++I                AF+    L  +  +   +      L Q +     P  + F +  D            I+   E W  QL S+S+L +++  L   LLP    + +        ++ +  I+D     ++  +++  S T    + +V HFQKLF+ P++ G+Y RM  LYS+  EM N + +L+ +L++          +EV +    V S+  +E+     S DI  ++ +L+++E F P F + + E+L TL + ++D+VLPRI+SL
Sbjct:    2 EQEEQREWDAVNRLLQHHGFKPVSFADPKENKNLAELVLLERKSASDVRLMLKTMLSDSERRQGLIQELIQSNSQLKEEVQQHQTRAARQSQRAAELENILDGVKVKVQDLE--------------------DSYISKAAQQHQQFQQLQQEKRDAEKCCQSVEQKLIQEQQQASRLQKKLQYAVREEERRATRQKQTFQQILHRSARPNSTN--DQQILDIIDLYESQMQQLRNELKLYKGEKDS-SNSQKSRSTVDKDVIDASSTY-----------KTLLKSYQEQLKESKAQREELRTEIQRLKEDLESRPTIKELKTCKQQLRRLDRIIQQSNLRSAQE--LKPQDST----EKPDTDNASIQSLDISTCRRLLTDVCKELDVQNINHLISTVNAQRNQAGSAFRLQKILYDITAVLTDHRAPLGLLRQRV-----PSNLEFNEEFDM-----------IVPSLEVWSQQLTSLSDLHHALINLQKRLLPLQPESGSTALSDSVRVEDLMLIVDTLLDETQPDDKVLRSPTRHTLESIVAHFQKLFDVPSLTGIYPRMTELYSKLGEMNNAMRNLRDLLDL----DDKAPASEVVSSVSSVLSQSGQEICSLLESSDIDSIILKLKEHEEFFPAFHSFMLELLQTLDVQTLDDVLPRIRSL 607          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Zebrafish
Match: cep70 (centrosomal protein 70 [Source:ZFIN;Acc:ZDB-GENE-070705-311])

HSP 1 Score: 134.806 bits (338), Expect = 1.429e-32
Identity = 161/660 (24.39%), Postives = 308/660 (46.67%), Query Frame = 1
Query:  145 DWDKIIYNLKLNGFSGITLK-FDENDNL----YFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICD-------EQREEINSLQLKLSKLTSIEKARNRRQNEIFHQL--RNKAPNSYNALDKRLLDVIESYESKVLQLESHLTFFSNLGFSLPNDDAPLNMADXXXXXXASTYQSHKSELSHEYKILXXXXXXXXXXXXXXXXXXXXXXXXXXXXFESKPSLVEMKEVLNKLKEYKRLLEIHNIRPEREKSLRKSNQTFKRYEYPNSI-PDIEFLPMKTCQKYLIDFCVHLNSKSIT--------------EAFKTLADLLKMNVLYPTYFGICSRLLQLIETPGLPVLVGFTDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQI--SLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSL 2031
            +WD +   L+ +GF  ++     EN NL       +  A ++R ++  +L+++ ++   I++L  SN +LK  +  +     R  +    L   L   K K++++E                    +S I+  +   +  Q +     + EK C        +++++ + LQ KL      E+ R  RQ + F Q+  R+  PNS N  D+++LD+I+ YES++ QL + L  +     S  N     +  D    + +STY           K L++  QE++++ + ++E+L+ + + LK + ES+P++ E+K    +L+   R+++  N+R  +E  L+  + T    E P++    I+ L + TC++ L D C  L+ ++I                AF+    L  +  +   +      L Q +     P  + F +  D            I+   E W  QL S+S+L +++  L   LLP    + +        ++ +  I+D     ++  +++  S T    + +V HFQKLF+ P++ G+Y RM  LYS+  EM N + +L+ +L++          +EV +    V S+  +E+     S DI  ++ +L+++E F P F + + E+L TL + ++D+VLPRI+SL
Sbjct:   15 EWDAVNRLLQHHGFKPVSFADPKENKNLAELVLLERKSASDVRLMLKTMLSDSERRQGLIQELIQSNSQLKEEVQQHQTRAARQSQRAAELENILDGVKVKVQDLE--------------------DSYISKAAQQHQQFQQLQQEKRDAEKCCQSVEQKLIQEQQQASRLQKKLQYAVREEERRATRQKQTFQQILHRSARPNSTN--DQQILDIIDLYESQMQQLRNELKLYKGEKDS-SNSQKSRSTVDKDVIDASSTY-----------KTLLKSYQEQLKESKAQREELRTEIQRLKEDLESRPTIKELKTCKQQLRRLDRIIQQSNLRSAQE--LKPQDST----EKPDTDNASIQSLDISTCRRLLTDVCKELDVQNINHLISTVNAQRNQAGSAFRLQKILYDITAVLTDHRAPLGLLRQRV-----PSNLEFNEEFDM-----------IVPSLEVWSQQLTSLSDLHHALINLQKRLLPLQPESGSTALSDSVRVEDLMLIVDTLLDETQPDDKVLRSPTRHTLESIVAHFQKLFDVPSLTGIYPRMTELYSKLGEMNNAMRNLRDLLDL----DDKAPASEVVSSVSSVLSQSGQEICSLLESSDIDSIILKLKEHEEFFPAFHSFMLELLQTLDVQTLDDVLPRIRSL 614          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Zebrafish
Match: cep70 (centrosomal protein 70 [Source:ZFIN;Acc:ZDB-GENE-070705-311])

HSP 1 Score: 96.2857 bits (238), Expect = 3.217e-20
Identity = 92/356 (25.84%), Postives = 170/356 (47.75%), Query Frame = 1
Query: 1015 FESKPSLVEMKEVLNKLKEYKRLLEIHNIRPEREKSLRKSNQTFKRYEYPNSI-PDIEFLPMKTCQKYLIDFCVHLNSKSITE--------------AFKTLADLLKMNVLYPTYFGICSRLLQLIETPGLPVLVGFTDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQI--SLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSL 2031
             ES+P++ E+K    +L+   R+++  N+R  +E  L+  + T    E P++    I+ L + TC++ L D C  L+ ++I                AF+    L  +  +   +      L Q +     P  + F +  D            I+   E W  QL S+S+L +++  L   LLP    + +        ++ +  I+D     ++  +++  S T    + +V HFQKLF+ P++ G+Y RM  LYS+  EM N + +L+ +L++          +EV +    V S+  +E+     S DI  ++ +L+++E F P F + + E+L TL + ++D+VLPRI+SL
Sbjct:  258 LESRPTIKELKTCKQQLRRLDRIIQQSNLRSAQE--LKPQDST----EKPDTDNASIQSLDISTCRRLLTDVCKELDVQNINHLISTVNAQRNQAGSAFRLQKILYDITAVLTDHRAPLGLLRQRV-----PSNLEFNEEFDM-----------IVPSLEVWSQQLTSLSDLHHALINLQKRLLPLQPESGSTALSDSVRVEDLMLIVDTLLDETQPDDKVLRSPTRHTLESIVAHFQKLFDVPSLTGIYPRMTELYSKLGEMNNAMRNLRDLLDL----DDKAPASEVVSSVSSVLSQSGQEICSLLESSDIDSIILKLKEHEEFFPAFHSFMLELLQTLDVQTLDDVLPRIRSL 587          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Mouse
Match: Cep70 (centrosomal protein 70 [Source:MGI Symbol;Acc:MGI:1915371])

HSP 1 Score: 95.5153 bits (236), Expect = 6.660e-20
Identity = 64/248 (25.81%), Postives = 133/248 (53.63%), Query Frame = 1
Query: 1309 TYFGICSRLLQLIETPGLPVLV-----GFTDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQA--KGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSL 2031
            +YF +   +  ++  P  PV++     G     + +   D   +  ++ + E WV +L S+ +L  S++ L++ L+PW+S  K +        DL+  ++D      EN  + S T      + +V HFQKLF+  ++ GV+ RMN +Y+R  EM N + +L+++L ++    L  +V+ V  L +++N    ++++     +D++ ++++LE++E F P F+   +++L  L +  +D ++P +K L
Sbjct:  366 SYFQVLCSINSIVHNPRAPVIIYKQSKGRAPNGNKDIGQD-CGFEHLVPIIEMWVDELTSLKDLYKSLKILSAELVPWHSLKKLDEKEGVKVGDLLF-MVDTMLEEVENQKETSSTPNSQTLQAIVSHFQKLFDVQSLNGVFPRMNEVYTRLGEMNNAVRNLQELLELDSSSSLCVVVSTVGKLCEIINKDVSEQVKQVLGPEDLQSIIKKLEEHEEFFPAFQAFANDLLEILEIDDLDAIVPAVKKL 611          

