Voltage-dependent T-type calcium channel subunit alpha

Overview
NameVoltage-dependent T-type calcium channel subunit alpha
Smed IDSMED30004695
Length (bp)7707
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Voltage-dependent T-type calcium channel subunit alpha (SMED30004695) t-SNE clustered cells

Violin plots show distribution of expression levels for Voltage-dependent T-type calcium channel subunit alpha (SMED30004695) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Voltage-dependent T-type calcium channel subunit alpha (SMED30004695) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Voltage-dependent T-type calcium channel subunit alpha (SMED30004695) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004695

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30004695SMESG000000986.1 SMESG000000983.1 SmedASXL_015862SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30004695SMESG000000986.1 dd_Smed_v4_25868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30004695SMESG000000986.1 dd_Smed_v4_16822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30004695SMESG000000986.1 dd_Smed_v4_16822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30004695SMESG000000986.1 SMESG000000983.1 dd_Smed_v4_26967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30004695SMESG000000986.1 dd_Smed_v6_25868_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30004695SMESG000000986.1 dd_Smed_v6_16822_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30004695SMESG000000986.1 OX_Smed_1.0.10105ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
headSMED30004695SMESG000000986.1 SMESG000000983.1 OX_Smed_1.0.10180ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
headSMED30004695SMESG000000986.1 OX_Smed_1.0.01139ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
headSMED30004695SMESG000000986.1 OX_Smed_1.0.15041ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1H (calcium voltage-gated channel subunit alpha1 H [Source:HGNC Symbol;Acc:HGNC:1395])

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 409/695 (58.85%), Postives = 511/695 (73.53%), Query Frame = 2
Query: 4187 VSKLPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNYF--WCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRGNKE 6262
            V  LPS+  +  +   ++ + L +  +D       K+L  Y   WC       R+    +L++ SP NRFR SCQ ++  K+FD++VL FI LNC+T+A+ERP I   S ER FL+++NY+FT IF  EM +KV+A GLL G+H+YL+S WN++DGLLV++SL DI++ +     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSLRPIGNIVLICC FFIIFGI GVQLFKGKFYYC GPD  ++   ++C       W  ++YNFDNLGQALMSLFVLSSKDGWV IMY GLDAVGV+QQP +N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE EE  RR  KR RRLE++++K  + PY+  Y   R  IH L  S Y DL I  II +NVITM+ME Y  P  L+ ALK  NY+FT VF+ EA +K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE++ +  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFGRLECS+ NPC GLSRHA F NFGMAFLTLFR++TGDNWNGIMKDTLR      + C       P ++P+YFV FVL+AQFVLVNVVVAVLMKHLEES+K   +D E++ E++ E+ +      R +        E+ G ++
Sbjct: 1221 VVALPSDFFLRIDSHREDAAELDDDSEDSCCLRLHKVLEPYKPQWC-------RSREAWALYLFSPQNRFRVSCQKVITHKMFDHVVLVFIFLNCVTIALERPDIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGPDTRNISTKAQCRA-AHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLERRRRKAQRRPYYADYSPTRRSIHSLCTSHYLDLFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSLMGITLEEIEMSAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFLTLFRVSTGDNWNGIMKDTLRECSREDKHCLSYL---PALSPVYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAELDAEIELEMAQGPGSARRVDADRPPLPQESPGARD 1904          

HSP 2 Score: 394.045 bits (1011), Expect = 1.599e-109
Identity = 236/448 (52.68%), Postives = 303/448 (67.63%), Query Frame = 2
Query:  464 DSSAAEEERIENTEKNKDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLN-LSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIP-------PSVI-WLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
            +S AAE       ++ + +PYP     VFF L QT  PR WCL+ +  PWFE +S+ VI++NC+TLGM++PCED  C + RC IL  FD  IF FFAVE++IK+ A+GL G   Y  ++WNRLD  IV+AG++E       +SL+AIRTVRVLRPLRAINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC+L  ++  R+  L  L  YYQ     T+      FICS    NG+ KCS IP       P  + W    + +     A  N        +C+NWNQYY+ C +  +NP+ GAINFDNIG+AW+AIFQVI++E WVDIMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE++ M  +R +  S  STL S  EP SCY E++K +    R + +  ++ Y R+  +
Sbjct:   52 ESPAAERGAELGADEEQRVPYPALAATVFFCLGQTTRPRSWCLRLVCNPWFEHVSMLVIMLNCVTLGMFRPCEDVECGSERCNILEAFDAFIFAFFAVEMVIKMVALGLFGQKCYLGDTWNRLDFFIVVAGMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLD-SAFVRNNNLTFLRPYYQ-----TEEGEENPFICSSRRDNGMQKCSHIPGRRELRMPCTLGWEAYTQPQAEGVGAARN--------ACINWNQYYNVCRSGDSNPHNGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRARHLSNDSTLASFSEPGSCYEELLKYVGHIFRKVKRRSLRLYARWQSR 485          

HSP 3 Score: 312.768 bits (800), Expect = 1.429e-84
Identity = 193/333 (57.96%), Postives = 239/333 (71.77%), Query Frame = 2
Query: 2513 LGVRFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXX-XXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFND 3508
            L V F  K++ IV  +YF RGI++AIL+NTLSMG+EYH QP  LTN LE SN++F  +F +EMLLK+LA G LGYI N +N+FDG IV++ + E+  +    GLSVLRTFRLLR+LKLVRF+PALR QL+V++KTMDNVATF  LL+LFIFIFSILGM LFGCK   K   G    DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TSSWAALYFVALMTFGNYVLFNLLVAILVEGF  E   +A  ++       +E+K +   + + HK +E            ++ N ++    +GSL+     P+I  T ATPMP+P++SPF D
Sbjct:  778 LWVTFSGKLRRIVDSKYFSRGIMMAILVNTLSMGVEYHEQPEELTNALEISNIVFTSMFALEMLLKLLACGPLGYIRNPYNIFDGIIVVISVWEIVGQADG-GLSVLRTFRLLRVLKLVRFLPALRRQLVVLVKTMDNVATFCTLLMLFIFIFSILGMHLFGCKFSLKTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQAE--GDANRSDT------DEDKTSVHFEEDFHKLRELQTTELKMCSLAVTPNGHLE--GRGSLSP----PLIMCTAATPMPTPKSSPFLD 1095          

HSP 4 Score: 98.9821 bits (245), Expect = 1.411e-19
Identity = 73/278 (26.26%), Postives = 140/278 (50.36%), Query Frame = 2
Query: 4388 FRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            F    + +++ K F   ++  I +N +++ +E    P++      L I+N VFT +FA+EM +K++A G L     Y+R+ +N+ DG++VVIS+ +     I+G +     +LR FRLLR L+ +R +   P L+  +  L+ ++  +     +   F  IF I G+ LF  KF                   D  +T  +++ NFD+L  A++++F + +++ W  ++Y G+ +           + W  LYF++ +    + + N+ V ++VE F 
Sbjct:  782 FSGKLRRIVDSKYFSRGIMMAILVNTLSMGVEYHEQPEELTNA--LEISNIVFTSMFALEMLLKLLACGPL----GYIRNPYNIFDGIIVVISVWE-----IVGQADGGLSVLRTFRLLRVLKLVRFL---PALRRQLVVLVKTMDNVATFCTLLMLFIFIFSILGMHLFGCKF---------------SLKTDTGDTVPDRK-NFDSLLWAIVTVFQILTQEDWNVVLYNGMAST----------SSWAALYFVALMTFGNYVLFNLLVAILVEGFQ 1019          

HSP 5 Score: 84.7297 bits (208), Expect = 2.999e-15
Identity = 73/198 (36.87%), Postives = 104/198 (52.53%), Query Frame = 2
Query: 4361 LFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKN 4948
             F L    R R+ C  L+    F+++ +  I LNC+TL M RP   +   S     L   +      FAVEM IK++A GL  G+  YL   WN +D  +VV   A +M   + GH+  +  I    R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G        D A V+N
Sbjct:   80 FFCLGQTTRPRSWCLRLVCNPWFEHVSMLVIMLNCVTLGMFRPCEDVECGSERCNILEAFDAFIFAFFAVEMVIKMVALGLF-GQKCYLGDTWNRLDFFIVV---AGMMEYSLDGHNVSLSAI----RTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLDSAFVRN 269          

HSP 6 Score: 78.1814 bits (191), Expect = 2.446e-13
Identity = 84/344 (24.42%), Postives = 159/344 (46.22%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS-----------SWAALYFVALMTFGNYVLFNLLVAIL---VEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVM--PIITHTDATPMP 3481
            R+ + S+    Y    I   I +N ++M +E++NQP  L   L+Y N +F  +F+ E  LK++A G   +  + +N  D  IV+L L+ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C   N      R   F +   A +T+F++ T ++WN ++   + + S           + + +YFV  +    +VL N++VA+L   +E  + E  ++A+L  +I LE       A  +  +     + +  +   P  V    + +++ R  SL     M  P++  +   P P
Sbjct: 1601 RRSIHSLCTSHYLDLFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSLMGITLEEIEMSAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFLTLFRVSTGDNWNGIMKDTLRECSREDKHCLSYLPALSPVYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAELDAEIELEMAQGPGSARRVDADRPPLPQESPGARDAPNLVA---RKVSVSRMLSLPNDSYMFRPVVPASAPHPRP 1941          

HSP 7 Score: 74.3294 bits (181), Expect = 3.781e-12
Identity = 68/210 (32.38%), Postives = 116/210 (55.24%), Query Frame = 2
Query: 5363 LVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFG-----RLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            +V+SKYF   I   I +N ++M +E++  P EL  AL+  N +FTS+F +E L+K +A GP  YI + +N  D +IV++SV  IV +          ++++R FR+L   RVLKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG     + +  D  P        +F++   A +T+F+I T ++WN ++ + +
Sbjct:  789 IVDSKYFSRGIMMAILVNTLSMGVEYHEQPEELTNALEISNIVFTSMFALEMLLKLLACGPLGYIRNPYNIFDGIIVVISVWEIVGQADG------GLSVLRTFRLL---RVLKLVRFLPALRRQLVVLVKTMDNVATFCTLLMLFIFIFSILGMHLFGCKFSLKTDTGDTVP-----DRKNFDSLLWAIVTVFQILTQEDWNVVLYNGM 984          

HSP 8 Score: 59.6918 bits (143), Expect = 9.232e-8
Identity = 34/108 (31.48%), Postives = 61/108 (56.48%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNT--LEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVE----LAQEGGA 2815
            RFR   + ++ H+ F   +L+ I +N +++ +E  +     T    L  SN IF  +F+ EM++K++A GLL     Y+ + +N+ DG +V++ LV+    +A  GGA
Sbjct: 1282 RFRVSCQKVITHKMFDHVVLVFIFLNCVTIALERPDIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGA 1389          

HSP 9 Score: 56.9954 bits (136), Expect = 7.044e-7
Identity = 50/170 (29.41%), Postives = 89/170 (52.35%), Query Frame = 2
Query:  587 CLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            C K I+   F+ + +  I +NC+T+ + +P  D    +     L   ++     F  E+M+K+ A+GLL G   Y   SWN LD ++V+  L++ + +        I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 1287 CQKVITHKMFDHVVLVFIFLNCVTIALERP--DIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKG 1454          

HSP 10 Score: 54.6842 bits (130), Expect = 3.809e-6
Identity = 27/80 (33.75%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRE 1612
            NFDN+G A +++F + S + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + ++ +
Sbjct: 1486 NFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQ 1565          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1H (calcium voltage-gated channel subunit alpha1 H [Source:HGNC Symbol;Acc:HGNC:1395])

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 403/655 (61.53%), Postives = 497/655 (75.88%), Query Frame = 2
Query: 4313 WCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQK--NCCVS--PIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRGNKE 6262
            WC       R+    +L++ SP NRFR SCQ ++  K+FD++VL FI LNC+T+A+ERP I   S ER FL+++NY+FT IF  EM +KV+A GLL G+H+YL+S WN++DGLLV++SL DI++ +     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSLRPIGNIVLICC FFIIFGI GVQLFKGKFYYC GPD  ++   ++C       W  ++YNFDNLGQALMSLFVLSSKDGWV IMY GLDAVGV+QQP +N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE EE  RR  KR RRLE++++K  + PY+  Y   R  IH L  S Y DL I  II +NVITM+ME Y  P  L+ ALK  NY+FT VF+ EA +K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE++ +  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFGRLECS+ NPC GLSRHA F NFGMAFLTLFR++TGDNWNGIMKDTLR       EC +    C+S  P ++P+YFV FVL+AQFVLVNVVVAVLMKHLEES+K   +D E++ E++ E+ +      R +        E+ G ++
Sbjct:    7 WC-------RSREAWALYLFSPQNRFRVSCQKVITHKMFDHVVLVFIFLNCVTIALERPDIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGPDTRNISTKAQCRA-AHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLERRRRKAQRRPYYADYSPTRRSIHSLCTSHYLDLFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSLMGITLEEIEMSAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFLTLFRVSTGDNWNGIMKDTLR-------ECSREDKHCLSYLPALSPVYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAELDAEIELEMAQGPGSARRVDADRPPLPQESPGARD 646          

HSP 2 Score: 79.7221 bits (195), Expect = 6.791e-14
Identity = 99/406 (24.38%), Postives = 182/406 (44.83%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS-----------SWAALYFVALMTFGNYVLFNLLVAIL---VEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVM--PIITHTDATPMPSPRASPFNDREIFHQEMDSLSRKSQLMSNTDGESLGVPLVLQHDQRN------LSRRGSDSS 3649
            R+ + S+    Y    I   I +N ++M +E++NQP  L   L+Y N +F  +F+ E  LK++A G   +  + +N  D  IV+L L+ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C   N      R   F +   A +T+F++ T ++WN ++   + + S           + + +YFV  +    +VL N++VA+L   +E  + E  ++A+L  +I LE       A  +  +     + +  +   P  V    + +++ R  SL     M  P++      P  +P   P  +      EM++    + L S     SL +PL +    R+      LS RG+  S
Sbjct:  343 RRSIHSLCTSHYLDLFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSLMGITLEEIEMSAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFLTLFRVSTGDNWNGIMKDTLRECSREDKHCLSYLPALSPVYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAELDAEIELEMAQGPGSARRVDADRPPLPQESPGARDAPNLVA---RKVSVSRMLSLPNDSYMFRPVV------PASAPHPRPLQE-----VEMETYGAGTPLESCA---SLQIPLAVSSPARSGEPLHALSPRGTARS 731          

HSP 3 Score: 60.077 bits (144), Expect = 6.734e-8
Identity = 34/108 (31.48%), Postives = 61/108 (56.48%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNT--LEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVE----LAQEGGA 2815
            RFR   + ++ H+ F   +L+ I +N +++ +E  +     T    L  SN IF  +F+ EM++K++A GLL     Y+ + +N+ DG +V++ LV+    +A  GGA
Sbjct:   24 RFRVSCQKVITHKMFDHVVLVFIFLNCVTIALERPDIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGA 131          

HSP 4 Score: 57.7658 bits (138), Expect = 3.831e-7
Identity = 50/170 (29.41%), Postives = 89/170 (52.35%), Query Frame = 2
Query:  587 CLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            C K I+   F+ + +  I +NC+T+ + +P  D    +     L   ++     F  E+M+K+ A+GLL G   Y   SWN LD ++V+  L++ + +        I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct:   29 CQKVITHKMFDHVVLVFIFLNCVTIALERP--DIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKG 196          

HSP 5 Score: 54.6842 bits (130), Expect = 3.351e-6
Identity = 27/80 (33.75%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRE 1612
            NFDN+G A +++F + S + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + ++ +
Sbjct:  228 NFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQ 307          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1H (calcium voltage-gated channel subunit alpha1 H [Source:HGNC Symbol;Acc:HGNC:1395])

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 409/695 (58.85%), Postives = 511/695 (73.53%), Query Frame = 2
Query: 4187 VSKLPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNYF--WCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRGNKE 6262
            V  LPS+  +  +   ++ + L +  +D       K+L  Y   WC       R+    +L++ SP NRFR SCQ ++  K+FD++VL FI LNC+T+A+ERP I   S ER FL+++NY+FT IF  EM +KV+A GLL G+H+YL+S WN++DGLLV++SL DI++ +     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSLRPIGNIVLICC FFIIFGI GVQLFKGKFYYC GPD  ++   ++C       W  ++YNFDNLGQALMSLFVLSSKDGWV IMY GLDAVGV+QQP +N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE EE  RR  KR RRLE++++K  + PY+  Y   R  IH L  S Y DL I  II +NVITM+ME Y  P  L+ ALK  NY+FT VF+ EA +K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE++ +  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFGRLECS+ NPC GLSRHA F NFGMAFLTLFR++TGDNWNGIMKDTLR      + C       P ++P+YFV FVL+AQFVLVNVVVAVLMKHLEES+K   +D E++ E++ E+ +      R +        E+ G ++
Sbjct: 1221 VVALPSDFFLRIDSHREDAAELDDDSEDSCCLRLHKVLEPYKPQWC-------RSREAWALYLFSPQNRFRVSCQKVITHKMFDHVVLVFIFLNCVTIALERPDIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGPDTRNISTKAQCRA-AHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLERRRRKAQRRPYYADYSPTRRSIHSLCTSHYLDLFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSLMGITLEEIEMSAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFLTLFRVSTGDNWNGIMKDTLRECSREDKHCLSYL---PALSPVYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAELDAEIELEMAQGPGSARRVDADRPPLPQESPGARD 1904          

HSP 2 Score: 394.045 bits (1011), Expect = 1.599e-109
Identity = 236/448 (52.68%), Postives = 303/448 (67.63%), Query Frame = 2
Query:  464 DSSAAEEERIENTEKNKDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLN-LSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIP-------PSVI-WLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
            +S AAE       ++ + +PYP     VFF L QT  PR WCL+ +  PWFE +S+ VI++NC+TLGM++PCED  C + RC IL  FD  IF FFAVE++IK+ A+GL G   Y  ++WNRLD  IV+AG++E       +SL+AIRTVRVLRPLRAINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC+L  ++  R+  L  L  YYQ     T+      FICS    NG+ KCS IP       P  + W    + +     A  N        +C+NWNQYY+ C +  +NP+ GAINFDNIG+AW+AIFQVI++E WVDIMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE++ M  +R +  S  STL S  EP SCY E++K +    R + +  ++ Y R+  +
Sbjct:   52 ESPAAERGAELGADEEQRVPYPALAATVFFCLGQTTRPRSWCLRLVCNPWFEHVSMLVIMLNCVTLGMFRPCEDVECGSERCNILEAFDAFIFAFFAVEMVIKMVALGLFGQKCYLGDTWNRLDFFIVVAGMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLD-SAFVRNNNLTFLRPYYQ-----TEEGEENPFICSSRRDNGMQKCSHIPGRRELRMPCTLGWEAYTQPQAEGVGAARN--------ACINWNQYYNVCRSGDSNPHNGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRARHLSNDSTLASFSEPGSCYEELLKYVGHIFRKVKRRSLRLYARWQSR 485          

HSP 3 Score: 312.768 bits (800), Expect = 1.429e-84
Identity = 193/333 (57.96%), Postives = 239/333 (71.77%), Query Frame = 2
Query: 2513 LGVRFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXX-XXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFND 3508
            L V F  K++ IV  +YF RGI++AIL+NTLSMG+EYH QP  LTN LE SN++F  +F +EMLLK+LA G LGYI N +N+FDG IV++ + E+  +    GLSVLRTFRLLR+LKLVRF+PALR QL+V++KTMDNVATF  LL+LFIFIFSILGM LFGCK   K   G    DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TSSWAALYFVALMTFGNYVLFNLLVAILVEGF  E   +A  ++       +E+K +   + + HK +E            ++ N ++    +GSL+     P+I  T ATPMP+P++SPF D
Sbjct:  778 LWVTFSGKLRRIVDSKYFSRGIMMAILVNTLSMGVEYHEQPEELTNALEISNIVFTSMFALEMLLKLLACGPLGYIRNPYNIFDGIIVVISVWEIVGQADG-GLSVLRTFRLLRVLKLVRFLPALRRQLVVLVKTMDNVATFCTLLMLFIFIFSILGMHLFGCKFSLKTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQAE--GDANRSDT------DEDKTSVHFEEDFHKLRELQTTELKMCSLAVTPNGHLE--GRGSLSP----PLIMCTAATPMPTPKSSPFLD 1095          

HSP 4 Score: 98.9821 bits (245), Expect = 1.411e-19
Identity = 73/278 (26.26%), Postives = 140/278 (50.36%), Query Frame = 2
Query: 4388 FRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            F    + +++ K F   ++  I +N +++ +E    P++      L I+N VFT +FA+EM +K++A G L     Y+R+ +N+ DG++VVIS+ +     I+G +     +LR FRLLR L+ +R +   P L+  +  L+ ++  +     +   F  IF I G+ LF  KF                   D  +T  +++ NFD+L  A++++F + +++ W  ++Y G+ +           + W  LYF++ +    + + N+ V ++VE F 
Sbjct:  782 FSGKLRRIVDSKYFSRGIMMAILVNTLSMGVEYHEQPEELTNA--LEISNIVFTSMFALEMLLKLLACGPL----GYIRNPYNIFDGIIVVISVWE-----IVGQADGGLSVLRTFRLLRVLKLVRFL---PALRRQLVVLVKTMDNVATFCTLLMLFIFIFSILGMHLFGCKF---------------SLKTDTGDTVPDRK-NFDSLLWAIVTVFQILTQEDWNVVLYNGMAST----------SSWAALYFVALMTFGNYVLFNLLVAILVEGFQ 1019          

HSP 5 Score: 84.7297 bits (208), Expect = 2.999e-15
Identity = 73/198 (36.87%), Postives = 104/198 (52.53%), Query Frame = 2
Query: 4361 LFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKN 4948
             F L    R R+ C  L+    F+++ +  I LNC+TL M RP   +   S     L   +      FAVEM IK++A GL  G+  YL   WN +D  +VV   A +M   + GH+  +  I    R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G        D A V+N
Sbjct:   80 FFCLGQTTRPRSWCLRLVCNPWFEHVSMLVIMLNCVTLGMFRPCEDVECGSERCNILEAFDAFIFAFFAVEMVIKMVALGLF-GQKCYLGDTWNRLDFFIVV---AGMMEYSLDGHNVSLSAI----RTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLDSAFVRN 269          

HSP 6 Score: 78.1814 bits (191), Expect = 2.446e-13
Identity = 84/344 (24.42%), Postives = 159/344 (46.22%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS-----------SWAALYFVALMTFGNYVLFNLLVAIL---VEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVM--PIITHTDATPMP 3481
            R+ + S+    Y    I   I +N ++M +E++NQP  L   L+Y N +F  +F+ E  LK++A G   +  + +N  D  IV+L L+ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C   N      R   F +   A +T+F++ T ++WN ++   + + S           + + +YFV  +    +VL N++VA+L   +E  + E  ++A+L  +I LE       A  +  +     + +  +   P  V    + +++ R  SL     M  P++  +   P P
Sbjct: 1601 RRSIHSLCTSHYLDLFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSLMGITLEEIEMSAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFLTLFRVSTGDNWNGIMKDTLRECSREDKHCLSYLPALSPVYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAELDAEIELEMAQGPGSARRVDADRPPLPQESPGARDAPNLVA---RKVSVSRMLSLPNDSYMFRPVVPASAPHPRP 1941          

HSP 7 Score: 74.3294 bits (181), Expect = 3.781e-12
Identity = 68/210 (32.38%), Postives = 116/210 (55.24%), Query Frame = 2
Query: 5363 LVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFG-----RLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            +V+SKYF   I   I +N ++M +E++  P EL  AL+  N +FTS+F +E L+K +A GP  YI + +N  D +IV++SV  IV +          ++++R FR+L   RVLKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG     + +  D  P        +F++   A +T+F+I T ++WN ++ + +
Sbjct:  789 IVDSKYFSRGIMMAILVNTLSMGVEYHEQPEELTNALEISNIVFTSMFALEMLLKLLACGPLGYIRNPYNIFDGIIVVISVWEIVGQADG------GLSVLRTFRLL---RVLKLVRFLPALRRQLVVLVKTMDNVATFCTLLMLFIFIFSILGMHLFGCKFSLKTDTGDTVP-----DRKNFDSLLWAIVTVFQILTQEDWNVVLYNGM 984          

HSP 8 Score: 59.6918 bits (143), Expect = 9.232e-8
Identity = 34/108 (31.48%), Postives = 61/108 (56.48%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNT--LEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVE----LAQEGGA 2815
            RFR   + ++ H+ F   +L+ I +N +++ +E  +     T    L  SN IF  +F+ EM++K++A GLL     Y+ + +N+ DG +V++ LV+    +A  GGA
Sbjct: 1282 RFRVSCQKVITHKMFDHVVLVFIFLNCVTIALERPDIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGA 1389          

HSP 9 Score: 56.9954 bits (136), Expect = 7.044e-7
Identity = 50/170 (29.41%), Postives = 89/170 (52.35%), Query Frame = 2
Query:  587 CLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            C K I+   F+ + +  I +NC+T+ + +P  D    +     L   ++     F  E+M+K+ A+GLL G   Y   SWN LD ++V+  L++ + +        I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 1287 CQKVITHKMFDHVVLVFIFLNCVTIALERP--DIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKG 1454          

HSP 10 Score: 54.6842 bits (130), Expect = 3.809e-6
Identity = 27/80 (33.75%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRE 1612
            NFDN+G A +++F + S + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + ++ +
Sbjct: 1486 NFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQ 1565          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1H (calcium voltage-gated channel subunit alpha1 H [Source:HGNC Symbol;Acc:HGNC:1395])

HSP 1 Score: 627.861 bits (1618), Expect = 0.000e+0
Identity = 403/666 (60.51%), Postives = 496/666 (74.47%), Query Frame = 2
Query: 4313 WCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQP-----------PYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQK--NCCVS--PIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRGNKE 6262
            WC       R+    +L++ SP NRFR SCQ ++  K+FD++VL FI LNC+T+A+ERP I   S ER FL+++NY+FT IF  EM +KV+A GLL G+H+YL+S WN++DGLLV++SL DI++ +     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSLRPIGNIVLICC FFIIFGI GVQLFKGKFYYC GPD  ++   ++C       W  ++YNFDNLGQALMSLFVLSSKDGWV IMY GLDAVGV+QQP +N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE EE  RR  KR RRLE++++    P           PY+  Y   R  IH L  S Y DL I  II +NVITM+ME Y  P  L+ ALK  NY+FT VF+ EA +K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE++ +  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFGRLECS+ NPC GLSRHA F NFGMAFLTLFR++TGDNWNGIMKDTLR       EC +    C+S  P ++P+YFV FVL+AQFVLVNVVVAVLMKHLEES+K   +D E++ E++ E+ +      R +        E+ G ++
Sbjct:    7 WC-------RSREAWALYLFSPQNRFRVSCQKVITHKMFDHVVLVFIFLNCVTIALERPDIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGPDTRNISTKAQCRA-AHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLERRRRSKALPVAVAVAEAQRRPYYADYSPTRRSIHSLCTSHYLDLFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSLMGITLEEIEMSAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFLTLFRVSTGDNWNGIMKDTLR-------ECSREDKHCLSYLPALSPVYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAELDAEIELEMAQGPGSARRVDADRPPLPQESPGARD 657          

HSP 2 Score: 77.7962 bits (190), Expect = 2.930e-13
Identity = 84/344 (24.42%), Postives = 159/344 (46.22%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS-----------SWAALYFVALMTFGNYVLFNLLVAIL---VEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVM--PIITHTDATPMP 3481
            R+ + S+    Y    I   I +N ++M +E++NQP  L   L+Y N +F  +F+ E  LK++A G   +  + +N  D  IV+L L+ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C   N      R   F +   A +T+F++ T ++WN ++   + + S           + + +YFV  +    +VL N++VA+L   +E  + E  ++A+L  +I LE       A  +  +     + +  +   P  V    + +++ R  SL     M  P++  +   P P
Sbjct:  354 RRSIHSLCTSHYLDLFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSLMGITLEEIEMSAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFLTLFRVSTGDNWNGIMKDTLRECSREDKHCLSYLPALSPVYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAELDAEIELEMAQGPGSARRVDADRPPLPQESPGARDAPNLVA---RKVSVSRMLSLPNDSYMFRPVVPASAPHPRP 694          

HSP 3 Score: 60.4622 bits (145), Expect = 5.722e-8
Identity = 34/108 (31.48%), Postives = 61/108 (56.48%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNT--LEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVE----LAQEGGA 2815
            RFR   + ++ H+ F   +L+ I +N +++ +E  +     T    L  SN IF  +F+ EM++K++A GLL     Y+ + +N+ DG +V++ LV+    +A  GGA
Sbjct:   24 RFRVSCQKVITHKMFDHVVLVFIFLNCVTIALERPDIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGA 131          

HSP 4 Score: 57.7658 bits (138), Expect = 3.918e-7
Identity = 50/170 (29.41%), Postives = 89/170 (52.35%), Query Frame = 2
Query:  587 CLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            C K I+   F+ + +  I +NC+T+ + +P  D    +     L   ++     F  E+M+K+ A+GLL G   Y   SWN LD ++V+  L++ + +        I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct:   29 CQKVITHKMFDHVVLVFIFLNCVTIALERP--DIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKG 196          

HSP 5 Score: 54.6842 bits (130), Expect = 3.283e-6
Identity = 27/80 (33.75%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRE 1612
            NFDN+G A +++F + S + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + ++ +
Sbjct:  228 NFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQ 307          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1H (calcium voltage-gated channel subunit alpha1 H [Source:HGNC Symbol;Acc:HGNC:1395])

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 398/661 (60.21%), Postives = 491/661 (74.28%), Query Frame = 2
Query: 4313 WCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ------XXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQK--NCCVS--PIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRGNKE 6262
            WC       R+    +L++ SP NRFR SCQ ++  K+FD++VL FI LNC+T+A+ERP I   S ER FL+++NY+FT IF  EM +KV+A GLL G+H+YL+S WN++DGLLV++SL DI++ +     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSLRPIGNIVLICC FFIIFGI GVQLFKGKFYYC GPD  ++   ++C       W  ++YNFDNLGQALMSLFVLSSKDGWV IMY GLDAVGV+QQP +N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++Q       +EEK  R  +R RR      +  + PY+  Y   R  IH L  S Y DL I  II +NVITM+ME Y  P  L+ ALK  NY+FT VF+ EA +K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE++ +  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFGRLECS+ NPC GLSRHA F NFGMAFLTLFR++TGDNWNGIMKDTLR       EC +    C+S  P ++P+YFV FVL+AQFVLVNVVVAVLMKHLEES+K   +D E++ E++ E+ +      R +        E+ G ++
Sbjct:    7 WC-------RSREAWALYLFSPQNRFRVSCQKVITHKMFDHVVLVFIFLNCVTIALERPDIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGPDTRNISTKAQCRA-AHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLERRRRSTFPSPEAQRRPYYADYSPTRRSIHSLCTSHYLDLFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSLMGITLEEIEMSAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFLTLFRVSTGDNWNGIMKDTLR-------ECSREDKHCLSYLPALSPVYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAELDAEIELEMAQGPGSARRVDADRPPLPQESPGARD 652          

HSP 2 Score: 79.7221 bits (195), Expect = 7.994e-14
Identity = 99/406 (24.38%), Postives = 182/406 (44.83%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS-----------SWAALYFVALMTFGNYVLFNLLVAIL---VEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVM--PIITHTDATPMPSPRASPFNDREIFHQEMDSLSRKSQLMSNTDGESLGVPLVLQHDQRN------LSRRGSDSS 3649
            R+ + S+    Y    I   I +N ++M +E++NQP  L   L+Y N +F  +F+ E  LK++A G   +  + +N  D  IV+L L+ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C   N      R   F +   A +T+F++ T ++WN ++   + + S           + + +YFV  +    +VL N++VA+L   +E  + E  ++A+L  +I LE       A  +  +     + +  +   P  V    + +++ R  SL     M  P++      P  +P   P  +      EM++    + L S     SL +PL +    R+      LS RG+  S
Sbjct:  349 RRSIHSLCTSHYLDLFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSLMGITLEEIEMSAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFLTLFRVSTGDNWNGIMKDTLRECSREDKHCLSYLPALSPVYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAELDAEIELEMAQGPGSARRVDADRPPLPQESPGARDAPNLVA---RKVSVSRMLSLPNDSYMFRPVV------PASAPHPRPLQE-----VEMETYGAGTPLESCA---SLQIPLAVSSPARSGEPLHALSPRGTARS 737          

HSP 3 Score: 60.4622 bits (145), Expect = 5.994e-8
Identity = 34/108 (31.48%), Postives = 61/108 (56.48%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNT--LEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVE----LAQEGGA 2815
            RFR   + ++ H+ F   +L+ I +N +++ +E  +     T    L  SN IF  +F+ EM++K++A GLL     Y+ + +N+ DG +V++ LV+    +A  GGA
Sbjct:   24 RFRVSCQKVITHKMFDHVVLVFIFLNCVTIALERPDIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGA 131          

HSP 4 Score: 57.3806 bits (137), Expect = 4.036e-7
Identity = 50/170 (29.41%), Postives = 89/170 (52.35%), Query Frame = 2
Query:  587 CLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            C K I+   F+ + +  I +NC+T+ + +P  D    +     L   ++     F  E+M+K+ A+GLL G   Y   SWN LD ++V+  L++ + +        I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct:   29 CQKVITHKMFDHVVLVFIFLNCVTIALERP--DIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKG 196          

HSP 5 Score: 54.6842 bits (130), Expect = 3.271e-6
Identity = 27/80 (33.75%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRE 1612
            NFDN+G A +++F + S + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + ++ +
Sbjct:  228 NFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQ 307          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Celegans
Match: cca-1 (Voltage-dependent T-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASP4])

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 410/634 (64.67%), Postives = 492/634 (77.60%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMI-VLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRE-----------NQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCD------DDEIEKEVQREIDEENKEK 6205
            SLF++ P N  R  C    +KK FD  VLFFI +NCITLAMERPSIP  S ER+FL I+ Y+FTVIF  EM +KVIA G  +G+ +Y + GWN++DG+LVVISL +I   +L  G S +IFG++RV RLLR LRPLRVI+RAPG+KLVV TL+SSL+PIGNIVLICCTFFIIFGI GVQLFKG  Y+C GP+V +V   ++C  D RN W N +YNFDNLGQALMSLFVLSSKDGWV IMY G+DAVGV+ QP ENYNEW ++YFISFLLLVGFFVLNMFVGVVVENFHKC+E            +  + K +R         K+KK     PY+  Y H RL +HG+V SKYFDLAIA +IG+NVI+MAMEFYMMP+ L+  LK+LNY FT+VF +EA +K IA G KR+ I++WN+LD+ IVILS++GI+ EE +   +PIN TIIRV RVLRIARVLKLLKMAKGIR+LLDTV +ALPQVGNLG LFFLLFFIFAALGVELFG+LECS+ +PC GL  HAHF+NFGMAFLTLFRIATGDNWNGIMKD LR+ CD+S+ C+ NCCV PI+AP +FVIFVL++QFVLVNVVVAVLMKHLEES+K   +       + IE E+ +  D+E  E+
Sbjct: 1097 SLFLMGPKNPLRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHKCKEALEKEMREKEKEKRLKRKLKRQKFEESMAGKRKKMERNYPYYHDYGHTRLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDNWNGIMKDALRDDCDSSDHCETNCCVDPILAPCFFVIFVLISQFVLVNVVVAVLMKHLEESNKRDAEGPAEPTGENIENEITKSDDDEIVEE 1730          

HSP 2 Score: 409.453 bits (1051), Expect = 1.558e-115
Identity = 232/440 (52.73%), Postives = 299/440 (67.95%), Query Frame = 2
Query:  518 LPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDT-SCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPST---GEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHL------NSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERK---KQQSTSTLGSSI-------EPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
            LPYP + E       Q   PR W L+ +  PWF+++++AVI++NC+TLGMY+PCED   C T RC+IL   D+CIF++FA E++IKI A+G  GP+ Y S++WNRLD  IV+AG+ E +      G ++LTAIRTVRVLRPLRA+NRIPSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC ++L      N S     + L+ +Y    T+ +      +ICS  + NGL  CS++PP  +     +   CN + L   D + TN SC+NWN YY++C+    NP+ G+++FDNIGFAWVAIF VIS+E W DIMYYVQDAHSFW+W YFV LI+IG+FFMINLCLVVIATQF+ETK+RETERML ERK    + S S  GS I       E  + Y   ++ I    R   +   K+Y  + E+
Sbjct:  100 LPYPGFAEPALRCFYQARPPRKWALQMVMSPWFDRITMAVIMINCVTLGMYRPCEDGPDCDTYRCQILDIIDNCIFVYFAFEMVIKIMALGFYGPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLGGNINLTAIRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCVINLPKTISENQSALFNNVKLTRFYIPEDTSLE------YICSQPDANGLHTCSNLPPYTV-----DGVKCNLT-LDEYDKV-TNDSCINWNIYYNECQVMQRNPFQGSVSFDNIGFAWVAIFLVISLEGWTDIMYYVQDAHSFWNWIYFVLLIVIGAFFMINLCLVVIATQFAETKRRETERMLQERKMLLNRDSISCTGSEIGGASSKEEGDTVYAAFVRFIGHTFRRTKRAAKKKYTAYMEE 526          

HSP 3 Score: 292.738 bits (748), Expect = 4.006e-79
Identity = 171/276 (61.96%), Postives = 205/276 (74.28%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKL----AEKIHLEKHNEEK 3304
            FR+K++  V   +F RGIL+AIL+NTLSMG+EYH QP +LT  LEYSN+ F  LF +EMLLKI+A GL GY+++GFN+FDGGIV L ++EL QE G  GLSVLRTFRLLRILKLVRFMPALR QL+VML+TMDNV  FF LL+LFIFIFS LGM L              C   +  +   +CDR NFD+ L+A VTVFQILTQEDWN VL +GM+QT+ WAALYFVALMTFGNYVLFNLLVAILVEGF   + +E +     A K  +E+ +E K
Sbjct:  642 FREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQE-GKGGLSVLRTFRLLRILKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCKFCNHPDTGLQCTSAQVISSICECDRMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQTNPWAALYFVALMTFGNYVLFNLLVAILVEGFQESKEEEKRQLEEDARKQAVEEEDERK 916          

HSP 4 Score: 103.219 bits (256), Expect = 2.543e-21
Identity = 96/346 (27.75%), Postives = 152/346 (43.93%), Query Frame = 2
Query: 4427 FDNIVLFFIALNCITLAMERP--SIPQKSRER-EFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKF-------------------------------------YYCSGPDVAHVKNFS----------ECN----------NDKRNTWKNQQYN---------------FDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            FD I +  I +NC+TL M RP    P     R + L I +    V FA EM IK++A G   G  +Y+   WN +D  +V+  +A+ ++   +G +  +  I    R +R LRPLR ++R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G                                       Y CS PD   +   S          +CN          ND    W N  YN               FDN+G A +++F++ S +GW  IMY   DA          ++ W  +YF+  +++  FF++N+ + V+   F + +  +
Sbjct:  132 FDRITMAVIMINCVTLGMYRPCEDGPDCDTYRCQILDIIDNCIFVYFAFEMVIKIMALGFY-GPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLGGNINLTAI----RTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCVINLPKTISENQSALFNNVKLTRFYIPEDTSLEYICSQPDANGLHTCSNLPPYTVDGVKCNLTLDEYDKVTNDSCINW-NIYYNECQVMQRNPFQGSVSFDNIGFAWVAIFLVISLEGWTDIMYYVQDA----------HSFWNWIYFVLLIVIGAFFMINLCLVVIATQFAETKRRE 461          

HSP 5 Score: 91.6633 bits (226), Expect = 8.679e-18
Identity = 76/295 (25.76%), Postives = 135/295 (45.76%), Query Frame = 2
Query: 4388 FRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTI----TNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAH-------VKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            FR   Q  +    F   +L  I +N +++ +E    P      E LT+    +N  FT +FA+EM +K+IA GL      YL  G+N+ DG +V +S+ ++              +LR FRLLR L+ +R +   P L+  +  +L ++  +     +   F  IF   G+ LF  KF  C+ PD          + +  EC+          + NFDN   A +++F + +++ W  +++ G+             N W  LYF++ +    + + N+ V ++VE F + +E +
Sbjct:  642 FREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQP------EILTVILEYSNLFFTALFALEMLLKIIASGLF----GYLADGFNLFDGGIVALSVLELF-----QEGKGGLSVLRTFRLLRILKLVRFM---PALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCKF--CNHPDTGLQCTSAQVISSICECD----------RMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQT----------NPWAALYFVALMTFGNYVLFNLLVAILVEGFQESKEEE 896          

HSP 6 Score: 68.9366 bits (167), Expect = 6.540e-11
Identity = 90/304 (29.61%), Postives = 152/304 (50.00%), Query Frame = 2
Query: 5342 WRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLS-------------RHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRE 6214
            +R  I   V   +F   I   I +N ++M +E++  P  L V L+  N  FT++F +E L+K IA G   Y+ D +N  D  IV LSV  +  E          ++++R FR+LRI   LKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG   C+  +P TGL                 +F+NF  A +T+F+I T ++WN ++ + +          Q N       A +YFV  +    +VL N++VA+L++  +ES +   +  ++E++ +++  EE  E+ RE
Sbjct:  642 FREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQEGKGG------LSVLRTFRLLRI---LKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCKFCN--HPDTGLQCTSAQVISSICECDRMNFDNFLFATVTVFQILTQEDWNMVLFNGM---------AQTNPW-----AALYFVALMTFGNYVLFNLLVAILVEGFQESKEE--EKRQLEEDARKQAVEEEDERKRE 918          

HSP 7 Score: 65.4698 bits (158), Expect = 6.330e-10
Identity = 58/207 (28.02%), Postives = 100/207 (48.31%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG--------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXX-XXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVL 3121
            R  +  IV  +YF   I   I IN +SM +E++  P+ L   L+  N  F  +F +E  +K++A G   +    +N  D  IVIL +  +  E           + + V+R  R+ R+LKL++    +R  L  + + +  V    +L  L  FIF+ LG+ LFG   C   +      +  +F +   A +T+F+I T ++WN ++
Sbjct: 1438 RLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDNWNGIM 1644          