HSP 2 Score: 61.6178 bits (148), Expect = 2.591e-9
Identity = 66/253 (26.09%), Postives = 114/253 (45.06%), Query Frame = 1
Query:  112 NSLAYEKN-DRLDWDKIIYNLKLNGFSGITL--KFDENDNLYFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTF----------FSNLGFSLPN 831
            N L  EK  +  +W+ I   L  +GF  + L    D  D + F+K  +  +R ++  L+ E  ++   I++L  +N +LKS +          E+   +L + +   K K+ E+E        S N   +  N        +  +++  +++  +    +K   EQ   I SLQ ++ +L   E+ R   QN +F  L  + P+S   LDK+LL +I+ YE K+ +L     F          F+NLG S PN
Sbjct:   37 NRLMIEKQQEEAEWESINGLLMTHGFKPLCLVKGADLRDFIVFDKQSSQKMRQILKTLMEETTRQQSMIRELIETNQQLKSELQLEQNRAAHQEQRANDLQQIMDSVKSKIGELED------ESLNRVCQQQN-------RIKDLQKEYKMLQMKCQQYKKNRMEQEGTIASLQKEIHRLAKEEEERILTQNRVFAHLCRRVPHS--VLDKQLLCLIDYYECKLRKLHIQRQFEEDSQSEEKDFTNLGAS-PN 273          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Mouse
Match: Cep70 (centrosomal protein 70 [Source:MGI Symbol;Acc:MGI:1915371])

HSP 1 Score: 68.9366 bits (167), Expect = 1.083e-11
Identity = 45/163 (27.61%), Postives = 83/163 (50.92%), Query Frame = 1
Query: 1309 TYFGICSRLLQLIETPGLPVLV-----GFTDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQA--KGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLK 1776
            +YF +   +  ++  P  PV++     G     + +   D   +  ++ + E WV +L S+ +L  S++ L++ L+PW+S  K +        DL+  ++D      EN  + S T      + +V HFQKLF+  ++ GV+ RMN +Y+R  EM N + +L+
Sbjct:  366 SYFQVLCSINSIVHNPRAPVIIYKQSKGRAPNGNKDIGQD-CGFEHLVPIIEMWVDELTSLKDLYKSLKILSAELVPWHSLKKLDEKEGVKVGDLLF-MVDTMLEEVENQKETSSTPNSQTLQAIVSHFQKLFDVQSLNGVFPRMNEVYTRLGEMNNAVRNLQ 526          

HSP 2 Score: 61.2326 bits (147), Expect = 3.133e-9
Identity = 66/253 (26.09%), Postives = 114/253 (45.06%), Query Frame = 1
Query:  112 NSLAYEKN-DRLDWDKIIYNLKLNGFSGITL--KFDENDNLYFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTF----------FSNLGFSLPN 831
            N L  EK  +  +W+ I   L  +GF  + L    D  D + F+K  +  +R ++  L+ E  ++   I++L  +N +LKS +          E+   +L + +   K K+ E+E        S N   +  N        +  +++  +++  +    +K   EQ   I SLQ ++ +L   E+ R   QN +F  L  + P+S   LDK+LL +I+ YE K+ +L     F          F+NLG S PN
Sbjct:   37 NRLMIEKQQEEAEWESINGLLMTHGFKPLCLVKGADLRDFIVFDKQSSQKMRQILKTLMEETTRQQSMIRELIETNQQLKSELQLEQNRAAHQEQRANDLQQIMDSVKSKIGELED------ESLNRVCQQQN-------RIKDLQKEYKMLQMKCQQYKKNRMEQEGTIASLQKEIHRLAKEEEERILTQNRVFAHLCRRVPHS--VLDKQLLCLIDYYECKLRKLHIQRQFEEDSQSEEKDFTNLGAS-PN 273          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. UniProt/SwissProt
Match: sp|Q5RDE3|CEP70_PONAB (Centrosomal protein of 70 kDa OS=Pongo abelii OX=9601 GN=CEP70 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.545e-22
Identity = 66/247 (26.72%), Postives = 133/247 (53.85%), Query Frame = 1
Query: 1312 YFGICSRLLQLIETPGLPVLVGFTDRTDTEKHS----DESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNSSTKNNRCGIFGAIDL---VNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSL 2031
            YF +   +  +I  P  PV++    +   +  +     +  +  ++ V E W  QL S+ +L  S++ L++ L+PW++  K +        DL   V+ +++  E   +++N  +    QA  +V HFQKLF+ P++ GVY RMN +Y+R  EM N + +L+++L ++    L  LV+ V  L +++N    +++      +D++ ++ +LE++E F P F+   +++L  L +  +D ++P +K L
Sbjct:  348 YFQVLCSINSIIHNPRAPVIIYKQSKGGAQNFNKDLVQDCGFEHLVPVIEMWADQLTSLKDLYKSLKTLSAELVPWHNLKKQDENEGIKVEDLLFIVDTMLEEVENKEKDSNMPNFQTLQA--IVSHFQKLFDVPSLNGVYPRMNEVYTRLGEMNNAVRNLQELLELDSSSSLCVLVSTVGKLCRLINEDVNEQVMQVLGPEDLQSIIYKLEEHEEFFPAFQAFTNDLLEILEIDDLDAIVPAVKKL 592          

HSP 2 Score: 56.225 bits (134), Expect = 7.302e-7
Identity = 53/237 (22.36%), Postives = 114/237 (48.10%), Query Frame = 1
Query:   97 SEKNHNSLAYEKNDRLDWDKIIYNLKLNGFSGITL--KFDENDNLYFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTF 801
            S+ +   +  ++ +  +W+ I   L ++G   ++L  + D  D + F+K  +  +R  +  L+ E +++ + I++L  +N +L++ +          E+   +L + +   K K+ E+E      A    N          +I  +   +++ Q+    Y   +K   EQ+E I SLQ+++ +L   E+ R   QN +F  L  + P  +  LD++LL +I+ YESK+ ++ +   +
Sbjct:   12 SQASDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRTDLKDLIIFDKQSSQRMRQNLKLLVEETSRQQNMIQELIETNQQLRNELQLEQSRAANQEQRANDLEQIMESVKSKIGELEDESLNRACQQQN----------KIKDLQKEQKTLQVKCQHY---KKKRTEQQETIASLQMEVCRLRKEEEDRIVTQNRVFAYLCKRVP--HTVLDRQLLCLIDYYESKIRKIHTQRQY 233          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. UniProt/SwissProt
Match: sp|Q5PQQ9|CEP70_RAT (Centrosomal protein of 70 kDa OS=Rattus norvegicus OX=10116 GN=Cep70 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.576e-22
Identity = 66/258 (25.58%), Postives = 137/258 (53.10%), Query Frame = 1
Query: 1279 DLLKMNVLYPTYFGICSRLLQLIETPGLPVLVGFTDRTDTEKHS----DESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNSSTKNNRCGIFGAIDL---VNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSL 2031
            D+ +  ++   YF +   +  ++ +P  P ++    +   +  S     E  +  ++ V E W  +L S+ +L  S++ L++ L+PW++  K N        DL   V+ +++  E   E ++  +    QA  +V HFQKLF+  ++ GVY RMN +Y+R  EM N + +L+++L ++    L  +V+ V  L +M+N    ++++     +D++ ++ +LE++E F P F+   +++L  L +  +D ++P +K L
Sbjct:  338 DIHQQALVDQRYFQVLCSIDSIVHSPRAPGVIYKQSKERAQNRSKDAVQECGFEHLVPVIEMWADELTSLKDLYKSLKILSAELIPWHNLKKPNENEGVKVGDLLLMVDTMLEEVENQKETSSMPNSQTLQA--IVSHFQKLFDVQSLNGVYPRMNEVYARLGEMNNAVRNLQELLGLDSSSSLCMVVSTVGKLCKMINEDVSEQIKRVLGPEDLQSIINKLEEHEEFFPAFQAFTNDLLEILEIDDLDAIVPAVKKL 593          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. UniProt/SwissProt
Match: sp|Q4R7V1|CEP70_MACFA (Centrosomal protein of 70 kDa OS=Macaca fascicularis OX=9541 GN=CEP70 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.723e-22
Identity = 65/247 (26.32%), Postives = 133/247 (53.85%), Query Frame = 1
Query: 1312 YFGICSRLLQLIETPGLPVLVGFTDRTDTEKHS----DESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNSSTKNNRCGIFGAIDL---VNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSL 2031
            YF +   +  +I  P  PV++    +   +  +     +  +  ++ + E W  QL S+ +L  S++ L++ L+PW++  K +        DL   V+ +++  E   +++N  +    QA  +V HFQKLF+ P++ GVY RMN +Y+R  EM N + +L+++L ++    L  LV+ V  L +++N    +++      +D++ ++ +LE++E F P F+   +++L  L +  +D ++P +K L
Sbjct:  348 YFQVLCSINSIIHNPRAPVIIYKQSKGGAQNFNKDLIQDCGFEHLVPIIEMWADQLTSLKDLYKSLKTLSAELVPWHNLKKQDENEGIKVEDLLFIVDTMLEEVENKEKDSNMPNFQTLQA--IVSHFQKLFDVPSLNGVYPRMNEVYTRLGEMNNAVRNLQELLELDSSSSLCVLVSTVGKLCRLINEDVNEQIMQVLGPEDLQSIIYKLEEHEEFFPAFQAFTNDLLEILEIDDLDAIVPAVKKL 592          