HSP 8 Score: 62.7734 bits (151), Expect = 4.304e-9
Identity = 80/290 (27.59%), Postives = 137/290 (47.24%), Query Frame = 2
Query:  290 LNENYDSLKISTSQTSFLPVMRTSDYNDQ-----SSICSRMRTSNEPSG------LYFNNDLDRSSYMVDSSAAEEERIENTEKN-------KDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMG-LLGPSGYFSESWNRLDMVIVIAGLIEC---IPSTGEMS-----LTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGIL 1078
            ++E  D  +++   +  LPV     Y  Q     S +C     +    G       Y       +S  +  + AEEE+    ++N       K     +  E   F +   +  R  CL+     WF+   +  I +NCITL M +P       +   + L    +   + F  E+M+K+ A G  +G + YF + WN LD ++V+  LI     + +TG+       +  +R +R LRPLR INR P ++++VM L+ +L  +GN++L+C   F IFGI+GVQ+++G++
Sbjct:  994 VSEGRDDSRLNRHASLVLPVANGVPYRRQRVHSWSGLCHHFNPNCPVHGRRALIETYAREKFLEASQELKQALAEEEKRNEAKQNTFVRKLLKKTCLHNRTEFSLFLMGPKNPLRIKCLQTTQKKWFDYTVLFFIGINCITLAMERP--SIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMM 1281          

HSP 9 Score: 60.4622 bits (145), Expect = 2.494e-8
Identity = 61/279 (21.86%), Postives = 123/279 (44.09%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQP--VLLTNTLEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLL---------RILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXX-----------------XXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGF 3235
             R K       ++F   +L  I IN +++ +E  + P        L  S  IF  +F  EM++K++A G       Y  +G+N+ DG +V++ L+ +A E  A+G S  + F ++         R L+++   P ++L ++ ++ ++  +     +   F  IF ILG+ LF          +                     R NFD+L  A++++F + +++ W +++  G+               W  +YF++ +    + + N+ V ++VE F
Sbjct: 1107 LRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSP-KIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENF 1384          

HSP 10 Score: 58.151 bits (139), Expect = 1.041e-7
Identity = 30/108 (27.78%), Postives = 55/108 (50.93%), Query Frame = 2
Query: 1322 TNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQ 1645
            T + C +     S CE          +NFDN  FA V +FQ+++ E W  +++      + W   YFV+L+  G++ + NL + ++   F E+K+ E  ++  + +KQ
Sbjct:  807 TGLQCTSAQVISSICEC-------DRMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQTNPWAALYFVALMTFGNYVLFNLLVAILVEGFQESKEEEKRQLEEDARKQ 907          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Celegans
Match: cca-1 (Voltage-dependent T-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASP4])

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 410/634 (64.67%), Postives = 492/634 (77.60%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMI-VLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRE-----------NQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCD------DDEIEKEVQREIDEENKEK 6205
            SLF++ P N  R  C    +KK FD  VLFFI +NCITLAMERPSIP  S ER+FL I+ Y+FTVIF  EM +KVIA G  +G+ +Y + GWN++DG+LVVISL +I   +L  G S +IFG++RV RLLR LRPLRVI+RAPG+KLVV TL+SSL+PIGNIVLICCTFFIIFGI GVQLFKG  Y+C GP+V +V   ++C  D RN W N +YNFDNLGQALMSLFVLSSKDGWV IMY G+DAVGV+ QP ENYNEW ++YFISFLLLVGFFVLNMFVGVVVENFHKC+E            +  + K +R         K+KK     PY+  Y H RL +HG+V SKYFDLAIA +IG+NVI+MAMEFYMMP+ L+  LK+LNY FT+VF +EA +K IA G KR+ I++WN+LD+ IVILS++GI+ EE +   +PIN TIIRV RVLRIARVLKLLKMAKGIR+LLDTV +ALPQVGNLG LFFLLFFIFAALGVELFG+LECS+ +PC GL  HAHF+NFGMAFLTLFRIATGDNWNGIMKD LR+ CD+S+ C+ NCCV PI+AP +FVIFVL++QFVLVNVVVAVLMKHLEES+K   +       + IE E+ +  D+E  E+
Sbjct: 1097 SLFLMGPKNPLRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHKCKEALEKEMREKEKEKRLKRKLKRQKFEESMAGKRKKMERNYPYYHDYGHTRLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDNWNGIMKDALRDDCDSSDHCETNCCVDPILAPCFFVIFVLISQFVLVNVVVAVLMKHLEESNKRDAEGPAEPTGENIENEITKSDDDEIVEE 1730          

HSP 2 Score: 409.453 bits (1051), Expect = 1.558e-115
Identity = 232/440 (52.73%), Postives = 299/440 (67.95%), Query Frame = 2
Query:  518 LPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDT-SCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPST---GEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHL------NSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERK---KQQSTSTLGSSI-------EPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
            LPYP + E       Q   PR W L+ +  PWF+++++AVI++NC+TLGMY+PCED   C T RC+IL   D+CIF++FA E++IKI A+G  GP+ Y S++WNRLD  IV+AG+ E +      G ++LTAIRTVRVLRPLRA+NRIPSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC ++L      N S     + L+ +Y    T+ +      +ICS  + NGL  CS++PP  +     +   CN + L   D + TN SC+NWN YY++C+    NP+ G+++FDNIGFAWVAIF VIS+E W DIMYYVQDAHSFW+W YFV LI+IG+FFMINLCLVVIATQF+ETK+RETERML ERK    + S S  GS I       E  + Y   ++ I    R   +   K+Y  + E+
Sbjct:  100 LPYPGFAEPALRCFYQARPPRKWALQMVMSPWFDRITMAVIMINCVTLGMYRPCEDGPDCDTYRCQILDIIDNCIFVYFAFEMVIKIMALGFYGPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLGGNINLTAIRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCVINLPKTISENQSALFNNVKLTRFYIPEDTSLE------YICSQPDANGLHTCSNLPPYTV-----DGVKCNLT-LDEYDKV-TNDSCINWNIYYNECQVMQRNPFQGSVSFDNIGFAWVAIFLVISLEGWTDIMYYVQDAHSFWNWIYFVLLIVIGAFFMINLCLVVIATQFAETKRRETERMLQERKMLLNRDSISCTGSEIGGASSKEEGDTVYAAFVRFIGHTFRRTKRAAKKKYTAYMEE 526          

HSP 3 Score: 292.738 bits (748), Expect = 4.006e-79
Identity = 171/276 (61.96%), Postives = 205/276 (74.28%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKL----AEKIHLEKHNEEK 3304
            FR+K++  V   +F RGIL+AIL+NTLSMG+EYH QP +LT  LEYSN+ F  LF +EMLLKI+A GL GY+++GFN+FDGGIV L ++EL QE G  GLSVLRTFRLLRILKLVRFMPALR QL+VML+TMDNV  FF LL+LFIFIFS LGM L              C   +  +   +CDR NFD+ L+A VTVFQILTQEDWN VL +GM+QT+ WAALYFVALMTFGNYVLFNLLVAILVEGF   + +E +     A K  +E+ +E K
Sbjct:  642 FREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQE-GKGGLSVLRTFRLLRILKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCKFCNHPDTGLQCTSAQVISSICECDRMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQTNPWAALYFVALMTFGNYVLFNLLVAILVEGFQESKEEEKRQLEEDARKQAVEEEDERK 916          

HSP 4 Score: 103.219 bits (256), Expect = 2.543e-21
Identity = 96/346 (27.75%), Postives = 152/346 (43.93%), Query Frame = 2
Query: 4427 FDNIVLFFIALNCITLAMERP--SIPQKSRER-EFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKF-------------------------------------YYCSGPDVAHVKNFS----------ECN----------NDKRNTWKNQQYN---------------FDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            FD I +  I +NC+TL M RP    P     R + L I +    V FA EM IK++A G   G  +Y+   WN +D  +V+  +A+ ++   +G +  +  I    R +R LRPLR ++R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G                                       Y CS PD   +   S          +CN          ND    W N  YN               FDN+G A +++F++ S +GW  IMY   DA          ++ W  +YF+  +++  FF++N+ + V+   F + +  +
Sbjct:  132 FDRITMAVIMINCVTLGMYRPCEDGPDCDTYRCQILDIIDNCIFVYFAFEMVIKIMALGFY-GPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLGGNINLTAI----RTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCVINLPKTISENQSALFNNVKLTRFYIPEDTSLEYICSQPDANGLHTCSNLPPYTVDGVKCNLTLDEYDKVTNDSCINW-NIYYNECQVMQRNPFQGSVSFDNIGFAWVAIFLVISLEGWTDIMYYVQDA----------HSFWNWIYFVLLIVIGAFFMINLCLVVIATQFAETKRRE 461          

HSP 5 Score: 91.6633 bits (226), Expect = 8.679e-18
Identity = 76/295 (25.76%), Postives = 135/295 (45.76%), Query Frame = 2
Query: 4388 FRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTI----TNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAH-------VKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            FR   Q  +    F   +L  I +N +++ +E    P      E LT+    +N  FT +FA+EM +K+IA GL      YL  G+N+ DG +V +S+ ++              +LR FRLLR L+ +R +   P L+  +  +L ++  +     +   F  IF   G+ LF  KF  C+ PD          + +  EC+          + NFDN   A +++F + +++ W  +++ G+             N W  LYF++ +    + + N+ V ++VE F + +E +
Sbjct:  642 FREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQP------EILTVILEYSNLFFTALFALEMLLKIIASGLF----GYLADGFNLFDGGIVALSVLELF-----QEGKGGLSVLRTFRLLRILKLVRFM---PALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCKF--CNHPDTGLQCTSAQVISSICECD----------RMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQT----------NPWAALYFVALMTFGNYVLFNLLVAILVEGFQESKEEE 896          

HSP 6 Score: 68.9366 bits (167), Expect = 6.540e-11
Identity = 90/304 (29.61%), Postives = 152/304 (50.00%), Query Frame = 2
Query: 5342 WRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLS-------------RHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRE 6214
            +R  I   V   +F   I   I +N ++M +E++  P  L V L+  N  FT++F +E L+K IA G   Y+ D +N  D  IV LSV  +  E          ++++R FR+LRI   LKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG   C+  +P TGL                 +F+NF  A +T+F+I T ++WN ++ + +          Q N       A +YFV  +    +VL N++VA+L++  +ES +   +  ++E++ +++  EE  E+ RE
Sbjct:  642 FREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQEGKGG------LSVLRTFRLLRI---LKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCKFCN--HPDTGLQCTSAQVISSICECDRMNFDNFLFATVTVFQILTQEDWNMVLFNGM---------AQTNPW-----AALYFVALMTFGNYVLFNLLVAILVEGFQESKEE--EKRQLEEDARKQAVEEEDERKRE 918          

HSP 7 Score: 65.4698 bits (158), Expect = 6.330e-10
Identity = 58/207 (28.02%), Postives = 100/207 (48.31%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG--------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXX-XXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVL 3121
            R  +  IV  +YF   I   I IN +SM +E++  P+ L   L+  N  F  +F +E  +K++A G   +    +N  D  IVIL +  +  E           + + V+R  R+ R+LKL++    +R  L  + + +  V    +L  L  FIF+ LG+ LFG   C   +      +  +F +   A +T+F+I T ++WN ++
Sbjct: 1438 RLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDNWNGIM 1644          

HSP 8 Score: 62.7734 bits (151), Expect = 4.304e-9
Identity = 80/290 (27.59%), Postives = 137/290 (47.24%), Query Frame = 2
Query:  290 LNENYDSLKISTSQTSFLPVMRTSDYNDQ-----SSICSRMRTSNEPSG------LYFNNDLDRSSYMVDSSAAEEERIENTEKN-------KDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMG-LLGPSGYFSESWNRLDMVIVIAGLIEC---IPSTGEMS-----LTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGIL 1078
            ++E  D  +++   +  LPV     Y  Q     S +C     +    G       Y       +S  +  + AEEE+    ++N       K     +  E   F +   +  R  CL+     WF+   +  I +NCITL M +P       +   + L    +   + F  E+M+K+ A G  +G + YF + WN LD ++V+  LI     + +TG+       +  +R +R LRPLR INR P ++++VM L+ +L  +GN++L+C   F IFGI+GVQ+++G++
Sbjct:  994 VSEGRDDSRLNRHASLVLPVANGVPYRRQRVHSWSGLCHHFNPNCPVHGRRALIETYAREKFLEASQELKQALAEEEKRNEAKQNTFVRKLLKKTCLHNRTEFSLFLMGPKNPLRIKCLQTTQKKWFDYTVLFFIGINCITLAMERP--SIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMM 1281          

HSP 9 Score: 60.4622 bits (145), Expect = 2.494e-8
Identity = 61/279 (21.86%), Postives = 123/279 (44.09%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQP--VLLTNTLEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLL---------RILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXX-----------------XXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGF 3235
             R K       ++F   +L  I IN +++ +E  + P        L  S  IF  +F  EM++K++A G       Y  +G+N+ DG +V++ L+ +A E  A+G S  + F ++         R L+++   P ++L ++ ++ ++  +     +   F  IF ILG+ LF          +                     R NFD+L  A++++F + +++ W +++  G+               W  +YF++ +    + + N+ V ++VE F
Sbjct: 1107 LRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSP-KIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENF 1384          

HSP 10 Score: 58.151 bits (139), Expect = 1.041e-7
Identity = 30/108 (27.78%), Postives = 55/108 (50.93%), Query Frame = 2
Query: 1322 TNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQ 1645
            T + C +     S CE          +NFDN  FA V +FQ+++ E W  +++      + W   YFV+L+  G++ + NL + ++   F E+K+ E  ++  + +KQ
Sbjct:  807 TGLQCTSAQVISSICEC-------DRMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQTNPWAALYFVALMTFGNYVLFNLLVAILVEGFQESKEEEKRQLEEDARKQ 907          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Celegans
Match: cca-1 (Voltage-dependent T-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASP4])

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 410/634 (64.67%), Postives = 492/634 (77.60%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMI-VLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRE-----------NQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCD------DDEIEKEVQREIDEENKEK 6205
            SLF++ P N  R  C    +KK FD  VLFFI +NCITLAMERPSIP  S ER+FL I+ Y+FTVIF  EM +KVIA G  +G+ +Y + GWN++DG+LVVISL +I   +L  G S +IFG++RV RLLR LRPLRVI+RAPG+KLVV TL+SSL+PIGNIVLICCTFFIIFGI GVQLFKG  Y+C GP+V +V   ++C  D RN W N +YNFDNLGQALMSLFVLSSKDGWV IMY G+DAVGV+ QP ENYNEW ++YFISFLLLVGFFVLNMFVGVVVENFHKC+E            +  + K +R         K+KK     PY+  Y H RL +HG+V SKYFDLAIA +IG+NVI+MAMEFYMMP+ L+  LK+LNY FT+VF +EA +K IA G KR+ I++WN+LD+ IVILS++GI+ EE +   +PIN TIIRV RVLRIARVLKLLKMAKGIR+LLDTV +ALPQVGNLG LFFLLFFIFAALGVELFG+LECS+ +PC GL  HAHF+NFGMAFLTLFRIATGDNWNGIMKD LR+ CD+S+ C+ NCCV PI+AP +FVIFVL++QFVLVNVVVAVLMKHLEES+K   +       + IE E+ +  D+E  E+
Sbjct: 1097 SLFLMGPKNPLRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHKCKEALEKEMREKEKEKRLKRKLKRQKFEESMAGKRKKMERNYPYYHDYGHTRLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDNWNGIMKDALRDDCDSSDHCETNCCVDPILAPCFFVIFVLISQFVLVNVVVAVLMKHLEESNKRDAEGPAEPTGENIENEITKSDDDEIVEE 1730          

HSP 2 Score: 409.453 bits (1051), Expect = 1.558e-115
Identity = 232/440 (52.73%), Postives = 299/440 (67.95%), Query Frame = 2
Query:  518 LPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDT-SCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPST---GEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHL------NSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERK---KQQSTSTLGSSI-------EPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
            LPYP + E       Q   PR W L+ +  PWF+++++AVI++NC+TLGMY+PCED   C T RC+IL   D+CIF++FA E++IKI A+G  GP+ Y S++WNRLD  IV+AG+ E +      G ++LTAIRTVRVLRPLRA+NRIPSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC ++L      N S     + L+ +Y    T+ +      +ICS  + NGL  CS++PP  +     +   CN + L   D + TN SC+NWN YY++C+    NP+ G+++FDNIGFAWVAIF VIS+E W DIMYYVQDAHSFW+W YFV LI+IG+FFMINLCLVVIATQF+ETK+RETERML ERK    + S S  GS I       E  + Y   ++ I    R   +   K+Y  + E+
Sbjct:  100 LPYPGFAEPALRCFYQARPPRKWALQMVMSPWFDRITMAVIMINCVTLGMYRPCEDGPDCDTYRCQILDIIDNCIFVYFAFEMVIKIMALGFYGPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLGGNINLTAIRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCVINLPKTISENQSALFNNVKLTRFYIPEDTSLE------YICSQPDANGLHTCSNLPPYTV-----DGVKCNLT-LDEYDKV-TNDSCINWNIYYNECQVMQRNPFQGSVSFDNIGFAWVAIFLVISLEGWTDIMYYVQDAHSFWNWIYFVLLIVIGAFFMINLCLVVIATQFAETKRRETERMLQERKMLLNRDSISCTGSEIGGASSKEEGDTVYAAFVRFIGHTFRRTKRAAKKKYTAYMEE 526          

HSP 3 Score: 292.738 bits (748), Expect = 4.006e-79
Identity = 171/276 (61.96%), Postives = 205/276 (74.28%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKL----AEKIHLEKHNEEK 3304
            FR+K++  V   +F RGIL+AIL+NTLSMG+EYH QP +LT  LEYSN+ F  LF +EMLLKI+A GL GY+++GFN+FDGGIV L ++EL QE G  GLSVLRTFRLLRILKLVRFMPALR QL+VML+TMDNV  FF LL+LFIFIFS LGM L              C   +  +   +CDR NFD+ L+A VTVFQILTQEDWN VL +GM+QT+ WAALYFVALMTFGNYVLFNLLVAILVEGF   + +E +     A K  +E+ +E K
Sbjct:  642 FREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQE-GKGGLSVLRTFRLLRILKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCKFCNHPDTGLQCTSAQVISSICECDRMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQTNPWAALYFVALMTFGNYVLFNLLVAILVEGFQESKEEEKRQLEEDARKQAVEEEDERK 916          

HSP 4 Score: 103.219 bits (256), Expect = 2.543e-21
Identity = 96/346 (27.75%), Postives = 152/346 (43.93%), Query Frame = 2
Query: 4427 FDNIVLFFIALNCITLAMERP--SIPQKSRER-EFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKF-------------------------------------YYCSGPDVAHVKNFS----------ECN----------NDKRNTWKNQQYN---------------FDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            FD I +  I +NC+TL M RP    P     R + L I +    V FA EM IK++A G   G  +Y+   WN +D  +V+  +A+ ++   +G +  +  I    R +R LRPLR ++R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G                                       Y CS PD   +   S          +CN          ND    W N  YN               FDN+G A +++F++ S +GW  IMY   DA          ++ W  +YF+  +++  FF++N+ + V+   F + +  +
Sbjct:  132 FDRITMAVIMINCVTLGMYRPCEDGPDCDTYRCQILDIIDNCIFVYFAFEMVIKIMALGFY-GPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLGGNINLTAI----RTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCVINLPKTISENQSALFNNVKLTRFYIPEDTSLEYICSQPDANGLHTCSNLPPYTVDGVKCNLTLDEYDKVTNDSCINW-NIYYNECQVMQRNPFQGSVSFDNIGFAWVAIFLVISLEGWTDIMYYVQDA----------HSFWNWIYFVLLIVIGAFFMINLCLVVIATQFAETKRRE 461          

HSP 5 Score: 91.6633 bits (226), Expect = 8.679e-18
Identity = 76/295 (25.76%), Postives = 135/295 (45.76%), Query Frame = 2
Query: 4388 FRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTI----TNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAH-------VKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            FR   Q  +    F   +L  I +N +++ +E    P      E LT+    +N  FT +FA+EM +K+IA GL      YL  G+N+ DG +V +S+ ++              +LR FRLLR L+ +R +   P L+  +  +L ++  +     +   F  IF   G+ LF  KF  C+ PD          + +  EC+          + NFDN   A +++F + +++ W  +++ G+             N W  LYF++ +    + + N+ V ++VE F + +E +
Sbjct:  642 FREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQP------EILTVILEYSNLFFTALFALEMLLKIIASGLF----GYLADGFNLFDGGIVALSVLELF-----QEGKGGLSVLRTFRLLRILKLVRFM---PALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCKF--CNHPDTGLQCTSAQVISSICECD----------RMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQT----------NPWAALYFVALMTFGNYVLFNLLVAILVEGFQESKEEE 896          