HSP 2 Score: 55.4546 bits (132), Expect = 1.278e-6
Identity = 54/230 (23.48%), Postives = 109/230 (47.39%), Query Frame = 1
Query:  118 LAYEKNDRLDWDKIIYNLKLNGFSGITL--KFDENDNLYFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTF 801
            +  ++ +  +W+ I   L ++G   ++L  + D  D + F+K  +  +R  +  L+ E +++ + I++L  +N +L++ +          E+   +L + +   K K+ E+E      A    N  K+              +E R + V   H  +K   EQ+E I SLQ ++ +L   E+ R   QN +F  L  + P  +  LD++LL +I+ YESK+ ++ +   +
Sbjct:   19 MTEKQQEEAEWESINVLLMMHGLKPLSLVKRTDLKDLIIFDKQSSQRMRQNLKLLVEETSRQQNMIQELIETNQQLRNELQLEHSRATNQEQRANDLEQIMESVKSKIGELEDESLNRACQQQNKIKDLQ------------KEQRTLQVKCQHYKKKRT-EQQETIASLQTEVCRLRKEEEDRIVTQNRVFAYLCKRVP--HTVLDRQLLCLIDYYESKIRKIHTQRQY 233          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. UniProt/SwissProt
Match: sp|Q8NHQ1|CEP70_HUMAN (Centrosomal protein of 70 kDa OS=Homo sapiens OX=9606 GN=CEP70 PE=1 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 1.601e-21
Identity = 64/247 (25.91%), Postives = 131/247 (53.04%), Query Frame = 1
Query: 1312 YFGICSRLLQLIETPGLPVLVGFTDRTDTEKHS----DESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPW---NSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSL 2031
            YF +   +  +I  P  PV++    +   +  +     +  +  ++ V E W  QL S+ +L  S++ L++ L+PW       +N    +   + +V+ +++  E   +++N       QA  +V HFQKLF+ P++ GVY RMN +Y+R  EM N + +L+++L ++    L  LV+ V  L +++N    +++      +D++ ++ +LE++E F P F+   +++L  L +  +D ++P +K L
Sbjct:  348 YFQVLCSINSIIHNPRAPVIIYKQTKGGVQNFNKDLVQDCGFEHLVPVIEMWADQLTSLKDLYKSLKTLSAELVPWLNLKKQDENEGIKVEDLLFIVDTMLEEVENKEKDSNMPHFQTLQA--IVSHFQKLFDVPSLNGVYPRMNEVYTRLGEMNNAVRNLQELLELDSSSSLCVLVSTVGKLCRLINEDVNEQVMQVLGPEDLQSIIYKLEEHEEFFPAFQAFTNDLLEILEIDDLDAIVPAVKKL 592          

HSP 2 Score: 53.9138 bits (128), Expect = 4.018e-6
Identity = 54/238 (22.69%), Postives = 113/238 (47.48%), Query Frame = 1
Query:   97 SEKNHNSLAYEKNDRLDWDKIIYNLKLNGFSGITL--KFDENDNLYFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMES-SCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTF 801
            S+ +   +  ++ +  +W+ I   L ++G   ++L  + D  D + F+K  +  +R  +  L+ E + + + I++L  +N +L++ +          E+   +L + +   K K+ E+E  S     H  N           +I  +   +++ Q+    Y   +K   EQ E I SLQ+++ +L   E+ R   QN +F  L  + P  +  LD++LL +I+ YESK+ ++ +   +
Sbjct:   12 SQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRTDLKDLIIFDKQSSQRMRQNLKLLVEETSCQQNMIQELIETNQQLRNELQLEQSRAANQEQRANDLEQIMESVKSKIGELEDESLSRACHQQN-----------KIKDLQKEQKTLQVKCQHY---KKKRTEQEETIASLQMEVCRLKKEEEDRIVTQNRVFAYLCKRVP--HTVLDRQLLCLIDYYESKIRKIHTQRQY 233          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. UniProt/SwissProt
Match: sp|Q6IQY5|CEP70_MOUSE (Centrosomal protein of 70 kDa OS=Mus musculus OX=10090 GN=Cep70 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 4.659e-19
Identity = 64/248 (25.81%), Postives = 133/248 (53.63%), Query Frame = 1
Query: 1309 TYFGICSRLLQLIETPGLPVLV-----GFTDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQA--KGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSL 2031
            +YF +   +  ++  P  PV++     G     + +   D   +  ++ + E WV +L S+ +L  S++ L++ L+PW+S  K +        DL+  ++D      EN  + S T      + +V HFQKLF+  ++ GV+ RMN +Y+R  EM N + +L+++L ++    L  +V+ V  L +++N    ++++     +D++ ++++LE++E F P F+   +++L  L +  +D ++P +K L
Sbjct:  366 SYFQVLCSINSIVHNPRAPVIIYKQSKGRAPNGNKDIGQD-CGFEHLVPIIEMWVDELTSLKDLYKSLKILSAELVPWHSLKKLDEKEGVKVGDLLF-MVDTMLEEVENQKETSSTPNSQTLQAIVSHFQKLFDVQSLNGVFPRMNEVYTRLGEMNNAVRNLQELLELDSSSSLCVVVSTVGKLCEIINKDVSEQVKQVLGPEDLQSIIKKLEEHEEFFPAFQAFANDLLEILEIDDLDAIVPAVKKL 611          

HSP 2 Score: 61.6178 bits (148), Expect = 1.812e-8
Identity = 66/253 (26.09%), Postives = 114/253 (45.06%), Query Frame = 1
Query:  112 NSLAYEKN-DRLDWDKIIYNLKLNGFSGITL--KFDENDNLYFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTF----------FSNLGFSLPN 831
            N L  EK  +  +W+ I   L  +GF  + L    D  D + F+K  +  +R ++  L+ E  ++   I++L  +N +LKS +          E+   +L + +   K K+ E+E        S N   +  N        +  +++  +++  +    +K   EQ   I SLQ ++ +L   E+ R   QN +F  L  + P+S   LDK+LL +I+ YE K+ +L     F          F+NLG S PN
Sbjct:   37 NRLMIEKQQEEAEWESINGLLMTHGFKPLCLVKGADLRDFIVFDKQSSQKMRQILKTLMEETTRQQSMIRELIETNQQLKSELQLEQNRAAHQEQRANDLQQIMDSVKSKIGELED------ESLNRVCQQQN-------RIKDLQKEYKMLQMKCQQYKKNRMEQEGTIASLQKEIHRLAKEEEERILTQNRVFAHLCRRVPHS--VLDKQLLCLIDYYECKLRKLHIQRQFEEDSQSEEKDFTNLGAS-PN 273          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. TrEMBL
Match: A0A1S3J4K0 (centrosomal protein of 70 kDa OS=Lingula unguis OX=7574 GN=LOC106170113 PE=4 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 6.825e-51
Identity = 170/651 (26.11%), Postives = 323/651 (49.62%), Query Frame = 1
Query:  145 DWDKIIYNLKLNGFSGITL-KFDENDNL----YFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTFFSNLGFSLPNDDAPLNMADXXXXXXASTYQSHKSELSHE----YKILXXXXXXXXXXXXXXXXXXXXXXXXXXXXFESKPSLVEMKEVLNKLKEYKRLLEIHNIRPEREKSLRKSNQTFKRY----EYPNSIPDIEFLPMKTCQKYLIDFCVHLNS---KSITEAFKTLADLLKMNVLYPTYFGICSRLLQLIETPGLPVLVGFTDRTDTEKHSD---ESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNSSTKNNRCGIFGAIDLVNEIIDYCEAG-SENTNQISLTLGQA-KGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNI-EDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSL 2031
            +W+++   L+ +GF  I L    E  N+      +     +LR     L+++ +++ + ++DL  +N++LK  +   S     YE  +K+L   +   + K++++E S         +++KN+ L E        ++ ++  I  R   +E  C  Q+EE++ L  K+ ++   ++AR  RQ E+F Q R K     + +D++LLDVI++YE ++  L   L      G                          HK E + +    YK LIQ  ++++ + +K+ + L+++ E+LKLE +++P + + +    ++K+ +++L +HNI      SL    QT  +Y    +Y   I DI++LP+  C+KYL   C  L     + IT   +   + ++    +P        +L+++ +   P L  F  RT  ++      E  ++ ++   E WV +L S+ EL  SV +L++ L P+          +   I  ++ +    E G SE  +   L  G   K +VEHFQ LF+  ++ GVY RMN +YS+  E+ NV+ SL+ +L + ED +  A +V  V  L Q   S   ++++     +D+  + +RLE+++ F P F+ ++D+++  LG+S ID+V+P +++L
Sbjct:    7 EWEEVNRELRHHGFPPIHLIHPGEVGNIPGVVVLDAAMTKSLRESFLTLMSDCDRRQELVQDLILTNNQLKEDLRHQSSLSDGYENQIKDLKIMVESLQCKIQDLEGS---------HSSKNHVLEEEG----ERLKNTKTAIHIRCKQLESKCALQQEEMDRLTEKIKRMNDEDEARKMRQKEVFQQFRRKTTRPQSKIDEKLLDVIDAYEGQIFTLRKELDMLRPAG-------------------------EHKQETAFDATGNYKALIQAYEKQLRESKKKYKALEDQSEVLKLELDARPDIKDYRAAQQRIKKLEKILRMHNI------SLPGEKQTGVKYVDESKYSTQIDDIDYLPLDLCRKYLWGTCECLGVFDLRHITPKIEKQQNAVEA---FPRLEQFAKDVLKIVNSERAPKLKDFAQRTSHKREHAVWCERTWSHVLPTLEFWVQELASLRELQQSVNKLSTRLAPFTYRKLVGDAKVSQIISAIDALT--FEGGVSEEPDGTELPSGTVLKNIVEHFQNLFDVESVNGVYPRMNEIYSKLGEVHNVLRSLRDLLGLPEDAKSTA-IVDAVGKLCQQHTSTTWRQLKQLLEEEDLDSVRKRLEQHDEFFPVFQEMMDKLMDILGVSRIDQVIPAVRAL 607          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. TrEMBL
Match: A0A5A9NT29 (Centrosomal protein of 70 kDa OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti012801 PE=4 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 3.732e-40
Identity = 154/645 (23.88%), Postives = 313/645 (48.53%), Query Frame = 1
Query:  127 EKNDRLDWDKIIYNLKLNGFSGITLK-FDENDNL----YFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTFFSNLGFSLPNDDAPLNMADXXXXXXASTYQSHKSELSHEYKILXXXXXXXXXXXXXXXXXXXXXXXXXXXXFESKPSLVEMKEVLNKLKEYKRLLEIHNIRPEREKSLRKSNQTFKRYEYPNSIPDIEFLPMKTCQKYLIDFCVHLNSKSITEAFKTLADLLKMNVLYPTYFGICSRLLQLIETPGLPVLVGFTDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPW----NSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDAL-DQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSL 2031
            +++++ +WD +   L+ +GF  ++     EN NL       +  A ++R ++  +L+++ ++   I++L  SN +LK  +  +     R+ +    L   L   K K++++E S  + A   +             +  + +++ ++    R  ++E+   +++++++ LQ KL      E+ R  RQN+ F Q+  ++    +  D+++LDVI+ YES++ QL +   F  +   S  +    LN   N +        +    LS+   IL Q  QE++++ + ++E+LK + + LK + ES+P++ E+K    +L+   R ++  NI+     SL+  +     Y    SI   + L   TC++YL+D C  L  + ++     + D  K          I   +  ++     P+  G   +        +  +  I+     W  QL ++SEL  ++  L   LLPW    N++  ++   +   + +V+ ++D  E  S++    S T    + +V HFQ+LF+  ++ G+Y RMN +YS+  EM N + +L+ +L+++D    + +V +V  +  Q  N     E+     + DI  ++ +L+++E F P F + I E+L TL + ++D VLP ++SL
Sbjct:    2 DQHEQKEWDAVNRLLQHHGFKPVSFADPTENKNLAELILLERKSAADIRLMLKTMLSDSERRQGLIQELIQSNSQLKEEVQQHQMRAARHSQRAAELEGVLDGVKVKVQDLEDSYIHKASQQH-------------SQFTQLQQEKKDAERRCDSLEQELSQEKDQVSQLQKKLQYAVREEERRVARQNQAFQQIHRRSVRPNSTTDQQILDVIDVYESQIQQLRNETNFILSCRMSKSSSGDALNSQKNKSREEKDPTDT----LSNYKTILKQSYQEQLKETKAQREELKTEIQKLKADLESRPTVKELKTCKQQLRRMDRFIQQSNIKS----SLKTQDSAETLYTDSYSI---QHLDASTCKRYLMDVCSELKIQDVSRLIPVVKDRCKTAESVSGLQKILRDITGVLTNQRAPL--GLLRQ--------QGEFELIVSTLAVWSQQLNALSELHRALCILQKRLLPWQPGANTTASSDSIRVEDLMLIVDTLLD--ETTSDDKVLRSPTRHTLESMVGHFQQLFDVSSLTGIYPRMNEVYSKLGEMNNAMRNLRDVLDLDDRAPPSEVVNKVAGIVSQTSNKASNHELYKLLETSDIDSIIIKLKEHEEFFPAFHSFILELLETLDVQNLDNVLPTLRSL 610          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. TrEMBL
Match: A0A433TW29 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_006490 PE=4 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.762e-37
Identity = 145/650 (22.31%), Postives = 297/650 (45.69%), Query Frame = 1
Query:  148 WDKIIYNLKLNGFSGITL----KFDENDNLY--FNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVS----AVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTFFSNLGFSL-PNDDAPLNMADXXXXXXASTY----QSHKSELSHEYKILXXXXXXXXXXXXXXXXXXXXXXXXXXXXFESKPSLVEMKEVLNKLKEYKRLLEIHNIRPEREKSLRKSNQTFKRYEYPNSIPDIEFLPMKTCQKYLIDFCVHLNSKSITEAFKTLADLLKMNVLYPTYFGICSRLLQLIETPGLPVLVGFTDRTDTEKHSDES-------RYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSL 2031
            W  +   L+  G S I +    + D N   Y   + + + +LR  +  L+ +   K   I+DL   N KL  L           E+ +  L E+   A  K K+++   + +        +  ++  S   S S     +  ++Q +  R   +E   D Q +EI  L+ ++      ++ R++RQNE+F   + +A  S++A D++LLD+I+SYE+++  L   +   S+      P ++   N++++ +  +++ +    QS++ +L  + KI+     E+    Q                 E +P + + + +  ++K+ +R+L +HNI    EK+ +   +  K++     + D+++LP++ C +YL + C  L   ++      + +L         Y   C  L +++E  G+   +    R    + + E+       RY   ++V  +W   +C + +L  ++  L    +PW  +       +   ++L+  +    ++    T    ++    + LV HFQ LF+ P I GV  RMN +Y    E++NV  +LK  L + +    + LV  V  +    NS   K+++     DD+  ++ RL+++  F P F+ ++ ++ H LG+S +DEV+P +++L
Sbjct:   40 WMTVNRKLRKQGLSSIRILPSQEVDCNSGRYVCLDLDSSFSLRAALISLIKDVATKETVIEDL---NRKLTDL-----------EDEISELRETSAHATSKAKDLKVMLECSRARVQELEEQSSVMSSAPRSGSDEMERLRNTKQAMGKRCRQLEAKVDHQEKEIERLKREVFAFAQEDERRSKRQNEVFSGFKKRASKSHSATDQKLLDIIDSYENQIQGLRKQIASKSSSTSDTSPQEER--NVSNSYSGPHSNNFKAIMQSYEKQLKEKEKIIQNLECEKNMVNQN---------------LELRPEVWDYRVLAQRVKKLERVLALHNISVPGEKAAKDPFRAHKKF--STRLDDLDYLPLEHCHQYLKEVCCELQIDNLDCMLDVIQELKVEGSKSDRYVEYCRELSEIVE--GMDEQLQHRSRFYRRERNVETVLCDSNMRY--YLNVVSNWRQDICCLDDLQRAINSLLDRTVPWVRAHMETDHSVADMVELLERVTHSDKSPYPKTVMEEVSRSTLEELVSHFQVLFDSPRISGVLPRMNEVYRVLGELRNVQNTLKCQLGLPEDAHSSALVDAVGKICHTHNSTTAKQLKRLLQCDDLNGVIRRLDEHTEFFPAFQCIMHKLFHILGVSRMDEVIPAVRAL 652          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. TrEMBL
Match: A0A5N5K9F1 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00149010 PE=4 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 2.254e-37
Identity = 157/651 (24.12%), Postives = 279/651 (42.86%), Query Frame = 1
Query:  127 EKNDRLDWDKIIYNLKLNGFSGITLK-FDENDNL----YFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTFFSNLGFSLPNDDAPLNMADXXXXXXASTYQ-------SHKSELSHEYKILXXXXXXXXXXXXXXXXXXXXXXXXXXXXFESKPSLVEMKEVLNKLKEYKRLLEIHNIRPEREKSLRKSNQTFKRYEYPNSIPDIEFLPMKTCQKYLIDFCVHLNSKSITEAFKTLADLLKMNVLYPTYFGICSRLLQLIETPGLPVLVGFTDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPW---NSSTKNNRC-GIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSL 2031
            EK ++++WD +   L+ +GF  +      EN NL       K  +  LR ++  +L ++ ++   I++L  SN KLK  +        R     + L   L   K K++ +E S               N +  +   +  +++ R+    R   +++   EQ  ++  LQ KL      E+ R  RQ + F Q  +++   ++  D+ +LDVI  YES++ QL+  L                            S+YQ       + + +L  E + L Q                           +S+PS+ E+K    +L+  +RL++  + R         S QT    + P+S  D +   +   Q+Y+ + C  L  + ++     +    +          I   +  ++  P  P+      R D    S+      I+   E W  QL ++ +L  SV +L   LLPW   + +   + C  +   + +V+ ++D  E   ++    S T    + +V HFQKLF+ P + GVY RMN +Y+R AEM N + +L+ IL+++D R     V    A         Q   E  G SD   I+V +L+++E F P F +L+ E+L+TLG  S+D++LPR+++L
Sbjct:    2 EKQEQMEWDAVNRLLQHHGFKPVRFADPTENKNLADLVLLEKTSSSELRVMLKTMLTDSERRQALIQELIQSNSKLKQEVEQQQARALRQSHRAEELEGVLAGVKVKVQGLEDSI-------------INKAAQQQGQLQQLQQDRRDAEMRCQALQQQLGEQVSQVCELQKKLHLAAKEEERRASRQKQAFQQFLSRSARLHSPSDQLILDVISVYESQLQQLQDKL----------------------KKCRRCSSYQEQLKKTKAQREDLQSEIQRLRQD-------------------------LDSRPSVKELKWCRQQLRRMERLVQHTSFR---------SVQTETPEDPPSSSTDTQPR-VPESQRYITEICSELKLQDVSHVVAAVKARCREADSALRLEKILCDITAILTNPRAPL--ALLRRPDAAAGSE---LEHIVPTLEMWSQQLSALPDLQRSVSRLAKRLLPWQPEDGACPQSECVKVEDVMLVVDTLLD--ETAPDDKVLRSPTKPTLQAMVSHFQKLFDVPGLRGVYPRMNEVYTRLAEMNNAMRNLRDILDMDD-RAPPSDVVNTVARITTRGGSYQNPHELLGTSDIDSIIV-KLKEHEEFFPAFHSLVLELLNTLGAESLDDILPRVRTL 573          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. TrEMBL
Match: A0A3B4CWU8 (Centrosomal protein 70 OS=Pygocentrus nattereri OX=42514 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 2.616e-37
Identity = 161/657 (24.51%), Postives = 307/657 (46.73%), Query Frame = 1
Query:  127 EKNDRLDWDKIIYNLKLNGFSGITLK-FDENDNL----YFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICD-------EQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTFFSNLGFSLPNDDAPLNMADXXXXXXASTYQSHKSELSHEYKILXXXXXXXXXXXXXXXXXXXXXXXXXXXXFESKPSLVEMKEVLNKLKEYKRLLEIHNIRPEREKSLRKSNQTFKRYEYPNSIPDIEFLPMKTCQKYLIDFCVHLNSKSITEAFKTLADLLKMNVLYPTYFGICSRLLQLIETPGLPV--LVGFTDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNS----STKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSLLECS 2043
            EK ++++WD +   L+ +GF  +      EN NL       +  A  +R ++  +L ++ ++   I++L  SN +LK  +        R     + L + L   K K++ +E                       I+  +      Q +       EK C        EQ+  ++ LQ KLS     E+ R  RQN+ F Q++N++  +++  D+ +LDVI+ YES++ QL + L        S  ND +     D T  + ++   S+       YK L++  QE++ + + ++E+LK + + LK + ES+P+  E+K    +L+   R+++  + +P ++  L     T    E   SI          CQ+YL + C  L  + ++     +    +      T   + + +  ++ +P  P+  L    D     ++S + +   I+   E W  QL S+ +L  S+ +L   LLPW       ++++   +  A+ LV+ ++D  E   ++    S T    + +V HFQKLF+ P++ GVY RMN +YSR  EM N + +L+ +L+++D    + +V  V  +     +   ++++    + DI  ++ +L+++E F P F +L+ E+L  L   S+D++LP ++SL   S
Sbjct:    2 EKQEQMEWDAVNRLLQHHGFKPVRFADPTENKNLADLVLLERTSAAEMRNMLKTMLADSERRQALIQELIQSNSQLKVEVEQQQARAARQSRRAEELEDVLASVKVKVQGLEDCF--------------------ISKAAQQHSHLQQLQQEKQEAEKRCQALLQQLSEQKVLVSDLQRKLSYAVKEEERRVTRQNQAFQQIQNRSARAHSPSDQLILDVIDVYESQLQQLRAKLKSCQK-NSSRENDSSDSLTTDKTGTDISALASSN-------YKALLKSYQEQLRRTKAQREELKNEIQRLKQDLESRPTAKELKSCKQQLRRMDRIIQQSSTKPAQKVRLEDFAGTTG-TESHQSI---------HCQRYLEEICSELKVQDMSHVVSAVKARCREADSAITLEKVINDITAVLTSPRAPLGLLKQPADGHGFRENSQQGQLELIVPTLEFWSQQLSSLPDLHRSLGRLVKRLLPWQPEDRVDSQSDSVKVEDAMLLVDMLLD--ETSPDDKILRSPTKHTLEAMVSHFQKLFDAPHLNGVYPRMNEVYSRLGEMTNAMRNLRDVLDMDDRAPPSEVVNTVARIVSPPGAFSGQDLQDLLGTSDIDSIIVKLKEHEEFFPAFHSLVLELLQVLDAVSLDDILPTVRSLKSAS 618          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Cavefish
Match: cep70 (centrosomal protein 70 [Source:NCBI gene;Acc:103028237])