HSP 6 Score: 68.9366 bits (167), Expect = 6.540e-11
Identity = 90/304 (29.61%), Postives = 152/304 (50.00%), Query Frame = 2
Query: 5342 WRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLS-------------RHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRE 6214
            +R  I   V   +F   I   I +N ++M +E++  P  L V L+  N  FT++F +E L+K IA G   Y+ D +N  D  IV LSV  +  E          ++++R FR+LRI   LKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG   C+  +P TGL                 +F+NF  A +T+F+I T ++WN ++ + +          Q N       A +YFV  +    +VL N++VA+L++  +ES +   +  ++E++ +++  EE  E+ RE
Sbjct:  642 FREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQEGKGG------LSVLRTFRLLRI---LKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCKFCN--HPDTGLQCTSAQVISSICECDRMNFDNFLFATVTVFQILTQEDWNMVLFNGM---------AQTNPW-----AALYFVALMTFGNYVLFNLLVAILVEGFQESKEE--EKRQLEEDARKQAVEEEDERKRE 918          

HSP 7 Score: 65.4698 bits (158), Expect = 6.330e-10
Identity = 58/207 (28.02%), Postives = 100/207 (48.31%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG--------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXX-XXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVL 3121
            R  +  IV  +YF   I   I IN +SM +E++  P+ L   L+  N  F  +F +E  +K++A G   +    +N  D  IVIL +  +  E           + + V+R  R+ R+LKL++    +R  L  + + +  V    +L  L  FIF+ LG+ LFG   C   +      +  +F +   A +T+F+I T ++WN ++
Sbjct: 1438 RLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDNWNGIM 1644          

HSP 8 Score: 62.7734 bits (151), Expect = 4.304e-9
Identity = 80/290 (27.59%), Postives = 137/290 (47.24%), Query Frame = 2
Query:  290 LNENYDSLKISTSQTSFLPVMRTSDYNDQ-----SSICSRMRTSNEPSG------LYFNNDLDRSSYMVDSSAAEEERIENTEKN-------KDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMG-LLGPSGYFSESWNRLDMVIVIAGLIEC---IPSTGEMS-----LTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGIL 1078
            ++E  D  +++   +  LPV     Y  Q     S +C     +    G       Y       +S  +  + AEEE+    ++N       K     +  E   F +   +  R  CL+     WF+   +  I +NCITL M +P       +   + L    +   + F  E+M+K+ A G  +G + YF + WN LD ++V+  LI     + +TG+       +  +R +R LRPLR INR P ++++VM L+ +L  +GN++L+C   F IFGI+GVQ+++G++
Sbjct:  994 VSEGRDDSRLNRHASLVLPVANGVPYRRQRVHSWSGLCHHFNPNCPVHGRRALIETYAREKFLEASQELKQALAEEEKRNEAKQNTFVRKLLKKTCLHNRTEFSLFLMGPKNPLRIKCLQTTQKKWFDYTVLFFIGINCITLAMERP--SIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMM 1281          

HSP 9 Score: 60.4622 bits (145), Expect = 2.494e-8
Identity = 61/279 (21.86%), Postives = 123/279 (44.09%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQP--VLLTNTLEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLL---------RILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXX-----------------XXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGF 3235
             R K       ++F   +L  I IN +++ +E  + P        L  S  IF  +F  EM++K++A G       Y  +G+N+ DG +V++ L+ +A E  A+G S  + F ++         R L+++   P ++L ++ ++ ++  +     +   F  IF ILG+ LF          +                     R NFD+L  A++++F + +++ W +++  G+               W  +YF++ +    + + N+ V ++VE F
Sbjct: 1107 LRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSP-KIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENF 1384          

HSP 10 Score: 58.151 bits (139), Expect = 1.041e-7
Identity = 30/108 (27.78%), Postives = 55/108 (50.93%), Query Frame = 2
Query: 1322 TNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQ 1645
            T + C +     S CE          +NFDN  FA V +FQ+++ E W  +++      + W   YFV+L+  G++ + NL + ++   F E+K+ E  ++  + +KQ
Sbjct:  807 TGLQCTSAQVISSICEC-------DRMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQTNPWAALYFVALMTFGNYVLFNLLVAILVEGFQESKEEEKRQLEEDARKQ 907          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Celegans
Match: cca-1 (Voltage-dependent T-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASP4])

HSP 1 Score: 676.011 bits (1743), Expect = 0.000e+0
Identity = 410/634 (64.67%), Postives = 492/634 (77.60%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMI-VLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRE-----------NQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCD------DDEIEKEVQREIDEENKEK 6205
            SLF++ P N  R  C    +KK FD  VLFFI +NCITLAMERPSIP  S ER+FL I+ Y+FTVIF  EM +KVIA G  +G+ +Y + GWN++DG+LVVISL +I   +L  G S +IFG++RV RLLR LRPLRVI+RAPG+KLVV TL+SSL+PIGNIVLICCTFFIIFGI GVQLFKG  Y+C GP+V +V   ++C  D RN W N +YNFDNLGQALMSLFVLSSKDGWV IMY G+DAVGV+ QP ENYNEW ++YFISFLLLVGFFVLNMFVGVVVENFHKC+E            +  + K +R         K+KK     PY+  Y H RL +HG+V SKYFDLAIA +IG+NVI+MAMEFYMMP+ L+  LK+LNY FT+VF +EA +K IA G KR+ I++WN+LD+ IVILS++GI+ EE +   +PIN TIIRV RVLRIARVLKLLKMAKGIR+LLDTV +ALPQVGNLG LFFLLFFIFAALGVELFG+LECS+ +PC GL  HAHF+NFGMAFLTLFRIATGDNWNGIMKD LR+ CD+S+ C+ NCCV PI+AP +FVIFVL++QFVLVNVVVAVLMKHLEES+K   +       + IE E+ +  D+E  E+
Sbjct: 1138 SLFLMGPKNPLRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHKCKEALEKEMREKEKEKRLKRKLKRQKFEESMAGKRKKMERNYPYYHDYGHTRLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDNWNGIMKDALRDDCDSSDHCETNCCVDPILAPCFFVIFVLISQFVLVNVVVAVLMKHLEESNKRDAEGPAEPTGENIENEITKSDDDEIVEE 1771          

HSP 2 Score: 409.453 bits (1051), Expect = 2.375e-115
Identity = 232/440 (52.73%), Postives = 299/440 (67.95%), Query Frame = 2
Query:  518 LPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDT-SCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPS---TGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHL------NSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERK---KQQSTSTLGSSI-------EPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
            LPYP + E       Q   PR W L+ +  PWF+++++AVI++NC+TLGMY+PCED   C T RC+IL   D+CIF++FA E++IKI A+G  GP+ Y S++WNRLD  IV+AG+ E +      G ++LTAIRTVRVLRPLRA+NRIPSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC ++L      N S     + L+ +Y    T+ +      +ICS  + NGL  CS++PP  +     +   CN + L   D + TN SC+NWN YY++C+    NP+ G+++FDNIGFAWVAIF VIS+E W DIMYYVQDAHSFW+W YFV LI+IG+FFMINLCLVVIATQF+ETK+RETERML ERK    + S S  GS I       E  + Y   ++ I    R   +   K+Y  + E+
Sbjct:  100 LPYPGFAEPALRCFYQARPPRKWALQMVMSPWFDRITMAVIMINCVTLGMYRPCEDGPDCDTYRCQILDIIDNCIFVYFAFEMVIKIMALGFYGPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLGGNINLTAIRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCVINLPKTISENQSALFNNVKLTRFYIPEDTSLE------YICSQPDANGLHTCSNLPPYTV-----DGVKCNLT-LDEYDKV-TNDSCINWNIYYNECQVMQRNPFQGSVSFDNIGFAWVAIFLVISLEGWTDIMYYVQDAHSFWNWIYFVLLIVIGAFFMINLCLVVIATQFAETKRRETERMLQERKMLLNRDSISCTGSEIGGASSKEEGDTVYAAFVRFIGHTFRRTKRAAKKKYTAYMEE 526          

HSP 3 Score: 280.026 bits (715), Expect = 3.083e-75
Identity = 175/317 (55.21%), Postives = 210/317 (66.25%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLX-----XXXXXXXXXXXXXXDRKNFDSLLWAI------------------------------------------------VTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKL----AEKIHLEKHNEEK 3304
            FR+K++  V   +F RGIL+AIL+NTLSMG+EYH QP +LT  LEYSN+ F  LF +EMLLKI+A GL GY+++GFN+FDGGIV L ++EL QE G  GLSVLRTFRLLRILKLVRFMPALR QL+VML+TMDNV  FF LL+LFIFIFSILGM+LF       +        +KC+RKNFD+LLWA+                                                VTVFQILTQEDWN VL +GM+QT+ WAALYFVALMTFGNYVLFNLLVAILVEGF   + +E +     A K  +E+ +E K
Sbjct:  642 FREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQE-GKGGLSVLRTFRLLRILKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSILGMNLFGCKFCKVEEKFLGGLAKKCERKNFDTLLWALITVTLGMVLFGCKFCNHPDTGLQCTSAQVISSICECDRMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQTNPWAALYFVALMTFGNYVLFNLLVAILVEGFQESKEEEKRQLEEDARKQAVEEEDERK 957          

HSP 4 Score: 102.834 bits (255), Expect = 2.763e-21
Identity = 96/346 (27.75%), Postives = 152/346 (43.93%), Query Frame = 2
Query: 4427 FDNIVLFFIALNCITLAMERP--SIPQKSRER-EFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKF-------------------------------------YYCSGPDVAHVKNFS----------ECN----------NDKRNTWKNQQYN---------------FDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            FD I +  I +NC+TL M RP    P     R + L I +    V FA EM IK++A G   G  +Y+   WN +D  +V+  +A+ ++   +G +  +  I    R +R LRPLR ++R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G                                       Y CS PD   +   S          +CN          ND    W N  YN               FDN+G A +++F++ S +GW  IMY   DA          ++ W  +YF+  +++  FF++N+ + V+   F + +  +
Sbjct:  132 FDRITMAVIMINCVTLGMYRPCEDGPDCDTYRCQILDIIDNCIFVYFAFEMVIKIMALGFY-GPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLGGNINLTAI----RTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCVINLPKTISENQSALFNNVKLTRFYIPEDTSLEYICSQPDANGLHTCSNLPPYTVDGVKCNLTLDEYDKVTNDSCINW-NIYYNECQVMQRNPFQGSVSFDNIGFAWVAIFLVISLEGWTDIMYYVQDA----------HSFWNWIYFVLLIVIGAFFMINLCLVVIATQFAETKRRE 461          

HSP 5 Score: 78.1814 bits (191), Expect = 1.075e-13
Identity = 77/334 (23.05%), Postives = 137/334 (41.02%), Query Frame = 2
Query: 4388 FRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTI----TNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKF---------------------------------------YYCSGPDVAH-------VKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            FR   Q  +    F   +L  I +N +++ +E    P      E LT+    +N  FT +FA+EM +K+IA GL      YL  G+N+ DG +V +S+ ++              +LR FRLLR L+ +R +   P L+  +  +L ++  +     +   F  IF I G+ LF  KF                                        +C+ PD          + +  EC+          + NFDN   A +++F + +++ W  +++ G+             N W  LYF++ +    + + N+ V ++VE F + +E +
Sbjct:  642 FREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQP------EILTVILEYSNLFFTALFALEMLLKIIASGLF----GYLADGFNLFDGGIVALSVLELF-----QEGKGGLSVLRTFRLLRILKLVRFM---PALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSILGMNLFGCKFCKVEEKFLGGLAKKCERKNFDTLLWALITVTLGMVLFGCKFCNHPDTGLQCTSAQVISSICECD----------RMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQT----------NPWAALYFVALMTFGNYVLFNLLVAILVEGFQESKEEE 937          

HSP 6 Score: 65.4698 bits (158), Expect = 7.208e-10
Identity = 58/207 (28.02%), Postives = 100/207 (48.31%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG--------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXX-XXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVL 3121
            R  +  IV  +YF   I   I IN +SM +E++  P+ L   L+  N  F  +F +E  +K++A G   +    +N  D  IVIL +  +  E           + + V+R  R+ R+LKL++    +R  L  + + +  V    +L  L  FIF+ LG+ LFG   C   +      +  +F +   A +T+F+I T ++WN ++
Sbjct: 1479 RLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDNWNGIM 1685          

HSP 7 Score: 62.7734 bits (151), Expect = 4.899e-9
Identity = 80/290 (27.59%), Postives = 137/290 (47.24%), Query Frame = 2
Query:  290 LNENYDSLKISTSQTSFLPVMRTSDYNDQ-----SSICSRMRTSNEPSG------LYFNNDLDRSSYMVDSSAAEEERIENTEKN-------KDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMG-LLGPSGYFSESWNRLDMVIVIAGLIEC---IPSTGEMS-----LTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGIL 1078
            ++E  D  +++   +  LPV     Y  Q     S +C     +    G       Y       +S  +  + AEEE+    ++N       K     +  E   F +   +  R  CL+     WF+   +  I +NCITL M +P       +   + L    +   + F  E+M+K+ A G  +G + YF + WN LD ++V+  LI     + +TG+       +  +R +R LRPLR INR P ++++VM L+ +L  +GN++L+C   F IFGI+GVQ+++G++
Sbjct: 1035 VSEGRDDSRLNRHASLVLPVANGVPYRRQRVHSWSGLCHHFNPNCPVHGRRALIETYAREKFLEASQELKQALAEEEKRNEAKQNTFVRKLLKKTCLHNRTEFSLFLMGPKNPLRIKCLQTTQKKWFDYTVLFFIGINCITLAMERP--SIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMM 1322          

HSP 8 Score: 60.077 bits (144), Expect = 2.791e-8
Identity = 61/279 (21.86%), Postives = 123/279 (44.09%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQP--VLLTNTLEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLL---------RILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXX-----------------XXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGF 3235
             R K       ++F   +L  I IN +++ +E  + P        L  S  IF  +F  EM++K++A G       Y  +G+N+ DG +V++ L+ +A E  A+G S  + F ++         R L+++   P ++L ++ ++ ++  +     +   F  IF ILG+ LF          +                     R NFD+L  A++++F + +++ W +++  G+               W  +YF++ +    + + N+ V ++VE F
Sbjct: 1148 LRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSP-KIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENF 1425          

HSP 9 Score: 58.151 bits (139), Expect = 1.108e-7
Identity = 30/108 (27.78%), Postives = 55/108 (50.93%), Query Frame = 2
Query: 1322 TNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQ 1645
            T + C +     S CE          +NFDN  FA V +FQ+++ E W  +++      + W   YFV+L+  G++ + NL + ++   F E+K+ E  ++  + +KQ
Sbjct:  848 TGLQCTSAQVISSICEC-------DRMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQTNPWAALYFVALMTFGNYVLFNLLVAILVEGFQESKEEEKRQLEEDARKQ 948          

HSP 10 Score: 56.225 bits (134), Expect = 4.322e-7
Identity = 62/202 (30.69%), Postives = 97/202 (48.02%), Query Frame = 2
Query: 5342 WRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECS-DYNPCTGLSRHAHFENFGMAFLTLFRIATG 5944
            +R  I   V   +F   I   I +N ++M +E++  P  L V L+  N  FT++F +E L+K IA G   Y+ D +N  D  IV LSV  +  E          ++++R FR+LRI   LKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG   C  +     GL++    +NF      L  +  G
Sbjct:  642 FREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQEGKGG------LSVLRTFRLLRI---LKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSILGMNLFGCKFCKVEEKFLGGLAKKCERKNFDTLLWALITVTLG 834          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Celegans
Match: cca-1 (Voltage-dependent T-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASP4])

HSP 1 Score: 676.011 bits (1743), Expect = 0.000e+0
Identity = 410/634 (64.67%), Postives = 492/634 (77.60%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMI-VLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRE-----------NQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCD------DDEIEKEVQREIDEENKEK 6205
            SLF++ P N  R  C    +KK FD  VLFFI +NCITLAMERPSIP  S ER+FL I+ Y+FTVIF  EM +KVIA G  +G+ +Y + GWN++DG+LVVISL +I   +L  G S +IFG++RV RLLR LRPLRVI+RAPG+KLVV TL+SSL+PIGNIVLICCTFFIIFGI GVQLFKG  Y+C GP+V +V   ++C  D RN W N +YNFDNLGQALMSLFVLSSKDGWV IMY G+DAVGV+ QP ENYNEW ++YFISFLLLVGFFVLNMFVGVVVENFHKC+E            +  + K +R         K+KK     PY+  Y H RL +HG+V SKYFDLAIA +IG+NVI+MAMEFYMMP+ L+  LK+LNY FT+VF +EA +K IA G KR+ I++WN+LD+ IVILS++GI+ EE +   +PIN TIIRV RVLRIARVLKLLKMAKGIR+LLDTV +ALPQVGNLG LFFLLFFIFAALGVELFG+LECS+ +PC GL  HAHF+NFGMAFLTLFRIATGDNWNGIMKD LR+ CD+S+ C+ NCCV PI+AP +FVIFVL++QFVLVNVVVAVLMKHLEES+K   +       + IE E+ +  D+E  E+
Sbjct: 1138 SLFLMGPKNPLRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHKCKEALEKEMREKEKEKRLKRKLKRQKFEESMAGKRKKMERNYPYYHDYGHTRLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDNWNGIMKDALRDDCDSSDHCETNCCVDPILAPCFFVIFVLISQFVLVNVVVAVLMKHLEESNKRDAEGPAEPTGENIENEITKSDDDEIVEE 1771          

HSP 2 Score: 409.453 bits (1051), Expect = 2.375e-115
Identity = 232/440 (52.73%), Postives = 299/440 (67.95%), Query Frame = 2
Query:  518 LPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDT-SCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPS---TGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHL------NSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERK---KQQSTSTLGSSI-------EPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
            LPYP + E       Q   PR W L+ +  PWF+++++AVI++NC+TLGMY+PCED   C T RC+IL   D+CIF++FA E++IKI A+G  GP+ Y S++WNRLD  IV+AG+ E +      G ++LTAIRTVRVLRPLRA+NRIPSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC ++L      N S     + L+ +Y    T+ +      +ICS  + NGL  CS++PP  +     +   CN + L   D + TN SC+NWN YY++C+    NP+ G+++FDNIGFAWVAIF VIS+E W DIMYYVQDAHSFW+W YFV LI+IG+FFMINLCLVVIATQF+ETK+RETERML ERK    + S S  GS I       E  + Y   ++ I    R   +   K+Y  + E+
Sbjct:  100 LPYPGFAEPALRCFYQARPPRKWALQMVMSPWFDRITMAVIMINCVTLGMYRPCEDGPDCDTYRCQILDIIDNCIFVYFAFEMVIKIMALGFYGPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLGGNINLTAIRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCVINLPKTISENQSALFNNVKLTRFYIPEDTSLE------YICSQPDANGLHTCSNLPPYTV-----DGVKCNLT-LDEYDKV-TNDSCINWNIYYNECQVMQRNPFQGSVSFDNIGFAWVAIFLVISLEGWTDIMYYVQDAHSFWNWIYFVLLIVIGAFFMINLCLVVIATQFAETKRRETERMLQERKMLLNRDSISCTGSEIGGASSKEEGDTVYAAFVRFIGHTFRRTKRAAKKKYTAYMEE 526          

HSP 3 Score: 280.026 bits (715), Expect = 3.083e-75
Identity = 175/317 (55.21%), Postives = 210/317 (66.25%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLX-----XXXXXXXXXXXXXXDRKNFDSLLWAI------------------------------------------------VTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKL----AEKIHLEKHNEEK 3304
            FR+K++  V   +F RGIL+AIL+NTLSMG+EYH QP +LT  LEYSN+ F  LF +EMLLKI+A GL GY+++GFN+FDGGIV L ++EL QE G  GLSVLRTFRLLRILKLVRFMPALR QL+VML+TMDNV  FF LL+LFIFIFSILGM+LF       +        +KC+RKNFD+LLWA+                                                VTVFQILTQEDWN VL +GM+QT+ WAALYFVALMTFGNYVLFNLLVAILVEGF   + +E +     A K  +E+ +E K
Sbjct:  642 FREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQE-GKGGLSVLRTFRLLRILKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSILGMNLFGCKFCKVEEKFLGGLAKKCERKNFDTLLWALITVTLGMVLFGCKFCNHPDTGLQCTSAQVISSICECDRMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQTNPWAALYFVALMTFGNYVLFNLLVAILVEGFQESKEEEKRQLEEDARKQAVEEEDERK 957          

HSP 4 Score: 102.834 bits (255), Expect = 2.763e-21
Identity = 96/346 (27.75%), Postives = 152/346 (43.93%), Query Frame = 2
Query: 4427 FDNIVLFFIALNCITLAMERP--SIPQKSRER-EFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKF-------------------------------------YYCSGPDVAHVKNFS----------ECN----------NDKRNTWKNQQYN---------------FDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            FD I +  I +NC+TL M RP    P     R + L I +    V FA EM IK++A G   G  +Y+   WN +D  +V+  +A+ ++   +G +  +  I    R +R LRPLR ++R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G                                       Y CS PD   +   S          +CN          ND    W N  YN               FDN+G A +++F++ S +GW  IMY   DA          ++ W  +YF+  +++  FF++N+ + V+   F + +  +
Sbjct:  132 FDRITMAVIMINCVTLGMYRPCEDGPDCDTYRCQILDIIDNCIFVYFAFEMVIKIMALGFY-GPAAYMSDTWNRLDFFIVMAGIAEFVLHEYLGGNINLTAI----RTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCVINLPKTISENQSALFNNVKLTRFYIPEDTSLEYICSQPDANGLHTCSNLPPYTVDGVKCNLTLDEYDKVTNDSCINW-NIYYNECQVMQRNPFQGSVSFDNIGFAWVAIFLVISLEGWTDIMYYVQDA----------HSFWNWIYFVLLIVIGAFFMINLCLVVIATQFAETKRRE 461          