HSP 1 Score: 147.517 bits (371), Expect = 7.157e-37
Identity = 170/656 (25.91%), Postives = 308/656 (46.95%), Query Frame = 1
Query:  127 EKNDRLDWDKIIYNLKLNGFSGITLK-FDENDNLY----FNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTFFSNLGFSLPNDDAPLNMADXXXXXXASTYQSHKSELSHEYKILXXXXXXXXXXXXXXXXXXXXXXXXXXXXFESKPSLVEMKEVLNKLKEYKRLLEIHNIRPEREKSLRKSNQTFKRYEYPNSIPDIEFLPMKTCQKYLIDFCVHLNSKSITEAFKTLADLLKMNVLYPTYFGICSRLLQLIETPGLP--VLVGFTDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNS----STKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQ---KEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSLLECSRIN 2052
            EK ++ DWD +   L+ +GF  +      EN NL       +  +  +R ++  +L ++ ++   I++L  SN +LK  +        R  +  + L   L   K K++ +E S    A   +++ +     +        VEE R         +++   EQ+E ++ LQ KL      E+ R  RQN+ F Q+  ++  ++N  D+ +LDVI  YES++ QL   L   S    SL  +++P    D+   + + T  S  +  S  YK L++  QE++ K + ++E LK + + LK + +S+P++ E+K    +L++  ++++  NI P          QT    E P      E       Q+YL + C  L  + ++     +    K          I + +  ++  P  P  +L    D      HS + +   I+   E W  QL  + +L  SV +L   LLPW       T+++   +   + +V  ++D  E   ++    S T    + +V HFQKLF+ P++ GVY RMN +Y++  EM N + +L+ IL   D+ G A     V+ + ++V+S      +E+     ++DI  ++ +L+ +E F P F +LI ++L  L   S+D+VLP ++SL  C++ N
Sbjct:    3 EKQEQTDWDAVNRMLQHHGFKPVRFADPTENKNLADLVLLERTSSAEMRNMLKTMLTDSERRQALIQELIQSNSQLKEEVEQQQVRAARQSQRAEELEGVLASVKVKVQGLEDSFVSKAAQQHSSLQQLQQDKR-------VEEKR------CQTLQQQLSEQKELVSDLQEKLYYAVKEEERRVARQNQAFQQILKRSNRTHNPSDQLILDVIGVYESQMQQLRDKLK--SGQRNSLCGNESP----DSQTTDKSGTDISALA--SSNYKALLKSYQEQLRKTKAQREDLKNEIQRLKKDLDSRPTVKELKSCKQQLRQMDKIIQQSNIWPA---------QTLG-TEEPIGSSSTENQQNIQNQRYLKEICSELKVQDVSHVVSAVKTRCKEADSAIKLEKIINDMAAVLTNPRAPLGLLRQPADGHGLRDHSQQGQLELIVPTLEFWSQQLSFLPDLHRSVAKLVKRLLPWQPEDRVGTRSDTVKVEDVMLMVEMVLD--ETCPDDKILRSPTKHTLESMVSHFQKLFDAPSLSGVYPRMNEVYTKLGEMNNAMRNLRDIL---DMDGKAPPSEVVNMVARVVSSTAALSNQELHDLLGTNDIDNIIMKLKDHEEFFPAFHSLILDLLDLLDAESLDDVLPIVRSLKSCNQQN 622          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Cavefish
Match: cep70 (centrosomal protein 70 [Source:NCBI gene;Acc:103028237])