HSP 5 Score: 78.1814 bits (191), Expect = 1.075e-13
Identity = 77/334 (23.05%), Postives = 137/334 (41.02%), Query Frame = 2
Query: 4388 FRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTI----TNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKF---------------------------------------YYCSGPDVAH-------VKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            FR   Q  +    F   +L  I +N +++ +E    P      E LT+    +N  FT +FA+EM +K+IA GL      YL  G+N+ DG +V +S+ ++              +LR FRLLR L+ +R +   P L+  +  +L ++  +     +   F  IF I G+ LF  KF                                        +C+ PD          + +  EC+          + NFDN   A +++F + +++ W  +++ G+             N W  LYF++ +    + + N+ V ++VE F + +E +
Sbjct:  642 FREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQP------EILTVILEYSNLFFTALFALEMLLKIIASGLF----GYLADGFNLFDGGIVALSVLELF-----QEGKGGLSVLRTFRLLRILKLVRFM---PALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSILGMNLFGCKFCKVEEKFLGGLAKKCERKNFDTLLWALITVTLGMVLFGCKFCNHPDTGLQCTSAQVISSICECD----------RMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQT----------NPWAALYFVALMTFGNYVLFNLLVAILVEGFQESKEEE 937          

HSP 6 Score: 65.4698 bits (158), Expect = 7.208e-10
Identity = 58/207 (28.02%), Postives = 100/207 (48.31%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG--------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXX-XXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVL 3121
            R  +  IV  +YF   I   I IN +SM +E++  P+ L   L+  N  F  +F +E  +K++A G   +    +N  D  IVIL +  +  E           + + V+R  R+ R+LKL++    +R  L  + + +  V    +L  L  FIF+ LG+ LFG   C   +      +  +F +   A +T+F+I T ++WN ++
Sbjct: 1479 RLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFGKLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDNWNGIM 1685          

HSP 7 Score: 62.7734 bits (151), Expect = 4.899e-9
Identity = 80/290 (27.59%), Postives = 137/290 (47.24%), Query Frame = 2
Query:  290 LNENYDSLKISTSQTSFLPVMRTSDYNDQ-----SSICSRMRTSNEPSG------LYFNNDLDRSSYMVDSSAAEEERIENTEKN-------KDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMG-LLGPSGYFSESWNRLDMVIVIAGLIEC---IPSTGEMS-----LTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGIL 1078
            ++E  D  +++   +  LPV     Y  Q     S +C     +    G       Y       +S  +  + AEEE+    ++N       K     +  E   F +   +  R  CL+     WF+   +  I +NCITL M +P       +   + L    +   + F  E+M+K+ A G  +G + YF + WN LD ++V+  LI     + +TG+       +  +R +R LRPLR INR P ++++VM L+ +L  +GN++L+C   F IFGI+GVQ+++G++
Sbjct: 1035 VSEGRDDSRLNRHASLVLPVANGVPYRRQRVHSWSGLCHHFNPNCPVHGRRALIETYAREKFLEASQELKQALAEEEKRNEAKQNTFVRKLLKKTCLHNRTEFSLFLMGPKNPLRIKCLQTTQKKWFDYTVLFFIGINCITLAMERP--SIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMM 1322          

HSP 8 Score: 60.077 bits (144), Expect = 2.791e-8
Identity = 61/279 (21.86%), Postives = 123/279 (44.09%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQP--VLLTNTLEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLL---------RILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXX-----------------XXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGF 3235
             R K       ++F   +L  I IN +++ +E  + P        L  S  IF  +F  EM++K++A G       Y  +G+N+ DG +V++ L+ +A E  A+G S  + F ++         R L+++   P ++L ++ ++ ++  +     +   F  IF ILG+ LF          +                     R NFD+L  A++++F + +++ W +++  G+               W  +YF++ +    + + N+ V ++VE F
Sbjct: 1148 LRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSP-KIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENF 1425          

HSP 9 Score: 58.151 bits (139), Expect = 1.108e-7
Identity = 30/108 (27.78%), Postives = 55/108 (50.93%), Query Frame = 2
Query: 1322 TNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQ 1645
            T + C +     S CE          +NFDN  FA V +FQ+++ E W  +++      + W   YFV+L+  G++ + NL + ++   F E+K+ E  ++  + +KQ
Sbjct:  848 TGLQCTSAQVISSICEC-------DRMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQTNPWAALYFVALMTFGNYVLFNLLVAILVEGFQESKEEEKRQLEEDARKQ 948          

HSP 10 Score: 56.225 bits (134), Expect = 4.322e-7
Identity = 62/202 (30.69%), Postives = 97/202 (48.02%), Query Frame = 2
Query: 5342 WRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECS-DYNPCTGLSRHAHFENFGMAFLTLFRIATG 5944
            +R  I   V   +F   I   I +N ++M +E++  P  L V L+  N  FT++F +E L+K IA G   Y+ D +N  D  IV LSV  +  E          ++++R FR+LRI   LKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG   C  +     GL++    +NF      L  +  G
Sbjct:  642 FREKIQKFVICDHFTRGILVAILVNTLSMGVEYHQQPEILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQEGKGG------LSVLRTFRLLRI---LKLVRFMPALRYQLVVMLRTMDNVTVFFGLLVLFIFIFSILGMNLFGCKFCKVEEKFLGGLAKKCERKNFDTLLWALITVTLG 834          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1T (gene:FBgn0264386 transcript:FBtr0112953)

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 441/635 (69.45%), Postives = 518/635 (81.57%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK---NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRG 6253
            SL++   DNRFR  C   + +K FDN+VL FIALNCITLAMERP+IP  S ER FL   NYVFTV+F VEM IKV+A G+  G  +Y  SGWN+MDG LV IS+ D+++ LI   S RIFGILRVFRLLR+LRPLRVI+RAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGI GVQLFKG FYYC G ++  V+N  EC     N W N++YNFD+LG+ALMSLFVLSS+DGWV IMYTGLDAVGV+QQP  NYNEW LLYFI+F+LLVGFFVLNMFVGVVVENFH+CRE QEKEEK RRAAKRA ++EKK+++M +PPY+  Y   R+ +H +V SKYFDLAIA +IGLNV+TMAME+Y MP  L+ ALK  NY FT+VFI+EA +K +A G K Y+ DRWNQLDV IV+LS+ GIV+EE++   ++ IPIN TIIRV RVLRIARVLKLLKMA GIRALLDTV+QALPQVGNLGLLFFLLFFIFAALGVELFGRLECSD  PC GL  HAHF NFGMAFLTLFR+ATGDNWNGIMKDTLR+ CD++ +C +NCCVS +IAPI+FVIFVLMAQFVLVNVVVAVLMKHLEESHK M D+ ++E E++RE+  E +    + +   + E +++ 
Sbjct: 2141 SLYIFPEDNRFRQICTWFVNQKWFDNVVLLFIALNCITLAMERPNIPPSSTERLFLATANYVFTVVFTVEMFIKVVATGMFYGHDAYFTSGWNIMDGSLVTISIIDLLMSLISESSPRIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGTFYYCEGENIKGVRNADECRRIPGNVWTNRKYNFDDLGKALMSLFVLSSRDGWVNIMYTGLDAVGVDQQPIVNYNEWRLLYFIAFILLVGFFVLNMFVGVVVENFHRCREEQEKEEKIRRAAKRALQMEKKRRRMHEPPYYTNYSPTRMFVHNVVTSKYFDLAIAAVIGLNVVTMAMEYYKMPSGLKYALKIFNYFFTAVFILEANMKLVALGWKLYLKDRWNQLDVGIVLLSIVGIVLEELETNTHQIIPINPTIIRVMRVLRIARVLKLLKMANGIRALLDTVMQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDEIPCQGLGEHAHFANFGMAFLTLFRVATGDNWNGIMKDTLRDNCDDAADCVRNCCVSSVIAPIFFVIFVLMAQFVLVNVVVAVLMKHLEESHKQMEDELDMEVELERELVREQEFAQEQKLCQQLAEAQSKA 2775          

HSP 2 Score: 451.825 bits (1161), Expect = 2.856e-127
Identity = 255/450 (56.67%), Postives = 312/450 (69.33%), Query Frame = 2
Query:  515 DLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKK---QQSTSTLGSSIEPQSCYHEIIKLIS----RFCRHLLKTV-IKRYERFSEKH------ENLTYFTKRLVFMH 1822
            +LPYP +PE     L Q   PR+WCL  I+ PWFE++SI VI++NCITLGMY+PC D +C T RCKIL  FD  IF FFA+E+ IK+ AMG+ G + Y ++SWNRLD  IV+AGL+E +     ++LTAIRT+RVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGI+GVQ+W+GILR RC L       +P L LS YY       + S  +D+ICS  N +G+  C + PP  I      + VCN+ A     N PTN SCVNWNQYY+ C+    NP+ G I+FDNIG AWVAIF VIS+E W DIMYYVQDAHSFWDW YFV LI+IGSFFMINLCLVVIATQFSETKKRE ERM  ER +     + ++  ++ EP +CY EI+K I+    RF R +LK   + +Y+R   K       +NLT+   R+   H
Sbjct:  270 NLPYPGFPEISIRALTQYTRPRNWCLMLITNPWFERVSILVILLNCITLGMYQPCVDDACVTNRCKILQIFDDIIFAFFALEMTIKMVAMGICGKNTYLADSWNRLDFFIVLAGLLEYVMHVENLNLTAIRTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWEGILRQRCSLMRTEGMVYP-LTLSQYY-------EFSKDQDYICSTPNDSGMHLCGNFPPYRI-----GSLVCNEEAKLFDFNEPTNTSCVNWNQYYTTCKQSGENPFQGTISFDNIGMAWVAIFLVISLEGWTDIMYYVQDAHSFWDWIYFVLLIVIGSFFMINLCLVVIATQFSETKKREMERMRQERARYTSTSTLASSTNNSEPATCYAEIVKYIAHLWRRFKRRMLKKYRLYKYQRQQRKEGLLPNADNLTFSPSRIKCHH 706          

HSP 3 Score: 283.108 bits (723), Expect = 8.758e-76
Identity = 178/285 (62.46%), Postives = 216/285 (75.79%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQ-------EGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXX-----------------XXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMA 3310
            R+ ++ +V H+YFQ+GIL+AILINTLSMGIEYHNQP  LT  +E SN++F+G+F VEMLLK++AEG   YI+NGFNVFDG IVIL  +E+ Q        GG SGLSVLRTFRLLRILKLVRFMP LR QL VML+TMDNVA FF+LL+LFIFIFSILGM LFG K                     ++ + +CDRK+F+++LWA VTVFQILTQEDWN VL +GM +TS WAALYFVALMTFGNYVLFNLLVAILVEGFS+ER +  +  ++  ++K  EE +A
Sbjct: 1221 RRYIRRLVEHKYFQQGILLAILINTLSMGIEYHNQPPELTAIVETSNVVFSGIFAVEMLLKVVAEGPFRYIANGFNVFDGIIVILSAIEICQTFMGNGTGGGGSGLSVLRTFRLLRILKLVRFMPNLRRQLFVMLRTMDNVAVFFSLLVLFIFIFSILGMYLFGGKFCKFLDESGLERECTCPEIISRHPQCECDRKHFNNILWATVTVFQILTQEDWNVVLFNGMEKTSHWAALYFVALMTFGNYVLFNLLVAILVEGFSSERNERREREQRELVKKLREETLA 1505          

HSP 4 Score: 116.701 bits (291), Expect = 2.792e-25
Identity = 101/362 (27.90%), Postives = 168/362 (46.41%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQK--SREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG-----------------------------KFYYCSGP----------------------DVAHVKNFSECNNDKRNTWKNQQY---------------NFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            S+  L+   R RN C  L+    F+ + +  I LNCITL M +P +     +   + L I + +    FA+EMTIK++A G+  GK++YL   WN +D  +V+  L + ++     H   +   L   R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL++G                             + Y CS P                      + A + +F+E  N     W NQ Y               +FDN+G A +++F++ S +GW  IMY   DA          ++ W  +YF+  +++  FF++N+ + V+   F + ++ +
Sbjct:  280 SIRALTQYTRPRNWCLMLITNPWFERVSILVILLNCITLGMYQPCVDDACVTNRCKILQIFDDIIFAFFALEMTIKMVAMGI-CGKNTYLADSWNRLDFFIVLAGLLEYVM-----HVENLN--LTAIRTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWEGILRQRCSLMRTEGMVYPLTLSQYYEFSKDQDYICSTPNDSGMHLCGNFPPYRIGSLVCNEEAKLFDFNEPTNTSCVNW-NQYYTTCKQSGENPFQGTISFDNIGMAWVAIFLVISLEGWTDIMYYVQDA----------HSFWDWIYFVLLIVIGSFFMINLCLVVIATQFSETKKRE 622          

HSP 5 Score: 98.2117 bits (243), Expect = 1.157e-19
Identity = 76/316 (24.05%), Postives = 145/316 (45.89%), Query Frame = 2
Query: 4301 CNYFWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKF----------YYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENF 5218
            C    CSW+ ++ R                      L+E K F   +L  I +N +++ +E  + P +      +  +N VF+ IFAVEM +KV+A+G       Y+ +G+NV DG++V++S  +I    +   +      L V R  R LR L+++   P L+  +  +L ++  +     +   F  IF I G+ LF GKF            C+ P++  +    +C  D++        +F+N+  A +++F + +++ W  +++ G+          E  + W  LYF++ +    + + N+ V ++VE F
Sbjct: 1212 CMSRVCSWIRRYIR---------------------RLVEHKYFQQGILLAILINTLSMGIEYHNQPPELTA--IVETSNVVFSGIFAVEMLLKVVAEG----PFRYIANGFNVFDGIIVILSAIEICQTFMGNGTGGGGSGLSVLRTFRLLRILKLVRFMPNLRRQLFVMLRTMDNVAVFFSLLVLFIFIFSILGMYLFGGKFCKFLDESGLERECTCPEI--ISRHPQCECDRK--------HFNNILWATVTVFQILTQEDWNVVLFNGM----------EKTSHWAALYFVALMTFGNYVLFNLLVAILVEGF 1480          

HSP 6 Score: 78.9518 bits (193), Expect = 7.336e-14
Identity = 75/225 (33.33%), Postives = 116/225 (51.56%), Query Frame = 2
Query: 5345 RLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPIN--MTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNP------CTG---LSRHA-------HFENFGMAFLTLFRIATGDNWNGIM 5965
            R  I  LV  KYF   I   I +N ++M +E++  P EL   +++ N +F+ +F +E L+K +A GP RYI + +N  D +IVILS   I    M N        ++++R FR+LRI   LKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG   C   +       CT    +SRH        HF N   A +T+F+I T ++WN ++
Sbjct: 1221 RRYIRRLVEHKYFQQGILLAILINTLSMGIEYHNQPPELTAIVETSNVVFSGIFAVEMLLKVVAEGPFRYIANGFNVFDGIIVILSAIEICQTFMGNGTGGGGSGLSVLRTFRLLRI---LKLVRFMPNLRRQLFVMLRTMDNVAVFFSLLVLFIFIFSILGMYLFGGKFCKFLDESGLERECTCPEIISRHPQCECDRKHFNNILWATVTVFQILTQEDWNVVL 1442          

HSP 7 Score: 76.2554 bits (186), Expect = 4.647e-13
Identity = 81/331 (24.47%), Postives = 148/331 (44.71%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTL--EYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVE----LAQEGGASGLSVLRTF---RLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRK-----------------NFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNN 3394
            RFR+     V  ++F   +L+ I +N +++ +E  N P   T  L    +N +F  +F VEM +K++A G+      Y ++G+N+ DG +V + +++    L  E       +LR F   R LR L+++   P L+L +  +L ++  +     +   F  IF ILG+ LF   F   +    K  R                  NFD L  A++++F + +++ W  ++ +G+               W  LYF+A +    + + N+ V ++VE F   R ++ K  EKI        K A  M+ +  +  E    ++  P  +  +N
Sbjct: 2150 RFRQICTWFVNQKWFDNVVLLFIALNCITLAMERPNIPPSSTERLFLATANYVFTVVFTVEMFIKVVATGMFYGHDAYFTSGWNIMDGSLVTISIIDLLMSLISESSPRIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGTFYYCEGENIKGVRNADECRRIPGNVWTNRKYNFDDLGKALMSLFVLSSRDGWVNIMYTGLDAVGVDQQPIVNYNEWRLLYFIAFILLVGFFVLNMFVGVVVENFHRCREEQEK-EEKI----RRAAKRALQMEKKRRRMHEPPYYTNYSPTRMFVHN 2475          

HSP 8 Score: 73.1738 bits (178), Expect = 4.748e-12
Identity = 56/210 (26.67%), Postives = 104/210 (49.52%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG-----------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXX-XXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVL 3121
            R  + ++V  +YF   I   I +N ++M +EY+  P  L   L+  N  F  +F++E  +K++A G   Y+ + +N  D GIV+L +V +  E              + + V+R  R+ R+LKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG          +   +  +F +   A +T+F++ T ++WN ++
Sbjct: 2470 RMFVHNVVTSKYFDLAIAAVIGLNVVTMAMEYYKMPSGLKYALKIFNYFFTAVFILEANMKLVALGWKLYLKDRWNQLDVGIVLLSIVGIVLEELETNTHQIIPINPTIIRVMRVLRIARVLKLLKMANGIRALLDTVMQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDEIPCQGLGEHAHFANFGMAFLTLFRVATGDNWNGIM 2679          

HSP 9 Score: 68.5514 bits (166), Expect = 9.815e-11
Identity = 56/178 (31.46%), Postives = 93/178 (52.25%), Query Frame = 2
Query:  578 RDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA------------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            R  C  F++  WF+ + +  I +NCITL M +P  +    +     L   ++   + F VE+ IK+ A G+  G   YF+  WN +D  +V   +I+ +     MSL +  + R+   LR             INR P ++++V  LL +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 2152 RQICTWFVNQKWFDNVVLLFIALNCITLAMERP--NIPPSSTERLFLATANYVFTVVFTVEMFIKVVATGMFYGHDAYFTSGWNIMDGSLVTISIIDLL-----MSLISESSPRIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKG 2322          

HSP 10 Score: 61.6178 bits (148), Expect = 1.457e-8
Identity = 38/136 (27.94%), Postives = 81/136 (59.56%), Query Frame = 2
Query: 2546 IVAHRYFQRGILIAILINTLSMGIEYHNQPVL----LTNTLE----YSNMIFNGLFLVEMLLKILAEGLLG---YISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTM 2920
            ++ + +F+R  ++ IL+N +++G+    QP +    +TN  +    + ++IF   F +EM +K++A G+ G   Y+++ +N  D  IV+ GL+E         L+ +RT R+LR L+ +  +P++R+ ++++L T+
Sbjct:  297 LITNPWFERVSILVILLNCITLGMY---QPCVDDACVTNRCKILQIFDDIIF-AFFALEMTIKMVAMGICGKNTYLADSWNRLDFFIVLAGLLEYVMHVENLNLTAIRTIRVLRPLRAINRIPSMRILVMLLLDTL 428          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1T (gene:FBgn0264386 transcript:FBtr0304610)

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 441/635 (69.45%), Postives = 518/635 (81.57%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK---NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRG 6253
            SL++   DNRFR  C   + +K FDN+VL FIALNCITLAMERP+IP  S ER FL   NYVFTV+F VEM IKV+A G+  G  +Y  SGWN+MDG LV IS+ D+++ LI   S RIFGILRVFRLLR+LRPLRVI+RAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGI GVQLFKG FYYC G ++  V+N  EC     N W N++YNFD+LG+ALMSLFVLSS+DGWV IMYTGLDAVGV+QQP  NYNEW LLYFI+F+LLVGFFVLNMFVGVVVENFH+CRE QEKEEK RRAAKRA ++EKK+++M +PPY+  Y   R+ +H +V SKYFDLAIA +IGLNV+TMAME+Y MP  L+ ALK  NY FT+VFI+EA +K +A G K Y+ DRWNQLDV IV+LS+ GIV+EE++   ++ IPIN TIIRV RVLRIARVLKLLKMA GIRALLDTV+QALPQVGNLGLLFFLLFFIFAALGVELFGRLECSD  PC GL  HAHF NFGMAFLTLFR+ATGDNWNGIMKDTLR+ CD++ +C +NCCVS +IAPI+FVIFVLMAQFVLVNVVVAVLMKHLEESHK M D+ ++E E++RE+  E +    + +   + E +++ 
Sbjct: 2136 SLYIFPEDNRFRQICTWFVNQKWFDNVVLLFIALNCITLAMERPNIPPSSTERLFLATANYVFTVVFTVEMFIKVVATGMFYGHDAYFTSGWNIMDGSLVTISIIDLLMSLISESSPRIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGTFYYCEGENIKGVRNADECRRIPGNVWTNRKYNFDDLGKALMSLFVLSSRDGWVNIMYTGLDAVGVDQQPIVNYNEWRLLYFIAFILLVGFFVLNMFVGVVVENFHRCREEQEKEEKIRRAAKRALQMEKKRRRMHEPPYYTNYSPTRMFVHNVVTSKYFDLAIAAVIGLNVVTMAMEYYKMPSGLKYALKIFNYFFTAVFILEANMKLVALGWKLYLKDRWNQLDVGIVLLSIVGIVLEELETNTHQIIPINPTIIRVMRVLRIARVLKLLKMANGIRALLDTVMQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDEIPCQGLGEHAHFANFGMAFLTLFRVATGDNWNGIMKDTLRDNCDDAADCVRNCCVSSVIAPIFFVIFVLMAQFVLVNVVVAVLMKHLEESHKQMEDELDMEVELERELVREQEFAQEQKLCQQLAEAQSKA 2770          

HSP 2 Score: 456.833 bits (1174), Expect = 8.129e-129
Identity = 252/445 (56.63%), Postives = 310/445 (69.66%), Query Frame = 2
Query:  515 DLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKK---QQSTSTLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEKH------ENLTYFTKRLVFMH 1822
            +LPYP +PE     L Q   PR+WCL  I+ PWFE++SI VI++NCITLGMY+PC D +C T RCKIL  FD  IF FFA+E+ IK+ AMG+ G + Y ++SWNRLD  IV+AGL+E +     ++LTAIRT+RVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGI+GVQ+W+GILR RC L       +P L LS YY       + S  +D+ICS  N +G+  C + PP  I      + VCN+ A     N PTN SCVNWNQYY+ C+    NP+ G I+FDNIG AWVAIF VIS+E W DIMYYVQDAHSFWDW YFV LI+IGSFFMINLCLVVIATQFSETKKRE ERM  ER +     + ++  ++ EP +CY EI+K I+   R   + ++K+Y+R   K       +NLT+   R+   H
Sbjct:  270 NLPYPGFPEISIRALTQYTRPRNWCLMLITNPWFERVSILVILLNCITLGMYQPCVDDACVTNRCKILQIFDDIIFAFFALEMTIKMVAMGICGKNTYLADSWNRLDFFIVLAGLLEYVMHVENLNLTAIRTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWEGILRQRCSLMRTEGMVYP-LTLSQYY-------EFSKDQDYICSTPNDSGMHLCGNFPPYRI-----GSLVCNEEAKLFDFNEPTNTSCVNWNQYYTTCKQSGENPFQGTISFDNIGMAWVAIFLVISLEGWTDIMYYVQDAHSFWDWIYFVLLIVIGSFFMINLCLVVIATQFSETKKREMERMRQERARYTSTSTLASSTNNSEPATCYAEIVKYIAHLWRRFKRRMLKKYQRQQRKEGLLPNADNLTFSPSRIKCHH 701          

HSP 3 Score: 283.108 bits (723), Expect = 9.125e-76
Identity = 178/286 (62.24%), Postives = 216/286 (75.52%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQ-------EGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXX-----------------XXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMA 3310
             R+ ++ +V H+YFQ+GIL+AILINTLSMGIEYHNQP  LT  +E SN++F+G+F VEMLLK++AEG   YI+NGFNVFDG IVIL  +E+ Q        GG SGLSVLRTFRLLRILKLVRFMP LR QL VML+TMDNVA FF+LL+LFIFIFSILGM LFG K                     ++ + +CDRK+F+++LWA VTVFQILTQEDWN VL +GM +TS WAALYFVALMTFGNYVLFNLLVAILVEGFS+ER +  +  ++  ++K  EE +A
Sbjct: 1215 IRRYIRRLVEHKYFQQGILLAILINTLSMGIEYHNQPPELTAIVETSNVVFSGIFAVEMLLKVVAEGPFRYIANGFNVFDGIIVILSAIEICQTFMGNGTGGGGSGLSVLRTFRLLRILKLVRFMPNLRRQLFVMLRTMDNVAVFFSLLVLFIFIFSILGMYLFGGKFCKFLDESGLERECTCPEIISRHPQCECDRKHFNNILWATVTVFQILTQEDWNVVLFNGMEKTSHWAALYFVALMTFGNYVLFNLLVAILVEGFSSERNERREREQRELVKKLREETLA 1500          

HSP 4 Score: 116.701 bits (291), Expect = 2.610e-25
Identity = 101/362 (27.90%), Postives = 168/362 (46.41%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQK--SREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG-----------------------------KFYYCSGP----------------------DVAHVKNFSECNNDKRNTWKNQQY---------------NFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            S+  L+   R RN C  L+    F+ + +  I LNCITL M +P +     +   + L I + +    FA+EMTIK++A G+  GK++YL   WN +D  +V+  L + ++     H   +   L   R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL++G                             + Y CS P                      + A + +F+E  N     W NQ Y               +FDN+G A +++F++ S +GW  IMY   DA          ++ W  +YF+  +++  FF++N+ + V+   F + ++ +
Sbjct:  280 SIRALTQYTRPRNWCLMLITNPWFERVSILVILLNCITLGMYQPCVDDACVTNRCKILQIFDDIIFAFFALEMTIKMVAMGI-CGKNTYLADSWNRLDFFIVLAGLLEYVM-----HVENLN--LTAIRTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWEGILRQRCSLMRTEGMVYPLTLSQYYEFSKDQDYICSTPNDSGMHLCGNFPPYRIGSLVCNEEAKLFDFNEPTNTSCVNW-NQYYTTCKQSGENPFQGTISFDNIGMAWVAIFLVISLEGWTDIMYYVQDA----------HSFWDWIYFVLLIVIGSFFMINLCLVVIATQFSETKKRE 622          

HSP 5 Score: 98.2117 bits (243), Expect = 1.109e-19
Identity = 76/316 (24.05%), Postives = 145/316 (45.89%), Query Frame = 2
Query: 4301 CNYFWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKF----------YYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENF 5218
            C    CSW+ ++ R                      L+E K F   +L  I +N +++ +E  + P +      +  +N VF+ IFAVEM +KV+A+G       Y+ +G+NV DG++V++S  +I    +   +      L V R  R LR L+++   P L+  +  +L ++  +     +   F  IF I G+ LF GKF            C+ P++  +    +C  D++        +F+N+  A +++F + +++ W  +++ G+          E  + W  LYF++ +    + + N+ V ++VE F
Sbjct: 1207 CMSRVCSWIRRYIR---------------------RLVEHKYFQQGILLAILINTLSMGIEYHNQPPELTA--IVETSNVVFSGIFAVEMLLKVVAEG----PFRYIANGFNVFDGIIVILSAIEICQTFMGNGTGGGGSGLSVLRTFRLLRILKLVRFMPNLRRQLFVMLRTMDNVAVFFSLLVLFIFIFSILGMYLFGGKFCKFLDESGLERECTCPEI--ISRHPQCECDRK--------HFNNILWATVTVFQILTQEDWNVVLFNGM----------EKTSHWAALYFVALMTFGNYVLFNLLVAILVEGF 1475          

HSP 6 Score: 78.9518 bits (193), Expect = 7.458e-14
Identity = 75/225 (33.33%), Postives = 116/225 (51.56%), Query Frame = 2
Query: 5345 RLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPIN--MTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNP------CTG---LSRHA-------HFENFGMAFLTLFRIATGDNWNGIM 5965
            R  I  LV  KYF   I   I +N ++M +E++  P EL   +++ N +F+ +F +E L+K +A GP RYI + +N  D +IVILS   I    M N        ++++R FR+LRI   LKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG   C   +       CT    +SRH        HF N   A +T+F+I T ++WN ++
Sbjct: 1216 RRYIRRLVEHKYFQQGILLAILINTLSMGIEYHNQPPELTAIVETSNVVFSGIFAVEMLLKVVAEGPFRYIANGFNVFDGIIVILSAIEICQTFMGNGTGGGGSGLSVLRTFRLLRI---LKLVRFMPNLRRQLFVMLRTMDNVAVFFSLLVLFIFIFSILGMYLFGGKFCKFLDESGLERECTCPEIISRHPQCECDRKHFNNILWATVTVFQILTQEDWNVVL 1437          

HSP 7 Score: 76.2554 bits (186), Expect = 4.607e-13
Identity = 81/331 (24.47%), Postives = 148/331 (44.71%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTL--EYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVE----LAQEGGASGLSVLRTF---RLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRK-----------------NFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNN 3394
            RFR+     V  ++F   +L+ I +N +++ +E  N P   T  L    +N +F  +F VEM +K++A G+      Y ++G+N+ DG +V + +++    L  E       +LR F   R LR L+++   P L+L +  +L ++  +     +   F  IF ILG+ LF   F   +    K  R                  NFD L  A++++F + +++ W  ++ +G+               W  LYF+A +    + + N+ V ++VE F   R ++ K  EKI        K A  M+ +  +  E    ++  P  +  +N
Sbjct: 2145 RFRQICTWFVNQKWFDNVVLLFIALNCITLAMERPNIPPSSTERLFLATANYVFTVVFTVEMFIKVVATGMFYGHDAYFTSGWNIMDGSLVTISIIDLLMSLISESSPRIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGTFYYCEGENIKGVRNADECRRIPGNVWTNRKYNFDDLGKALMSLFVLSSRDGWVNIMYTGLDAVGVDQQPIVNYNEWRLLYFIAFILLVGFFVLNMFVGVVVENFHRCREEQEK-EEKI----RRAAKRALQMEKKRRRMHEPPYYTNYSPTRMFVHN 2470          

HSP 8 Score: 73.1738 bits (178), Expect = 4.747e-12
Identity = 56/210 (26.67%), Postives = 104/210 (49.52%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG-----------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXX-XXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVL 3121
            R  + ++V  +YF   I   I +N ++M +EY+  P  L   L+  N  F  +F++E  +K++A G   Y+ + +N  D GIV+L +V +  E              + + V+R  R+ R+LKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG          +   +  +F +   A +T+F++ T ++WN ++
Sbjct: 2465 RMFVHNVVTSKYFDLAIAAVIGLNVVTMAMEYYKMPSGLKYALKIFNYFFTAVFILEANMKLVALGWKLYLKDRWNQLDVGIVLLSIVGIVLEELETNTHQIIPINPTIIRVMRVLRIARVLKLLKMANGIRALLDTVMQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDEIPCQGLGEHAHFANFGMAFLTLFRVATGDNWNGIM 2674          

HSP 9 Score: 68.5514 bits (166), Expect = 9.814e-11
Identity = 56/178 (31.46%), Postives = 93/178 (52.25%), Query Frame = 2
Query:  578 RDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA------------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            R  C  F++  WF+ + +  I +NCITL M +P  +    +     L   ++   + F VE+ IK+ A G+  G   YF+  WN +D  +V   +I+ +     MSL +  + R+   LR             INR P ++++V  LL +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 2147 RQICTWFVNQKWFDNVVLLFIALNCITLAMERP--NIPPSSTERLFLATANYVFTVVFTVEMFIKVVATGMFYGHDAYFTSGWNIMDGSLVTISIIDLL-----MSLISESSPRIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKG 2317          

HSP 10 Score: 61.6178 bits (148), Expect = 1.433e-8
Identity = 38/136 (27.94%), Postives = 81/136 (59.56%), Query Frame = 2
Query: 2546 IVAHRYFQRGILIAILINTLSMGIEYHNQPVL----LTNTLE----YSNMIFNGLFLVEMLLKILAEGLLG---YISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTM 2920
            ++ + +F+R  ++ IL+N +++G+    QP +    +TN  +    + ++IF   F +EM +K++A G+ G   Y+++ +N  D  IV+ GL+E         L+ +RT R+LR L+ +  +P++R+ ++++L T+
Sbjct:  297 LITNPWFERVSILVILLNCITLGMY---QPCVDDACVTNRCKILQIFDDIIF-AFFALEMTIKMVAMGICGKNTYLADSWNRLDFFIVLAGLLEYVMHVENLNLTAIRTIRVLRPLRAINRIPSMRILVMLLLDTL 428          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1T (gene:FBgn0264386 transcript:FBtr0304609)

HSP 1 Score: 736.873 bits (1901), Expect = 0.000e+0
Identity = 441/635 (69.45%), Postives = 518/635 (81.57%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK---NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRG 6253
            SL++   DNRFR  C   + +K FDN+VL FIALNCITLAMERP+IP  S ER FL   NYVFTV+F VEM IKV+A G+  G  +Y  SGWN+MDG LV IS+ D+++ LI   S RIFGILRVFRLLR+LRPLRVI+RAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGI GVQLFKG FYYC G ++  V+N  EC     N W N++YNFD+LG+ALMSLFVLSS+DGWV IMYTGLDAVGV+QQP  NYNEW LLYFI+F+LLVGFFVLNMFVGVVVENFH+CRE QEKEEK RRAAKRA ++EKK+++M +PPY+  Y   R+ +H +V SKYFDLAIA +IGLNV+TMAME+Y MP  L+ ALK  NY FT+VFI+EA +K +A G K Y+ DRWNQLDV IV+LS+ GIV+EE++   ++ IPIN TIIRV RVLRIARVLKLLKMA GIRALLDTV+QALPQVGNLGLLFFLLFFIFAALGVELFGRLECSD  PC GL  HAHF NFGMAFLTLFR+ATGDNWNGIMKDTLR+ CD++ +C +NCCVS +IAPI+FVIFVLMAQFVLVNVVVAVLMKHLEESHK M D+ ++E E++RE+  E +    + +   + E +++ 
Sbjct: 2116 SLYIFPEDNRFRQICTWFVNQKWFDNVVLLFIALNCITLAMERPNIPPSSTERLFLATANYVFTVVFTVEMFIKVVATGMFYGHDAYFTSGWNIMDGSLVTISIIDLLMSLISESSPRIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGTFYYCEGENIKGVRNADECRRIPGNVWTNRKYNFDDLGKALMSLFVLSSRDGWVNIMYTGLDAVGVDQQPIVNYNEWRLLYFIAFILLVGFFVLNMFVGVVVENFHRCREEQEKEEKIRRAAKRALQMEKKRRRMHEPPYYTNYSPTRMFVHNVVTSKYFDLAIAAVIGLNVVTMAMEYYKMPSGLKYALKIFNYFFTAVFILEANMKLVALGWKLYLKDRWNQLDVGIVLLSIVGIVLEELETNTHQIIPINPTIIRVMRVLRIARVLKLLKMANGIRALLDTVMQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDEIPCQGLGEHAHFANFGMAFLTLFRVATGDNWNGIMKDTLRDNCDDAADCVRNCCVSSVIAPIFFVIFVLMAQFVLVNVVVAVLMKHLEESHKQMEDELDMEVELERELVREQEFAQEQKLCQQLAEAQSKA 2750          

HSP 2 Score: 452.21 bits (1162), Expect = 2.478e-127
Identity = 255/450 (56.67%), Postives = 312/450 (69.33%), Query Frame = 2
Query:  515 DLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKK---QQSTSTLGSSIEPQSCYHEIIKLIS----RFCRHLLKTV-IKRYERFSEKH------ENLTYFTKRLVFMH 1822
            +LPYP +PE     L Q   PR+WCL  I+ PWFE++SI VI++NCITLGMY+PC D +C T RCKIL  FD  IF FFA+E+ IK+ AMG+ G + Y ++SWNRLD  IV+AGL+E +     ++LTAIRT+RVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGI+GVQ+W+GILR RC L       +P L LS YY       + S  +D+ICS  N +G+  C + PP  I      + VCN+ A     N PTN SCVNWNQYY+ C+    NP+ G I+FDNIG AWVAIF VIS+E W DIMYYVQDAHSFWDW YFV LI+IGSFFMINLCLVVIATQFSETKKRE ERM  ER +     + ++  ++ EP +CY EI+K I+    RF R +LK   + +Y+R   K       +NLT+   R+   H
Sbjct:  270 NLPYPGFPEISIRALTQYTRPRNWCLMLITNPWFERVSILVILLNCITLGMYQPCVDDACVTNRCKILQIFDDIIFAFFALEMTIKMVAMGICGKNTYLADSWNRLDFFIVLAGLLEYVMHVENLNLTAIRTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWEGILRQRCSLMRTEGMVYP-LTLSQYY-------EFSKDQDYICSTPNDSGMHLCGNFPPYRI-----GSLVCNEEAKLFDFNEPTNTSCVNWNQYYTTCKQSGENPFQGTISFDNIGMAWVAIFLVISLEGWTDIMYYVQDAHSFWDWIYFVLLIVIGSFFMINLCLVVIATQFSETKKREMERMRQERARYTSTSTLASSTNNSEPATCYAEIVKYIAHLWRRFKRRMLKKYRLYKYQRQQRKEGLLPNADNLTFSPSRIKCHH 706          

HSP 3 Score: 301.597 bits (771), Expect = 2.576e-81
Identity = 187/268 (69.78%), Postives = 221/268 (82.46%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQ-------EGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMA 3310
            R+ ++ +V H+YFQ+GIL+AILINTLSMGIEYHNQP  LT  +E SN++F+G+F VEMLLK++AEG   YI+NGFNVFDG IVIL  +E+ Q        GG SGLSVLRTFRLLRILKLVRFMP LR QL VML+TMDNVA FF+LL+LFIFIFSILGM+LFGCKFC+  NG+  CDRKNFDSLLWA+VTVFQILTQEDWN VL +GM +TS WAALYFVALMTFGNYVLFNLLVAILVEGFS+ER +  +  ++  ++K  EE +A
Sbjct: 1213 RRYIRRLVEHKYFQQGILLAILINTLSMGIEYHNQPPELTAIVETSNVVFSGIFAVEMLLKVVAEGPFRYIANGFNVFDGIIVILSAIEICQTFMGNGTGGGGSGLSVLRTFRLLRILKLVRFMPNLRRQLFVMLRTMDNVAVFFSLLVLFIFIFSILGMNLFGCKFCEKVNGEMICDRKNFDSLLWALVTVFQILTQEDWNVVLFNGMEKTSHWAALYFVALMTFGNYVLFNLLVAILVEGFSSERNERREREQRELVKKLREETLA 1480          

HSP 4 Score: 116.701 bits (291), Expect = 2.788e-25
Identity = 101/362 (27.90%), Postives = 168/362 (46.41%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQK--SREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG-----------------------------KFYYCSGP----------------------DVAHVKNFSECNNDKRNTWKNQQY---------------NFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            S+  L+   R RN C  L+    F+ + +  I LNCITL M +P +     +   + L I + +    FA+EMTIK++A G+  GK++YL   WN +D  +V+  L + ++     H   +   L   R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL++G                             + Y CS P                      + A + +F+E  N     W NQ Y               +FDN+G A +++F++ S +GW  IMY   DA          ++ W  +YF+  +++  FF++N+ + V+   F + ++ +
Sbjct:  280 SIRALTQYTRPRNWCLMLITNPWFERVSILVILLNCITLGMYQPCVDDACVTNRCKILQIFDDIIFAFFALEMTIKMVAMGI-CGKNTYLADSWNRLDFFIVLAGLLEYVM-----HVENLN--LTAIRTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWEGILRQRCSLMRTEGMVYPLTLSQYYEFSKDQDYICSTPNDSGMHLCGNFPPYRIGSLVCNEEAKLFDFNEPTNTSCVNW-NQYYTTCKQSGENPFQGTISFDNIGMAWVAIFLVISLEGWTDIMYYVQDA----------HSFWDWIYFVLLIVIGSFFMINLCLVVIATQFSETKKRE 622          

HSP 5 Score: 93.2041 bits (230), Expect = 3.957e-18
Identity = 78/306 (25.49%), Postives = 140/306 (45.75%), Query Frame = 2
Query: 4301 CNYFWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENF 5218
            C    CSW+ ++ R                      L+E K F   +L  I +N +++ +E  + P +      +  +N VF+ IFAVEM +KV+A+G       Y+ +G+NV DG++V++S  +I    +   +      L V R  R LR L+++   P L+  +  +L ++  +     +   F  IF I G+ LF  KF  C        K   E   D++        NFD+L  AL+++F + +++ W  +++ G+          E  + W  LYF++ +    + + N+ V ++VE F
Sbjct: 1204 CMSRVCSWIRRYIR---------------------RLVEHKYFQQGILLAILINTLSMGIEYHNQPPELTA--IVETSNVVFSGIFAVEMLLKVVAEG----PFRYIANGFNVFDGIIVILSAIEICQTFMGNGTGGGGSGLSVLRTFRLLRILKLVRFMPNLRRQLFVMLRTMDNVAVFFSLLVLFIFIFSILGMNLFGCKF--CE-------KVNGEMICDRK--------NFDSLLWALVTVFQILTQEDWNVVLFNGM----------EKTSHWAALYFVALMTFGNYVLFNLLVAILVEGF 1455          