HSP 1 Score: 144.05 bits (362), Expect = 1.076e-35
Identity = 159/627 (25.36%), Postives = 289/627 (46.09%), Query Frame = 1
Query:  127 EKNDRLDWDKIIYNLKLNGFSGITLK-FDENDNLY----FNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTFFSNLGFSLPNDDAPLNMADXXXXXXASTYQSHKSELSHEYKILXXXXXXXXXXXXXXXXXXXXXXXXXXXXFESKPSLVEMKEVLNKLKEYKRLLEIHNIRPEREKSLRKSNQTFKRYEYPNSIPDIEFLPMKTCQKYLIDFCVHLNSKSITEAFKTLADLLKMNVLYPTYFGICSRLLQLIETPGLP--VLVGFTDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNS----STKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQ---KEMEHFGFSDDIKILVERLEKYETFIPEFENLI 1965
            EK ++ DWD +   L+ +GF  +      EN NL       +  +  +R ++  +L ++ ++   I++L  SN +LK  +        R  +  + L   L   K K++ +E S    A   +++ +     +        VEE R         +++   EQ+E ++ LQ KL      E+ R  RQN+ F Q+  ++  ++N  D+ +LDVI  YES++ QL   L   S    SL  +++P    D+   + + T  S  +  S  YK L++  QE++ K + ++E LK + + LK + +S+P++ E+K    +L++  ++++  NI P          QT    E P      E       Q+YL + C  L  + ++     +    K          I + +  ++  P  P  +L    D      HS + +   I+   E W  QL  + +L  SV +L   LLPW       T+++   +   + +V  ++D  E   ++    S T    + +V HFQKLF+ P++ GVY RMN +Y++  EM N + +L+ IL   D+ G A     V+ + ++V+S      +E+     ++DI  ++ +L+ +E F P F +LI
Sbjct:    3 EKQEQTDWDAVNRMLQHHGFKPVRFADPTENKNLADLVLLERTSSAEMRNMLKTMLTDSERRQALIQELIQSNSQLKEEVEQQQVRAARQSQRAEELEGVLASVKVKVQGLEDSFVSKAAQQHSSLQQLQQDKR-------VEEKR------CQTLQQQLSEQKELVSDLQEKLYYAVKEEERRVARQNQAFQQILKRSNRTHNPSDQLILDVIGVYESQMQQLRDKLK--SGQRNSLCGNESP----DSQTTDKSGTDISALA--SSNYKALLKSYQEQLRKTKAQREDLKNEIQRLKKDLDSRPTVKELKSCKQQLRQMDKIIQQSNIWPA---------QTLG-TEEPIGSSSTENQQNIQNQRYLKEICSELKVQDVSHVVSAVKTRCKEADSAIKLEKIINDMAAVLTNPRAPLGLLRQPADGHGLRDHSQQGQLELIVPTLEFWSQQLSFLPDLHRSVAKLVKRLLPWQPEDRVGTRSDTVKVEDVMLMVEMVLD--ETCPDDKILRSPTKHTLESMVSHFQKLFDAPSLSGVYPRMNEVYTKLGEMNNAMRNLRDIL---DMDGKAPPSEVVNMVARVVSSTAALSNQELHDLLGTNDIDNIIMKLKDHEEFFPAFHSLI 593          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Cavefish
Match: cep70 (centrosomal protein 70 [Source:NCBI gene;Acc:103028237])

HSP 1 Score: 140.969 bits (354), Expect = 1.315e-34
Identity = 157/626 (25.08%), Postives = 288/626 (46.01%), Query Frame = 1
Query:  130 KNDRLDWDKIIYNLKLNGFSGITLK-FDENDNL----YFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTFFSNLGFSLPNDDAPLNMADXXXXXXASTYQSHKSELSHEYKILXXXXXXXXXXXXXXXXXXXXXXXXXXXXFESKPSLVEMKEVLNKLKEYKRLLEIHNIRPEREKSLRKSNQTFKRYEYPNSIPDIEFLPMKTCQKYLIDFCVHLNSKSITEAFKTLADLLKMNVLYPTYFGICSRLLQLIETPGLP--VLVGFTDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNS----STKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQ---KEMEHFGFSDDIKILVERLEKYETFIPEFENLI 1965
            + ++ DWD +   L+ +GF  +      EN NL       +  +  +R ++  +L ++ ++   I++L  SN +LK  +        R  +  + L   L   K K++ +E S    A   +++ +     +        VEE R         +++   EQ+E ++ LQ KL      E+ R  RQN+ F Q+  ++  ++N  D+ +LDVI  YES++ QL   L   S    SL  +++P    D+   + + T  S  +  S  YK L++  QE++ K + ++E LK + + LK + +S+P++ E+K    +L++  ++++  NI P          QT    E P      E       Q+YL + C  L  + ++     +    K          I + +  ++  P  P  +L    D      HS + +   I+   E W  QL  + +L  SV +L   LLPW       T+++   +   + +V  ++D  E   ++    S T    + +V HFQKLF+ P++ GVY RMN +Y++  EM N + +L+ IL   D+ G A     V+ + ++V+S      +E+     ++DI  ++ +L+ +E F P F +LI
Sbjct:   27 QQEQTDWDAVNRMLQHHGFKPVRFADPTENKNLADLVLLERTSSAEMRNMLKTMLTDSERRQALIQELIQSNSQLKEEVEQQQVRAARQSQRAEELEGVLASVKVKVQGLEDSFVSKAAQQHSSLQQLQQDKR-------VEEKR------CQTLQQQLSEQKELVSDLQEKLYYAVKEEERRVARQNQAFQQILKRSNRTHNPSDQLILDVIGVYESQMQQLRDKLK--SGQRNSLCGNESP----DSQTTDKSGTDISALA--SSNYKALLKSYQEQLRKTKAQREDLKNEIQRLKKDLDSRPTVKELKSCKQQLRQMDKIIQQSNIWPA---------QTLG-TEEPIGSSSTENQQNIQNQRYLKEICSELKVQDVSHVVSAVKTRCKEADSAIKLEKIINDMAAVLTNPRAPLGLLRQPADGHGLRDHSQQGQLELIVPTLEFWSQQLSFLPDLHRSVAKLVKRLLPWQPEDRVGTRSDTVKVEDVMLMVEMVLD--ETCPDDKILRSPTKHTLESMVSHFQKLFDAPSLSGVYPRMNEVYTKLGEMNNAMRNLRDIL---DMDGKAPPSEVVNMVARVVSSTAALSNQELHDLLGTNDIDNIIMKLKDHEEFFPAFHSLI 616          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Nematostella
Match: EDO37412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFU5])

HSP 1 Score: 81.2629 bits (199), Expect = 6.192e-16
Identity = 66/279 (23.66%), Postives = 121/279 (43.37%), Query Frame = 1
Query: 1192 PMKTCQKYLIDFCVHLNSKSITEAFKTLADLLKMNVLYPTYFGICSRLLQLIETPGLPVLVG--FTDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNSST--KNNRCGIFGAIDLVNEIIDYCEAG-----SENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAE-VDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSS 1998
            P K       + C  L    + +    L  +  M   YP+   + S +L L +  G  V+     +   D+     +  +  I+     W  +L  + +L  +V+ L   L+PW      + +        DL   I      G     SE       +  Q + +V HFQKLF+  ++ GV+ RMN LY R  E+ N + +++++LN++      C  ++ V+A+ ++  ++      H    DD+  L++RLE+Y+ F P F+ ++ E+   L   S
Sbjct:  566 PSKMATTKQNEVCSRLEVTDLKQLTDRLDSIDVMAEAYPSMEKLISDILSLTQEKGALVVSAEDMSQSVDSHALYCQRAWQNILPTLRLWHKELKHMKDLQTAVDHLAVSLMPWKPDNMFRADDRKPLRMRDLRARIESLAYQGTRALPSELRGSDKPSAEQLQSIVAHFQKLFDVTSVSGVFPRMNELYLRVGEVYNAMNTMRELLNLDP----CCKASDVVNAVGKLSKAR------HLLKVDDLPGLIQRLEQYDEFFPAFQEMVTELCRLLKTGS 834          