HSP 6 Score: 78.9518 bits (193), Expect = 6.796e-14
Identity = 70/209 (33.49%), Postives = 112/209 (53.59%), Query Frame = 2
Query: 5345 RLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPIN--MTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIM 5965
            R  I  LV  KYF   I   I +N ++M +E++  P EL   +++ N +F+ +F +E L+K +A GP RYI + +N  D +IVILS   I    M N        ++++R FR+LRI   LKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG   C   N      R  +F++   A +T+F+I T ++WN ++
Sbjct: 1213 RRYIRRLVEHKYFQQGILLAILINTLSMGIEYHNQPPELTAIVETSNVVFSGIFAVEMLLKVVAEGPFRYIANGFNVFDGIIVILSAIEICQTFMGNGTGGGGSGLSVLRTFRLLRI---LKLVRFMPNLRRQLFVMLRTMDNVAVFFSLLVLFIFIFSILGMNLFGCKFCEKVNGEMICDRK-NFDSLLWALVTVFQILTQEDWNVVL 1417          

HSP 7 Score: 76.2554 bits (186), Expect = 5.134e-13
Identity = 81/331 (24.47%), Postives = 148/331 (44.71%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTL--EYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVE----LAQEGGASGLSVLRTF---RLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRK-----------------NFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNN 3394
            RFR+     V  ++F   +L+ I +N +++ +E  N P   T  L    +N +F  +F VEM +K++A G+      Y ++G+N+ DG +V + +++    L  E       +LR F   R LR L+++   P L+L +  +L ++  +     +   F  IF ILG+ LF   F   +    K  R                  NFD L  A++++F + +++ W  ++ +G+               W  LYF+A +    + + N+ V ++VE F   R ++ K  EKI        K A  M+ +  +  E    ++  P  +  +N
Sbjct: 2125 RFRQICTWFVNQKWFDNVVLLFIALNCITLAMERPNIPPSSTERLFLATANYVFTVVFTVEMFIKVVATGMFYGHDAYFTSGWNIMDGSLVTISIIDLLMSLISESSPRIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGTFYYCEGENIKGVRNADECRRIPGNVWTNRKYNFDDLGKALMSLFVLSSRDGWVNIMYTGLDAVGVDQQPIVNYNEWRLLYFIAFILLVGFFVLNMFVGVVVENFHRCREEQEK-EEKI----RRAAKRALQMEKKRRRMHEPPYYTNYSPTRMFVHN 2450          

HSP 8 Score: 72.7886 bits (177), Expect = 4.989e-12
Identity = 56/210 (26.67%), Postives = 104/210 (49.52%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG-----------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXX-XXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVL 3121
            R  + ++V  +YF   I   I +N ++M +EY+  P  L   L+  N  F  +F++E  +K++A G   Y+ + +N  D GIV+L +V +  E              + + V+R  R+ R+LKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG          +   +  +F +   A +T+F++ T ++WN ++
Sbjct: 2445 RMFVHNVVTSKYFDLAIAAVIGLNVVTMAMEYYKMPSGLKYALKIFNYFFTAVFILEANMKLVALGWKLYLKDRWNQLDVGIVLLSIVGIVLEELETNTHQIIPINPTIIRVMRVLRIARVLKLLKMANGIRALLDTVMQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDEIPCQGLGEHAHFANFGMAFLTLFRVATGDNWNGIM 2654          

HSP 9 Score: 68.5514 bits (166), Expect = 9.484e-11
Identity = 56/178 (31.46%), Postives = 93/178 (52.25%), Query Frame = 2
Query:  578 RDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA------------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            R  C  F++  WF+ + +  I +NCITL M +P  +    +     L   ++   + F VE+ IK+ A G+  G   YF+  WN +D  +V   +I+ +     MSL +  + R+   LR             INR P ++++V  LL +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 2127 RQICTWFVNQKWFDNVVLLFIALNCITLAMERP--NIPPSSTERLFLATANYVFTVVFTVEMFIKVVATGMFYGHDAYFTSGWNIMDGSLVTISIIDLL-----MSLISESSPRIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKG 2297          

HSP 10 Score: 61.6178 bits (148), Expect = 1.456e-8
Identity = 38/136 (27.94%), Postives = 81/136 (59.56%), Query Frame = 2
Query: 2546 IVAHRYFQRGILIAILINTLSMGIEYHNQPVL----LTNTLE----YSNMIFNGLFLVEMLLKILAEGLLG---YISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTM 2920
            ++ + +F+R  ++ IL+N +++G+    QP +    +TN  +    + ++IF   F +EM +K++A G+ G   Y+++ +N  D  IV+ GL+E         L+ +RT R+LR L+ +  +P++R+ ++++L T+
Sbjct:  297 LITNPWFERVSILVILLNCITLGMY---QPCVDDACVTNRCKILQIFDDIIF-AFFALEMTIKMVAMGICGKNTYLADSWNRLDFFIVLAGLLEYVMHVENLNLTAIRTIRVLRPLRAINRIPSMRILVMLLLDTL 428          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1T (gene:FBgn0264386 transcript:FBtr0089393)

HSP 1 Score: 736.873 bits (1901), Expect = 0.000e+0
Identity = 441/635 (69.45%), Postives = 518/635 (81.57%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK---NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRG 6253
            SL++   DNRFR  C   + +K FDN+VL FIALNCITLAMERP+IP  S ER FL   NYVFTV+F VEM IKV+A G+  G  +Y  SGWN+MDG LV IS+ D+++ LI   S RIFGILRVFRLLR+LRPLRVI+RAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGI GVQLFKG FYYC G ++  V+N  EC     N W N++YNFD+LG+ALMSLFVLSS+DGWV IMYTGLDAVGV+QQP  NYNEW LLYFI+F+LLVGFFVLNMFVGVVVENFH+CRE QEKEEK RRAAKRA ++EKK+++M +PPY+  Y   R+ +H +V SKYFDLAIA +IGLNV+TMAME+Y MP  L+ ALK  NY FT+VFI+EA +K +A G K Y+ DRWNQLDV IV+LS+ GIV+EE++   ++ IPIN TIIRV RVLRIARVLKLLKMA GIRALLDTV+QALPQVGNLGLLFFLLFFIFAALGVELFGRLECSD  PC GL  HAHF NFGMAFLTLFR+ATGDNWNGIMKDTLR+ CD++ +C +NCCVS +IAPI+FVIFVLMAQFVLVNVVVAVLMKHLEESHK M D+ ++E E++RE+  E +    + +   + E +++ 
Sbjct: 2124 SLYIFPEDNRFRQICTWFVNQKWFDNVVLLFIALNCITLAMERPNIPPSSTERLFLATANYVFTVVFTVEMFIKVVATGMFYGHDAYFTSGWNIMDGSLVTISIIDLLMSLISESSPRIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGTFYYCEGENIKGVRNADECRRIPGNVWTNRKYNFDDLGKALMSLFVLSSRDGWVNIMYTGLDAVGVDQQPIVNYNEWRLLYFIAFILLVGFFVLNMFVGVVVENFHRCREEQEKEEKIRRAAKRALQMEKKRRRMHEPPYYTNYSPTRMFVHNVVTSKYFDLAIAAVIGLNVVTMAMEYYKMPSGLKYALKIFNYFFTAVFILEANMKLVALGWKLYLKDRWNQLDVGIVLLSIVGIVLEELETNTHQIIPINPTIIRVMRVLRIARVLKLLKMANGIRALLDTVMQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDEIPCQGLGEHAHFANFGMAFLTLFRVATGDNWNGIMKDTLRDNCDDAADCVRNCCVSSVIAPIFFVIFVLMAQFVLVNVVVAVLMKHLEESHKQMEDELDMEVELERELVREQEFAQEQKLCQQLAEAQSKA 2758          

HSP 2 Score: 452.21 bits (1162), Expect = 2.510e-127
Identity = 255/450 (56.67%), Postives = 312/450 (69.33%), Query Frame = 2
Query:  515 DLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKK---QQSTSTLGSSIEPQSCYHEIIKLIS----RFCRHLLKTV-IKRYERFSEKH------ENLTYFTKRLVFMH 1822
            +LPYP +PE     L Q   PR+WCL  I+ PWFE++SI VI++NCITLGMY+PC D +C T RCKIL  FD  IF FFA+E+ IK+ AMG+ G + Y ++SWNRLD  IV+AGL+E +     ++LTAIRT+RVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGI+GVQ+W+GILR RC L       +P L LS YY       + S  +D+ICS  N +G+  C + PP  I      + VCN+ A     N PTN SCVNWNQYY+ C+    NP+ G I+FDNIG AWVAIF VIS+E W DIMYYVQDAHSFWDW YFV LI+IGSFFMINLCLVVIATQFSETKKRE ERM  ER +     + ++  ++ EP +CY EI+K I+    RF R +LK   + +Y+R   K       +NLT+   R+   H
Sbjct:  270 NLPYPGFPEISIRALTQYTRPRNWCLMLITNPWFERVSILVILLNCITLGMYQPCVDDACVTNRCKILQIFDDIIFAFFALEMTIKMVAMGICGKNTYLADSWNRLDFFIVLAGLLEYVMHVENLNLTAIRTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWEGILRQRCSLMRTEGMVYP-LTLSQYY-------EFSKDQDYICSTPNDSGMHLCGNFPPYRI-----GSLVCNEEAKLFDFNEPTNTSCVNWNQYYTTCKQSGENPFQGTISFDNIGMAWVAIFLVISLEGWTDIMYYVQDAHSFWDWIYFVLLIVIGSFFMINLCLVVIATQFSETKKREMERMRQERARYTSTSTLASSTNNSEPATCYAEIVKYIAHLWRRFKRRMLKKYRLYKYQRQQRKEGLLPNADNLTFSPSRIKCHH 706          

HSP 3 Score: 301.212 bits (770), Expect = 2.761e-81
Identity = 187/269 (69.52%), Postives = 221/269 (82.16%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQ-------EGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMA 3310
             R+ ++ +V H+YFQ+GIL+AILINTLSMGIEYHNQP  LT  +E SN++F+G+F VEMLLK++AEG   YI+NGFNVFDG IVIL  +E+ Q        GG SGLSVLRTFRLLRILKLVRFMP LR QL VML+TMDNVA FF+LL+LFIFIFSILGM+LFGCKFC+  NG+  CDRKNFDSLLWA+VTVFQILTQEDWN VL +GM +TS WAALYFVALMTFGNYVLFNLLVAILVEGFS+ER +  +  ++  ++K  EE +A
Sbjct: 1220 IRRYIRRLVEHKYFQQGILLAILINTLSMGIEYHNQPPELTAIVETSNVVFSGIFAVEMLLKVVAEGPFRYIANGFNVFDGIIVILSAIEICQTFMGNGTGGGGSGLSVLRTFRLLRILKLVRFMPNLRRQLFVMLRTMDNVAVFFSLLVLFIFIFSILGMNLFGCKFCEKVNGEMICDRKNFDSLLWALVTVFQILTQEDWNVVLFNGMEKTSHWAALYFVALMTFGNYVLFNLLVAILVEGFSSERNERREREQRELVKKLREETLA 1488          

HSP 4 Score: 116.701 bits (291), Expect = 2.837e-25
Identity = 101/362 (27.90%), Postives = 168/362 (46.41%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQK--SREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG-----------------------------KFYYCSGP----------------------DVAHVKNFSECNNDKRNTWKNQQY---------------NFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            S+  L+   R RN C  L+    F+ + +  I LNCITL M +P +     +   + L I + +    FA+EMTIK++A G+  GK++YL   WN +D  +V+  L + ++     H   +   L   R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL++G                             + Y CS P                      + A + +F+E  N     W NQ Y               +FDN+G A +++F++ S +GW  IMY   DA          ++ W  +YF+  +++  FF++N+ + V+   F + ++ +
Sbjct:  280 SIRALTQYTRPRNWCLMLITNPWFERVSILVILLNCITLGMYQPCVDDACVTNRCKILQIFDDIIFAFFALEMTIKMVAMGI-CGKNTYLADSWNRLDFFIVLAGLLEYVM-----HVENLN--LTAIRTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWEGILRQRCSLMRTEGMVYPLTLSQYYEFSKDQDYICSTPNDSGMHLCGNFPPYRIGSLVCNEEAKLFDFNEPTNTSCVNW-NQYYTTCKQSGENPFQGTISFDNIGMAWVAIFLVISLEGWTDIMYYVQDA----------HSFWDWIYFVLLIVIGSFFMINLCLVVIATQFSETKKRE 622          

HSP 5 Score: 93.2041 bits (230), Expect = 4.163e-18
Identity = 78/306 (25.49%), Postives = 140/306 (45.75%), Query Frame = 2
Query: 4301 CNYFWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENF 5218
            C    CSW+ ++ R                      L+E K F   +L  I +N +++ +E  + P +      +  +N VF+ IFAVEM +KV+A+G       Y+ +G+NV DG++V++S  +I    +   +      L V R  R LR L+++   P L+  +  +L ++  +     +   F  IF I G+ LF  KF  C        K   E   D++        NFD+L  AL+++F + +++ W  +++ G+          E  + W  LYF++ +    + + N+ V ++VE F
Sbjct: 1212 CMSRVCSWIRRYIR---------------------RLVEHKYFQQGILLAILINTLSMGIEYHNQPPELTA--IVETSNVVFSGIFAVEMLLKVVAEG----PFRYIANGFNVFDGIIVILSAIEICQTFMGNGTGGGGSGLSVLRTFRLLRILKLVRFMPNLRRQLFVMLRTMDNVAVFFSLLVLFIFIFSILGMNLFGCKF--CE-------KVNGEMICDRK--------NFDSLLWALVTVFQILTQEDWNVVLFNGM----------EKTSHWAALYFVALMTFGNYVLFNLLVAILVEGF 1463          

HSP 6 Score: 78.9518 bits (193), Expect = 7.149e-14
Identity = 70/209 (33.49%), Postives = 112/209 (53.59%), Query Frame = 2
Query: 5345 RLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPIN--MTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIM 5965
            R  I  LV  KYF   I   I +N ++M +E++  P EL   +++ N +F+ +F +E L+K +A GP RYI + +N  D +IVILS   I    M N        ++++R FR+LRI   LKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG   C   N      R  +F++   A +T+F+I T ++WN ++
Sbjct: 1221 RRYIRRLVEHKYFQQGILLAILINTLSMGIEYHNQPPELTAIVETSNVVFSGIFAVEMLLKVVAEGPFRYIANGFNVFDGIIVILSAIEICQTFMGNGTGGGGSGLSVLRTFRLLRI---LKLVRFMPNLRRQLFVMLRTMDNVAVFFSLLVLFIFIFSILGMNLFGCKFCEKVNGEMICDRK-NFDSLLWALVTVFQILTQEDWNVVL 1425          

HSP 7 Score: 76.2554 bits (186), Expect = 5.728e-13
Identity = 81/331 (24.47%), Postives = 148/331 (44.71%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTL--EYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVE----LAQEGGASGLSVLRTF---RLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRK-----------------NFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNN 3394
            RFR+     V  ++F   +L+ I +N +++ +E  N P   T  L    +N +F  +F VEM +K++A G+      Y ++G+N+ DG +V + +++    L  E       +LR F   R LR L+++   P L+L +  +L ++  +     +   F  IF ILG+ LF   F   +    K  R                  NFD L  A++++F + +++ W  ++ +G+               W  LYF+A +    + + N+ V ++VE F   R ++ K  EKI        K A  M+ +  +  E    ++  P  +  +N
Sbjct: 2133 RFRQICTWFVNQKWFDNVVLLFIALNCITLAMERPNIPPSSTERLFLATANYVFTVVFTVEMFIKVVATGMFYGHDAYFTSGWNIMDGSLVTISIIDLLMSLISESSPRIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGTFYYCEGENIKGVRNADECRRIPGNVWTNRKYNFDDLGKALMSLFVLSSRDGWVNIMYTGLDAVGVDQQPIVNYNEWRLLYFIAFILLVGFFVLNMFVGVVVENFHRCREEQEK-EEKI----RRAAKRALQMEKKRRRMHEPPYYTNYSPTRMFVHN 2458          

HSP 8 Score: 72.7886 bits (177), Expect = 5.519e-12
Identity = 56/210 (26.67%), Postives = 104/210 (49.52%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG-----------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXX-XXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVL 3121
            R  + ++V  +YF   I   I +N ++M +EY+  P  L   L+  N  F  +F++E  +K++A G   Y+ + +N  D GIV+L +V +  E              + + V+R  R+ R+LKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG          +   +  +F +   A +T+F++ T ++WN ++
Sbjct: 2453 RMFVHNVVTSKYFDLAIAAVIGLNVVTMAMEYYKMPSGLKYALKIFNYFFTAVFILEANMKLVALGWKLYLKDRWNQLDVGIVLLSIVGIVLEELETNTHQIIPINPTIIRVMRVLRIARVLKLLKMANGIRALLDTVMQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDEIPCQGLGEHAHFANFGMAFLTLFRVATGDNWNGIM 2662          

HSP 9 Score: 68.9366 bits (167), Expect = 8.796e-11
Identity = 56/178 (31.46%), Postives = 93/178 (52.25%), Query Frame = 2
Query:  578 RDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA------------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            R  C  F++  WF+ + +  I +NCITL M +P  +    +     L   ++   + F VE+ IK+ A G+  G   YF+  WN +D  +V   +I+ +     MSL +  + R+   LR             INR P ++++V  LL +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 2135 RQICTWFVNQKWFDNVVLLFIALNCITLAMERP--NIPPSSTERLFLATANYVFTVVFTVEMFIKVVATGMFYGHDAYFTSGWNIMDGSLVTISIIDLL-----MSLISESSPRIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKG 2305          

HSP 10 Score: 61.2326 bits (147), Expect = 1.557e-8
Identity = 38/136 (27.94%), Postives = 81/136 (59.56%), Query Frame = 2
Query: 2546 IVAHRYFQRGILIAILINTLSMGIEYHNQPVL----LTNTLE----YSNMIFNGLFLVEMLLKILAEGLLG---YISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTM 2920
            ++ + +F+R  ++ IL+N +++G+    QP +    +TN  +    + ++IF   F +EM +K++A G+ G   Y+++ +N  D  IV+ GL+E         L+ +RT R+LR L+ +  +P++R+ ++++L T+
Sbjct:  297 LITNPWFERVSILVILLNCITLGMY---QPCVDDACVTNRCKILQIFDDIIF-AFFALEMTIKMVAMGICGKNTYLADSWNRLDFFIVLAGLLEYVMHVENLNLTAIRTIRVLRPLRAINRIPSMRILVMLLLDTL 428          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1T (gene:FBgn0264386 transcript:FBtr0334984)

HSP 1 Score: 736.873 bits (1901), Expect = 0.000e+0
Identity = 441/635 (69.45%), Postives = 518/635 (81.57%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK---NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRG 6253
            SL++   DNRFR  C   + +K FDN+VL FIALNCITLAMERP+IP  S ER FL   NYVFTV+F VEM IKV+A G+  G  +Y  SGWN+MDG LV IS+ D+++ LI   S RIFGILRVFRLLR+LRPLRVI+RAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGI GVQLFKG FYYC G ++  V+N  EC     N W N++YNFD+LG+ALMSLFVLSS+DGWV IMYTGLDAVGV+QQP  NYNEW LLYFI+F+LLVGFFVLNMFVGVVVENFH+CRE QEKEEK RRAAKRA ++EKK+++M +PPY+  Y   R+ +H +V SKYFDLAIA +IGLNV+TMAME+Y MP  L+ ALK  NY FT+VFI+EA +K +A G K Y+ DRWNQLDV IV+LS+ GIV+EE++   ++ IPIN TIIRV RVLRIARVLKLLKMA GIRALLDTV+QALPQVGNLGLLFFLLFFIFAALGVELFGRLECSD  PC GL  HAHF NFGMAFLTLFR+ATGDNWNGIMKDTLR+ CD++ +C +NCCVS +IAPI+FVIFVLMAQFVLVNVVVAVLMKHLEESHK M D+ ++E E++RE+  E +    + +   + E +++ 
Sbjct: 2154 SLYIFPEDNRFRQICTWFVNQKWFDNVVLLFIALNCITLAMERPNIPPSSTERLFLATANYVFTVVFTVEMFIKVVATGMFYGHDAYFTSGWNIMDGSLVTISIIDLLMSLISESSPRIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGTFYYCEGENIKGVRNADECRRIPGNVWTNRKYNFDDLGKALMSLFVLSSRDGWVNIMYTGLDAVGVDQQPIVNYNEWRLLYFIAFILLVGFFVLNMFVGVVVENFHRCREEQEKEEKIRRAAKRALQMEKKRRRMHEPPYYTNYSPTRMFVHNVVTSKYFDLAIAAVIGLNVVTMAMEYYKMPSGLKYALKIFNYFFTAVFILEANMKLVALGWKLYLKDRWNQLDVGIVLLSIVGIVLEELETNTHQIIPINPTIIRVMRVLRIARVLKLLKMANGIRALLDTVMQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDEIPCQGLGEHAHFANFGMAFLTLFRVATGDNWNGIMKDTLRDNCDDAADCVRNCCVSSVIAPIFFVIFVLMAQFVLVNVVVAVLMKHLEESHKQMEDELDMEVELERELVREQEFAQEQKLCQQLAEAQSKA 2788          