HSP 2 Score: 55.4546 bits (132), Expect = 7.462e-8
Identity = 45/244 (18.44%), Postives = 110/244 (45.08%), Query Frame = 1
Query:  145 DWDKIIYNLKLNGFSGITLKFDEN------DNLYFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKR---------------------LLDVIESYESKVLQLESHL 795
            DW ++   L+ +GF  + +   ++        +   ++ + +LR+ +  L+++ +++   +++L S++++L+    +N+  I  YE  ++ L + L   + K++E E       H      ++  L + E+  +             Y  ME+   ++ EE + LQ +   L   E+ R  RQ  +F   +N++P   + +D+                      +LD+++SYE+++ +L+  +
Sbjct:   38 DWSEVNRQLRHHGFHAVMVLPRQHISEIPAGAVILEEHTSQHLRHTLESLMSDCDRRQALVQELISASNRLQKDNKENAEIIYSYETEIRGLEQQLETERIKVQEYEDRHMSELHRHGEEVQDLQLGKDEVAVM-------------YKQMEQKLQKKDEETSRLQKRCHDLVHKEEERLERQRLMFKHFKNRSPRKQSDVDQSENGLLGHLKIVLGQSEWLFYWILDIVDSYEAQIDELKEEM 268          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Medaka
Match: cep70 (centrosomal protein 70 [Source:NCBI gene;Acc:101171643])

HSP 1 Score: 94.3597 bits (233), Expect = 8.741e-20
Identity = 48/125 (38.40%), Postives = 78/125 (62.40%), Query Frame = 1
Query: 1657 GLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSL 2031
             +V HFQKLF+ P++ GVY RMN +Y+R AEM N + +LK  L+++     A +V  V AL     S  +  +E      DI  ++ ++++++ F+P F  LI +IL TLG++ ++E+LP +KSL
Sbjct:  414 AIVSHFQKLFDVPSLRGVYPRMNEVYTRLAEMTNAMRNLKDALDLDGRASPAEVVNHVSALASAQQSGLRDLLEEA----DIDSVILKVKQHDEFLPAFHRLITDILQTLGVTHLEEILPALKSL 534          

HSP 2 Score: 52.7582 bits (125), Expect = 8.804e-7
Identity = 47/218 (21.56%), Postives = 95/218 (43.58%), Query Frame = 1
Query:  145 DWDKIIYNLKLNGFSGITLKFD-ENDNLY----FNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQL 783
            +W+ +   L+  GF  +      EN N       ++  A  LR  +  LL +++++   +++L  SN++L+  + +      ++ +    L   L + K K++++E  C   A  T++         +E              + R   +++    + EE   L+ KL      E+ R  R+N  F ++  K      A D+R+LDVI+ YE++  +L
Sbjct:    8 EWEPLNRLLQQRGFRPVLFADPVENKNPAELGLLDRKSAAALRRTLETLLADSDRRQALLQELVGSNNRLREEVQEQMSRAAQHSQRASELQALLDQVKVKVQDLEDRCICRAAQTHSRTLQLQRHSAEA-------------IRRCEQLQQKLRRKEEEAAKLRWKLRFAVEQEERRLARRNRSFQEICGKTSRLQTAADQRVLDVIDFYEAERRRL 212          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Planmine SMEST
Match: SMESG000052033.1 (SMESG000052033.1)

HSP 1 Score: 1283.47 bits (3320), Expect = 0.000e+0
Identity = 670/675 (99.26%), Postives = 673/675 (99.70%), Query Frame = 1
Query:   31 MSFENDSEYNSISNSTHTINHFSEKNHNSLAYEKNDRLDWDKIIYNLKLNGFSGITLKFDENDNLYFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTFFSNLGFSLPNDDAPLNMADXXXXXXASTYQSHKSELSHEYKILXXXXXXXXXXXXXXXXXXXXXXXXXXXXFESKPSLVEMKEVLNKLKEYKRLLEIHNIRPEREKSLRKSNQTFKRYEYPNSIPDIEFLPMKTCQKYLIDFCVHLNSKSITEAFKTLADLLKMNVLYPTYFGICSRLLQLIETPGLPVLVGFTDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSLLECSRINQ 2055
            MSFENDSEYNSISNSTHTINHFSEKNHNSLAYEKNDRLDWDKIIYNLKLNGFSGITLKFDENDNLYFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFI RYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTFFSNLGFSLPNDDAPL+MADNTNNNNASTYQSHKSELSHEYKILIQKLQEEIEKVQKEKEKLKEKYEILKLEFESKPSLVEMKEVLNKLKEYKRLLEIHNIRPEREKSLRKSNQTFKRYEYPNSIPDIEFLPMKTCQKYLIDFCVHLNSKSITEAFKTL+DLLKMNVLYPTYFGICSRLLQLIETPGLP+LV FTDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSLLECSRINQ
Sbjct:    1 MSFENDSEYNSISNSTHTINHFSEKNHNSLAYEKNDRLDWDKIIYNLKLNGFSGITLKFDENDNLYFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFINRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTFFSNLGFSLPNDDAPLSMADNTNNNNASTYQSHKSELSHEYKILIQKLQEEIEKVQKEKEKLKEKYEILKLEFESKPSLVEMKEVLNKLKEYKRLLEIHNIRPEREKSLRKSNQTFKRYEYPNSIPDIEFLPMKTCQKYLIDFCVHLNSKSITEAFKTLSDLLKMNVLYPTYFGICSRLLQLIETPGLPILVDFTDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLGLSSIDEVLPRIKSLLECSRINQ 675          
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Planmine SMEST
Match: SMESG000052033.1 (SMESG000052033.1)

HSP 1 Score: 1241.1 bits (3210), Expect = 0.000e+0
Identity = 647/653 (99.08%), Postives = 650/653 (99.54%), Query Frame = 1
Query:   31 MSFENDSEYNSISNSTHTINHFSEKNHNSLAYEKNDRLDWDKIIYNLKLNGFSGITLKFDENDNLYFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTFFSNLGFSLPNDDAPLNMADXXXXXXASTYQSHKSELSHEYKILXXXXXXXXXXXXXXXXXXXXXXXXXXXXFESKPSLVEMKEVLNKLKEYKRLLEIHNIRPEREKSLRKSNQTFKRYEYPNSIPDIEFLPMKTCQKYLIDFCVHLNSKSITEAFKTLADLLKMNVLYPTYFGICSRLLQLIETPGLPVLVGFTDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLG 1989
            MSFENDSEYNSISNSTHTINHFSEKNHNSLAYEKNDRLDWDKIIYNLKLNGFSGITLKFDENDNLYFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFI RYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTFFSNLGFSLPNDDAPL+MADNTNNNNASTYQSHKSELSHEYKILIQKLQEEIEKVQKEKEKLKEKYEILKLEFESKPSLVEMKEVLNKLKEYKRLLEIHNIRPEREKSLRKSNQTFKRYEYPNSIPDIEFLPMKTCQKYLIDFCVHLNSKSITEAFKTL+DLLKMNVLYPTYFGICSRLLQLIETPGLP+LV FTDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTL 
Sbjct:    1 MSFENDSEYNSISNSTHTINHFSEKNHNSLAYEKNDRLDWDKIIYNLKLNGFSGITLKFDENDNLYFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSNDKLKSLMNDNSFFINRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTNNTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLKLSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQLESHLTFFSNLGFSLPNDDAPLSMADNTNNNNASTYQSHKSELSHEYKILIQKLQEEIEKVQKEKEKLKEKYEILKLEFESKPSLVEMKEVLNKLKEYKRLLEIHNIRPEREKSLRKSNQTFKRYEYPNSIPDIEFLPMKTCQKYLIDFCVHLNSKSITEAFKTLSDLLKMNVLYPTYFGICSRLLQLIETPGLPILVDFTDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWNSSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQKLFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEVDALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILHTLA 653          
The following BLAST results are available for this feature:
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CEP701.607e-2225.91centrosomal protein 70 [Source:HGNC Symbol;Acc:HGN... [more]
CEP703.333e-2225.91centrosomal protein 70 [Source:HGNC Symbol;Acc:HGN... [more]
CEP703.333e-2225.91centrosomal protein 70 [Source:HGNC Symbol;Acc:HGN... [more]
CEP703.544e-2225.91centrosomal protein 70 [Source:HGNC Symbol;Acc:HGN... [more]
CEP705.533e-1427.16centrosomal protein 70 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cep703.097e-3324.32centrosomal protein 70 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
cep701.429e-3224.39centrosomal protein 70 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
cep703.217e-2025.84centrosomal protein 70 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cep706.660e-2025.81centrosomal protein 70 [Source:MGI Symbol;Acc:MGI:... [more]
Cep701.083e-1127.61centrosomal protein 70 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RDE3|CEP70_PONAB2.545e-2226.72Centrosomal protein of 70 kDa OS=Pongo abelii OX=9... [more]
sp|Q5PQQ9|CEP70_RAT3.576e-2225.58Centrosomal protein of 70 kDa OS=Rattus norvegicus... [more]
sp|Q4R7V1|CEP70_MACFA3.723e-2226.32Centrosomal protein of 70 kDa OS=Macaca fascicular... [more]
sp|Q8NHQ1|CEP70_HUMAN1.601e-2125.91Centrosomal protein of 70 kDa OS=Homo sapiens OX=9... [more]
sp|Q6IQY5|CEP70_MOUSE4.659e-1925.81Centrosomal protein of 70 kDa OS=Mus musculus OX=1... [more]
back to top
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3J4K06.825e-5126.11centrosomal protein of 70 kDa OS=Lingula unguis OX... [more]
A0A5A9NT293.732e-4023.88Centrosomal protein of 70 kDa OS=Triplophysa tibet... [more]
A0A433TW291.762e-3722.31Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A5N5K9F12.254e-3724.12Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A3B4CWU82.616e-3724.51Centrosomal protein 70 OS=Pygocentrus nattereri OX... [more]
back to top
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cep707.157e-3725.91centrosomal protein 70 [Source:NCBI gene;Acc:10302... [more]
cep701.076e-3525.36centrosomal protein 70 [Source:NCBI gene;Acc:10302... [more]
cep701.315e-3425.08centrosomal protein 70 [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO374126.192e-1623.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cep708.741e-2038.40centrosomal protein 70 [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of centrosomal protein of 70 kDa-like isoform X4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000052033.10.000e+099.26SMESG000052033.1[more]
SMESG000052033.10.000e+099.08SMESG000052033.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004697 ID=SMED30004697|Name=centrosomal protein of 70 kDa-like isoform X4|organism=Schmidtea mediterranea sexual|type=transcript|length=2092bp
ATAGTTAAATTTTAAAGCAGTTGAACAAAAATGTCATTTGAAAACGATTC
GGAATATAATTCCATATCAAATTCTACTCATACTATTAATCATTTTTCAG
AAAAAAATCATAATTCATTGGCTTATGAAAAAAATGACAGGCTAGATTGG
GATAAGATAATTTATAATTTAAAGCTAAATGGCTTCAGTGGGATTACATT
GAAATTTGATGAAAACGATAATTTGTACTTCAACAAAAACGATGCCATCA
ATTTGCGATATTTGATATTTGATTTATTAAATGAAAACAACAAAAAGCAT
GACACAATCAAAGATTTATGGTCTTCAAATGACAAATTGAAATCTTTGAT
GAATGATAATTCATTTTTTATCAAGCGCTATGAGGAAATGGTTAAAAATC
TTAATGAAAGTTTATTAGAAGCCAAGCAGAAATTAAAGGAAATGGAAAGT
TCGTGTCAATATAATGCCCATTCAACGAACAACACGAACAAGAACTACAA
CTTGTCTGAATCAGAAATAACAAGCGTGAGTGCAGTAGAGGAATCGAGAC
AGATAATAGTTAGTAGATATCATAATATGGAAAAAATATGCGATGAACAA
AGAGAAGAAATAAATTCACTGCAGTTGAAATTATCAAAGCTAACATCTAT
AGAAAAGGCAAGAAATAGAAGGCAAAATGAAATTTTTCATCAGTTGCGGA
ATAAAGCTCCTAACTCGTATAATGCATTAGATAAAAGGCTTCTGGATGTG
ATAGAGAGTTATGAAAGTAAAGTTTTGCAGTTAGAGAGTCATTTAACATT
TTTCTCTAATCTCGGGTTTTCATTACCGAATGATGATGCCCCATTAAACA
TGGCCGATAATACTAACAACAATAATGCATCGACCTATCAGTCGCACAAA
TCGGAATTATCACATGAATATAAAATATTAATTCAGAAATTACAAGAAGA
AATCGAAAAGGTACAGAAAGAAAAAGAGAAACTAAAGGAGAAATATGAAA
TACTAAAGTTGGAATTCGAAAGCAAGCCTTCTCTAGTGGAAATGAAAGAG
GTATTGAATAAATTAAAAGAATACAAACGGCTTCTGGAAATCCACAACAT
AAGGCCAGAAAGAGAGAAATCTCTCCGTAAATCGAATCAGACATTTAAAC
GATATGAATATCCCAATTCGATCCCAGATATTGAATTCCTTCCGATGAAA
ACCTGTCAAAAGTATCTCATTGATTTTTGTGTGCACCTGAATTCCAAATC
GATAACCGAAGCATTTAAAACCCTCGCAGATTTATTGAAAATGAATGTTT
TGTACCCGACATATTTTGGGATTTGTTCTCGTTTGTTGCAGTTGATTGAA
ACGCCGGGTTTGCCCGTATTGGTGGGTTTTACAGACAGAACTGACACGGA
AAAGCATTCCGATGAATCTCGATATACAAAAATCATTGATGTTGCGGAAT
CCTGGGTTCATCAGTTGTGTTCCATAAGTGAACTGGGAAACTCCGTTGAA
CAATTAAATTCCATTTTACTGCCTTGGAATTCATCTACGAAAAATAACAG
ATGTGGAATATTTGGTGCAATAGACTTGGTCAATGAAATTATTGACTACT
GTGAAGCAGGCAGTGAAAACACAAATCAGATCTCATTGACACTTGGTCAA
GCCAAAGGTCTAGTGGAACATTTTCAGAAACTGTTCGAATGCCCAAATAT
CATCGGTGTATATTCCCGGATGAATGTCCTCTACTCTCGATACGCAGAGA
TGAAAAATGTCATAGAGTCTTTGAAGAAAATTTTGAATATTGAAGATGTA
CGTGGATTAGCGTGTCTTGTGGCAGAGGTTGATGCTCTAGATCAAATGGT
AAATTCTAAATGCCAAAAAGAAATGGAACATTTTGGATTTTCTGATGACA
TCAAGATTCTGGTTGAAAGATTAGAAAAATATGAAACTTTTATTCCTGAA
TTTGAAAATCTAATAGATGAAATATTACATACATTAGGCCTCTCGTCAAT
TGATGAAGTTTTACCAAGAATCAAATCTCTCTTGGAATGTTCTCGGATCA
ATCAATGATATTTTCTGTTGCATTTTTAAATAAATTCTCCTG
back to top

protein sequence of SMED30004697-orf-1

>SMED30004697-orf-1 ID=SMED30004697-orf-1|Name=SMED30004697-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=676bp
MSFENDSEYNSISNSTHTINHFSEKNHNSLAYEKNDRLDWDKIIYNLKLN
GFSGITLKFDENDNLYFNKNDAINLRYLIFDLLNENNKKHDTIKDLWSSN
DKLKSLMNDNSFFIKRYEEMVKNLNESLLEAKQKLKEMESSCQYNAHSTN
NTNKNYNLSESEITSVSAVEESRQIIVSRYHNMEKICDEQREEINSLQLK
LSKLTSIEKARNRRQNEIFHQLRNKAPNSYNALDKRLLDVIESYESKVLQ
LESHLTFFSNLGFSLPNDDAPLNMADNTNNNNASTYQSHKSELSHEYKIL
IQKLQEEIEKVQKEKEKLKEKYEILKLEFESKPSLVEMKEVLNKLKEYKR
LLEIHNIRPEREKSLRKSNQTFKRYEYPNSIPDIEFLPMKTCQKYLIDFC
VHLNSKSITEAFKTLADLLKMNVLYPTYFGICSRLLQLIETPGLPVLVGF
TDRTDTEKHSDESRYTKIIDVAESWVHQLCSISELGNSVEQLNSILLPWN
SSTKNNRCGIFGAIDLVNEIIDYCEAGSENTNQISLTLGQAKGLVEHFQK
LFECPNIIGVYSRMNVLYSRYAEMKNVIESLKKILNIEDVRGLACLVAEV
DALDQMVNSKCQKEMEHFGFSDDIKILVERLEKYETFIPEFENLIDEILH
TLGLSSIDEVLPRIKSLLECSRINQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005813centrosome
GO:0005737cytoplasm
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
Vocabulary: molecular function
TermDefinition
GO:0043015gamma-tubulin binding
Vocabulary: biological process
TermDefinition
GO:0060271cilium morphogenesis
GO:0070507regulation of microtubule cytoskeleton organization
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR037692CEP70
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 290..328
NoneNo IPR availableCOILSCoilCoilcoord: 114..141
NoneNo IPR availableCOILSCoilCoilcoord: 180..207
NoneNo IPR availableCOILSCoilCoilcoord: 338..358
IPR037692Centrosomal protein of 70kDaPANTHERPTHR14594CENTROSOMAL PROTEIN OF 70 KDAcoord: 27..255
coord: 399..670