HSP 2 Score: 447.203 bits (1149), Expect = 7.147e-126
Identity = 254/456 (55.70%), Postives = 313/456 (68.64%), Query Frame = 2
Query:  515 DLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPH------KDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKK---QQSTSTLGSSIEPQSCYHEIIKLIS----RFCRHLLKTV-IKRYERFSEKH------ENLTYFTKRLVFMH 1822
            +LPYP +PE     L Q   PR+WCL  I+ PWFE++SI VI++NCITLGMY+PC D +C T RCKIL  FD  IF FFA+E+ IK+ AMG+ G + Y ++SWNRLD  IV+AGL+E +     ++LTAIRT+RVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGI+GVQ+W+GILR RC L       +P L +   Y+V      LS +      +D+ICS  N +G+  C + PP  I      + VCN+ A     N PTN SCVNWNQYY+ C+    NP+ G I+FDNIG AWVAIF VIS+E W DIMYYVQDAHSFWDW YFV LI+IGSFFMINLCLVVIATQFSETKKRE ERM  ER +     + ++  ++ EP +CY EI+K I+    RF R +LK   + +Y+R   K       +NLT+   R+   H
Sbjct:  270 NLPYPGFPEISIRALTQYTRPRNWCLMLITNPWFERVSILVILLNCITLGMYQPCVDDACVTNRCKILQIFDDIIFAFFALEMTIKMVAMGICGKNTYLADSWNRLDFFIVLAGLLEYVMHVENLNLTAIRTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWEGILRQRCSLMRTEGMVYP-LTVPEVYRVRVRVNSLSQYYEFSKDQDYICSTPNDSGMHLCGNFPPYRI-----GSLVCNEEAKLFDFNEPTNTSCVNWNQYYTTCKQSGENPFQGTISFDNIGMAWVAIFLVISLEGWTDIMYYVQDAHSFWDWIYFVLLIVIGSFFMINLCLVVIATQFSETKKREMERMRQERARYTSTSTLASSTNNSEPATCYAEIVKYIAHLWRRFKRRMLKKYRLYKYQRQQRKEGLLPNADNLTFSPSRIKCHH 719          

HSP 3 Score: 283.108 bits (723), Expect = 9.799e-76
Identity = 178/286 (62.24%), Postives = 216/286 (75.52%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQ-------EGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXX-----------------XXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMA 3310
             R+ ++ +V H+YFQ+GIL+AILINTLSMGIEYHNQP  LT  +E SN++F+G+F VEMLLK++AEG   YI+NGFNVFDG IVIL  +E+ Q        GG SGLSVLRTFRLLRILKLVRFMP LR QL VML+TMDNVA FF+LL+LFIFIFSILGM LFG K                     ++ + +CDRK+F+++LWA VTVFQILTQEDWN VL +GM +TS WAALYFVALMTFGNYVLFNLLVAILVEGFS+ER +  +  ++  ++K  EE +A
Sbjct: 1233 IRRYIRRLVEHKYFQQGILLAILINTLSMGIEYHNQPPELTAIVETSNVVFSGIFAVEMLLKVVAEGPFRYIANGFNVFDGIIVILSAIEICQTFMGNGTGGGGSGLSVLRTFRLLRILKLVRFMPNLRRQLFVMLRTMDNVAVFFSLLVLFIFIFSILGMYLFGGKFCKFLDESGLERECTCPEIISRHPQCECDRKHFNNILWATVTVFQILTQEDWNVVLFNGMEKTSHWAALYFVALMTFGNYVLFNLLVAILVEGFSSERNERREREQRELVKKLREETLA 1518          

HSP 4 Score: 98.2117 bits (243), Expect = 1.158e-19
Identity = 76/316 (24.05%), Postives = 145/316 (45.89%), Query Frame = 2
Query: 4301 CNYFWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKF----------YYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENF 5218
            C    CSW+ ++ R                      L+E K F   +L  I +N +++ +E  + P +      +  +N VF+ IFAVEM +KV+A+G       Y+ +G+NV DG++V++S  +I    +   +      L V R  R LR L+++   P L+  +  +L ++  +     +   F  IF I G+ LF GKF            C+ P++  +    +C  D++        +F+N+  A +++F + +++ W  +++ G+          E  + W  LYF++ +    + + N+ V ++VE F
Sbjct: 1225 CMSRVCSWIRRYIR---------------------RLVEHKYFQQGILLAILINTLSMGIEYHNQPPELTA--IVETSNVVFSGIFAVEMLLKVVAEG----PFRYIANGFNVFDGIIVILSAIEICQTFMGNGTGGGGSGLSVLRTFRLLRILKLVRFMPNLRRQLFVMLRTMDNVAVFFSLLVLFIFIFSILGMYLFGGKFCKFLDESGLERECTCPEI--ISRHPQCECDRK--------HFNNILWATVTVFQILTQEDWNVVLFNGM----------EKTSHWAALYFVALMTFGNYVLFNLLVAILVEGF 1493          

HSP 5 Score: 92.0485 bits (227), Expect = 9.174e-18
Identity = 67/184 (36.41%), Postives = 105/184 (57.07%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQK--SREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            S+  L+   R RN C  L+    F+ + +  I LNCITL M +P +     +   + L I + +    FA+EMTIK++A G+  GK++YL   WN +D  +V+  L + ++     H   +   L   R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL++G
Sbjct:  280 SIRALTQYTRPRNWCLMLITNPWFERVSILVILLNCITLGMYQPCVDDACVTNRCKILQIFDDIIFAFFALEMTIKMVAMGI-CGKNTYLADSWNRLDFFIVLAGLLEYVM-----HVENLN--LTAIRTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWEG 455          

HSP 6 Score: 78.9518 bits (193), Expect = 7.783e-14
Identity = 75/225 (33.33%), Postives = 116/225 (51.56%), Query Frame = 2
Query: 5345 RLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPIN--MTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNP------CTG---LSRHA-------HFENFGMAFLTLFRIATGDNWNGIM 5965
            R  I  LV  KYF   I   I +N ++M +E++  P EL   +++ N +F+ +F +E L+K +A GP RYI + +N  D +IVILS   I    M N        ++++R FR+LRI   LKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG   C   +       CT    +SRH        HF N   A +T+F+I T ++WN ++
Sbjct: 1234 RRYIRRLVEHKYFQQGILLAILINTLSMGIEYHNQPPELTAIVETSNVVFSGIFAVEMLLKVVAEGPFRYIANGFNVFDGIIVILSAIEICQTFMGNGTGGGGSGLSVLRTFRLLRI---LKLVRFMPNLRRQLFVMLRTMDNVAVFFSLLVLFIFIFSILGMYLFGGKFCKFLDESGLERECTCPEIISRHPQCECDRKHFNNILWATVTVFQILTQEDWNVVL 1455          

HSP 7 Score: 76.2554 bits (186), Expect = 4.688e-13
Identity = 81/331 (24.47%), Postives = 148/331 (44.71%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTL--EYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVE----LAQEGGASGLSVLRTF---RLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRK-----------------NFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNN 3394
            RFR+     V  ++F   +L+ I +N +++ +E  N P   T  L    +N +F  +F VEM +K++A G+      Y ++G+N+ DG +V + +++    L  E       +LR F   R LR L+++   P L+L +  +L ++  +     +   F  IF ILG+ LF   F   +    K  R                  NFD L  A++++F + +++ W  ++ +G+               W  LYF+A +    + + N+ V ++VE F   R ++ K  EKI        K A  M+ +  +  E    ++  P  +  +N
Sbjct: 2163 RFRQICTWFVNQKWFDNVVLLFIALNCITLAMERPNIPPSSTERLFLATANYVFTVVFTVEMFIKVVATGMFYGHDAYFTSGWNIMDGSLVTISIIDLLMSLISESSPRIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGTFYYCEGENIKGVRNADECRRIPGNVWTNRKYNFDDLGKALMSLFVLSSRDGWVNIMYTGLDAVGVDQQPIVNYNEWRLLYFIAFILLVGFFVLNMFVGVVVENFHRCREEQEK-EEKI----RRAAKRALQMEKKRRRMHEPPYYTNYSPTRMFVHN 2488          

HSP 8 Score: 73.1738 bits (178), Expect = 4.912e-12
Identity = 56/210 (26.67%), Postives = 104/210 (49.52%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG-----------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXX-XXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVL 3121
            R  + ++V  +YF   I   I +N ++M +EY+  P  L   L+  N  F  +F++E  +K++A G   Y+ + +N  D GIV+L +V +  E              + + V+R  R+ R+LKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG          +   +  +F +   A +T+F++ T ++WN ++
Sbjct: 2483 RMFVHNVVTSKYFDLAIAAVIGLNVVTMAMEYYKMPSGLKYALKIFNYFFTAVFILEANMKLVALGWKLYLKDRWNQLDVGIVLLSIVGIVLEELETNTHQIIPINPTIIRVMRVLRIARVLKLLKMANGIRALLDTVMQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDEIPCQGLGEHAHFANFGMAFLTLFRVATGDNWNGIM 2692          

HSP 9 Score: 68.5514 bits (166), Expect = 9.819e-11
Identity = 56/178 (31.46%), Postives = 93/178 (52.25%), Query Frame = 2
Query:  578 RDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA------------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            R  C  F++  WF+ + +  I +NCITL M +P  +    +     L   ++   + F VE+ IK+ A G+  G   YF+  WN +D  +V   +I+ +     MSL +  + R+   LR             INR P ++++V  LL +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 2165 RQICTWFVNQKWFDNVVLLFIALNCITLAMERP--NIPPSSTERLFLATANYVFTVVFTVEMFIKVVATGMFYGHDAYFTSGWNIMDGSLVTISIIDLL-----MSLISESSPRIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKG 2335          

HSP 10 Score: 61.6178 bits (148), Expect = 1.495e-8
Identity = 38/136 (27.94%), Postives = 81/136 (59.56%), Query Frame = 2
Query: 2546 IVAHRYFQRGILIAILINTLSMGIEYHNQPVL----LTNTLE----YSNMIFNGLFLVEMLLKILAEGLLG---YISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTM 2920
            ++ + +F+R  ++ IL+N +++G+    QP +    +TN  +    + ++IF   F +EM +K++A G+ G   Y+++ +N  D  IV+ GL+E         L+ +RT R+LR L+ +  +P++R+ ++++L T+
Sbjct:  297 LITNPWFERVSILVILLNCITLGMY---QPCVDDACVTNRCKILQIFDDIIF-AFFALEMTIKMVAMGICGKNTYLADSWNRLDFFIVLAGLLEYVMHVENLNLTAIRTIRVLRPLRAINRIPSMRILVMLLLDTL 428          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1ha (calcium channel, voltage-dependent, T type, alpha 1H subunit a [Source:ZFIN;Acc:ZDB-GENE-130103-1])

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 400/656 (60.98%), Postives = 495/656 (75.46%), Query Frame = 2
Query: 4244 SSLLNQDQDDHNENEEKILCNYF---WCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENK 6199
            S+ LN++     E+ +   C        ++  K+ + H   SL++ SP N+FR  CQ L+  K+FD +VL FI LNCIT+A+ERP I Q   ER FL ++NYVFTVIF  EMT+KV+A G   G  SYL+S WNV+DG+LV +SL DI++ L     +RIFGILRV RLLRTLRPLRVISRAPGLKLVV+TL++SLRPIGNIVLICC FFI+FGI GVQLFKGKF++C G D  ++ N S+C       W  ++YNFDNLGQALMSLFVLS KDGWV IMY GLDAVGV+QQP+ N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE+ E      KR + +EKK++K ++ PY+  Y   RL IH L  + Y DL I GII +NV+TM++E +  P  L+ ALK  NY+FT +FIIEAL+K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE+K N  +PIN TIIR+ RVLRIARVLKLLKMA G+R+LLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG+LEC++ NPC GLS HA FENFGMAFLTLFR++TGDNWNGIMKDTLR    +  +C       P ++PIYFV FVLMAQFVLVNVVVAVLMKHLEES+K   +D E++  ++  I +E +
Sbjct: 1064 SASLNKEDSIAEEDLDDSFCFRLRRTLAAYKPKWCKDHEEWSLYLFSPHNKFRMMCQKLISHKMFDYVVLVFIFLNCITIALERPHIQQS--ERLFLLVSNYVFTVIFVAEMTVKVVALGFYSGNQSYLKSTWNVLDGVLVFVSLIDILVSLAWT-GNRIFGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCAFFIVFGILGVQLFKGKFFHCEGGDTRNITNKSDCLQANLK-WIRRKYNFDNLGQALMSLFVLSCKDGWVNIMYDGLDAVGVDQQPERNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQEEVEARLLELKRQKLMEKKRRKALRRPYYADYSPARLYIHTLCTNHYLDLFITGIICINVVTMSIEHFNQPSYLDEALKYCNYVFTIIFIIEALLKLVAFGIRRFFKDRWNQLDLAIVLLSIMGITLEEIKMNAALPINPTIIRIMRVLRIARVLKLLKMATGMRSLLDTVMQALPQVGNLGLLFMLLFFIYAALGVELFGKLECTENNPCEGLSPHATFENFGMAFLTLFRVSTGDNWNGIMKDTLRECLPSETQCLSYL---PWVSPIYFVTFVLMAQFVLVNVVVAVLMKHLEESNKEAKEDAEMDAAIKLAILKETR 1712          

HSP 2 Score: 371.318 bits (952), Expect = 7.625e-103
Identity = 217/384 (56.51%), Postives = 271/384 (70.57%), Query Frame = 2
Query:  635 VIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSY---YYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPN---SDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYER 1765
            VI++NC+TLGMY+PCED  C++  C +L  FD CIF FFAVE++IK+ A+G+ G +GY  ++WNRLD  IV+AG++E        SL+AIRTVRVLRPLRAINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC++    S      NLSY   YY+      +      FICS    NG+ +CS +PP    L  G     N S L +     +   N SCVNWNQYYS+C+    NP+ GA+NFDNIG+AW+AIFQVI++E WVDIMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQF+ETK+RE   M  +R + +S  STL S  EP SCY E++K +S    HL + V +R  R
Sbjct:    3 VILLNCVTLGMYQPCEDLKCQSEWCIVLQAFDDCIFAFFAVEMVIKMIALGIFGINGYLGDTWNRLDFFIVMAGMMEYSLDGHNASLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFM---PSKVRDQYNLSYMSLYYE-----NEDGEDNPFICSSSKDNGMKRCSAVPP----LKEGVECTLNASFLGHVYSGLSGTGNYSCVNWNQYYSECKPGDLNPHKGAVNFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFAETKQRENMLMKEQRARYRSNDSTLASYSEPGSCYEEMLKYVS----HLYRKVKRRLSR 370          

HSP 3 Score: 306.22 bits (783), Expect = 6.698e-83
Identity = 186/325 (57.23%), Postives = 226/325 (69.54%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXX-XXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRAS 3496
            FR+++  IV  +YF RGI+IAILINTLSMGIEYH QP  LTN LE SN++F  +F++EML K+LA G+ GYI N +N+FDG IV++ + E+       GLSVLRTFRLLR+LKLVRF+PALR QL+V++KTMDNVATF  LL+LFIF FSILGM LFG     K +NG    DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TS WAALYFVALMTFGNYVLFNLLVAILVEGF  E        ++     ++EEKM  L         +++ N  ++P               G+L      PII  T ATPMP+P++S
Sbjct:  634 FRERLTRIVDSKYFNRGIMIAILINTLSMGIEYHEQPEELTNILEISNIVFTSMFVLEMLFKLLAFGIFGYIRNPYNIFDGVIVVISVWEIIGHADG-GLSVLRTFRLLRVLKLVRFLPALRRQLLVLMKTMDNVATFCMLLMLFIFTFSILGMHLFGCKFSLKMENGDTIPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDANKSDGDEEKTSVNSEEKMEQL---------QSSANGHVDP--------------CGTLPP----PIIMRTAATPMPTPKSS 930          

HSP 4 Score: 102.834 bits (255), Expect = 6.190e-21
Identity = 74/278 (26.62%), Postives = 138/278 (49.64%), Query Frame = 2
Query: 4388 FRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            FR     +++ K F+  ++  I +N +++ +E    P++      L I+N VFT +F +EM  K++A G+      Y+R+ +N+ DG++VVIS+ +     IIGH+     +LR FRLLR L+ +R +   P L+  +  L+ ++  +    ++   F   F I G+ LF  KF            +    N D     K    NFD+L  A++++F + +++ W  ++Y G+ +           + W  LYF++ +    + + N+ V ++VE F 
Sbjct:  634 FRERLTRIVDSKYFNRGIMIAILINTLSMGIEYHEQPEELTN--ILEISNIVFTSMFVLEMLFKLLAFGIF----GYIRNPYNIFDGVIVVISVWE-----IIGHADGGLSVLRTFRLLRVLKLVRFL---PALRRQLLVLMKTMDNVATFCMLLMLFIFTFSILGMHLFGCKF------------SLKMENGDTIPDRK----NFDSLLWAIVTVFQILTQEDWNVVLYNGMAST----------SPWAALYFVALMTFGNYVLFNLLVAILVEGFQ 871          

HSP 5 Score: 78.5666 bits (192), Expect = 1.342e-13
Identity = 59/156 (37.82%), Postives = 89/156 (57.05%), Query Frame = 2
Query: 4442 LFFIALNCITLAMERPSIPQKSREREFLTITNY--VFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            +  I LNC+TL M +P    K +    + +  +       FAVEM IK+IA G+  G + YL   WN +D  +V   +A +M   + GH++ +  I    R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G
Sbjct:    1 MLVILLNCVTLGMYQPCEDLKCQSEWCIVLQAFDDCIFAFFAVEMVIKMIALGIF-GINGYLGDTWNRLDFFIV---MAGMMEYSLDGHNASLSAI----RTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAG 148          

HSP 6 Score: 77.7962 bits (190), Expect = 2.298e-13
Identity = 62/239 (25.94%), Postives = 120/239 (50.21%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXX-XXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGM-----SQTSSWAALYFVALMTFGNYVL 3199
            R  + ++  + Y    I   I IN ++M IE+ NQP  L   L+Y N +F  +F++E LLK++A G+  +  + +N  D  IV+L ++ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG     +    +       F++   A +T+F++ T ++WN ++   +     S+T   + L +V+ + F  +VL
Sbjct: 1430 RLYIHTLCTNHYLDLFITGIICINVVTMSIEHFNQPSYLDEALKYCNYVFTIIFIIEALLKLVAFGIRRFFKDRWNQLDLAIVLLSIMGITLEEIKMNAALPINPTIIRIMRVLRIARVLKLLKMATGMRSLLDTVMQALPQVGNLGLLFMLLFFIYAALGVELFGKLECTENNPCEGLSPHATFENFGMAFLTLFRVSTGDNWNGIMKDTLRECLPSETQCLSYLPWVSPIYFVTFVL 1668          

HSP 7 Score: 75.8702 bits (185), Expect = 8.815e-13
Identity = 67/222 (30.18%), Postives = 123/222 (55.41%), Query Frame = 2
Query: 5327 KFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFG-----RLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            +F+  +R  +  +V+SKYF+  I   I +N ++M +E++  P EL   L+  N +FTS+F++E L K +A+G   YI + +N  D +IV++SV  I+       +    ++++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  F F+ LG+ LFG     ++E  D  P        +F++   A +T+F+I T ++WN ++ + +
Sbjct:  629 QFWEDFRERLTRIVDSKYFNRGIMIAILINTLSMGIEYHEQPEELTNILEISNIVFTSMFVLEMLFKLLAFGIFGYIRNPYNIFDGVIVVISVWEII------GHADGGLSVLRTFRLL---RVLKLVRFLPALRRQLLVLMKTMDNVATFCMLLMLFIFTFSILGMHLFGCKFSLKMENGDTIP-----DRKNFDSLLWAIVTVFQILTQEDWNVVLYNGM 836          

HSP 8 Score: 61.2326 bits (147), Expect = 2.141e-8
Identity = 62/288 (21.53%), Postives = 131/288 (45.49%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVELAQEGGASGLSVL------RTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKI 3277
            +FR   + +++H+ F   +L+ I +N +++ +E  +        L  SN +F  +F+ EM +K++A G       Y+ + +NV DG +V + L+++      +G  +       R  R LR L+++   P L+L +  ++ ++  +     +   F  +F ILG+ L                     C   N K    + NFD+L  A++++F +  ++ W  ++  G+               W  LYF++ +   ++ + N+ V ++VE F   R D+ ++  ++
Sbjct: 1114 KFRMMCQKLISHKMFDYVVLVFIFLNCITIALERPHIQQSERLFLLVSNYVFTVIFVAEMTVKVVALGFYSGNQSYLKSTWNVLDGVLVFVSLIDILVSLAWTGNRIFGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCAFFIVFGILGVQLFKGKFFHCEGGDTRNITNKSDCLQANLKWIRRKYNFDNLGQALMSLFVLSCKDGWVNIMYDGLDAVGVDQQPERNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQEEVEARL 1401          

HSP 9 Score: 59.3066 bits (142), Expect = 7.742e-8
Identity = 35/122 (28.69%), Postives = 71/122 (58.20%), Query Frame = 2
Query: 2579 LIAILINTLSMGI-----EYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLG---YISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTM 2920
            ++ IL+N +++G+     +   Q         + + IF   F VEM++K++A G+ G   Y+ + +N  D  IV+ G++E + +G  + LS +RT R+LR L+ +  +P++R+ + ++L T+
Sbjct:    1 MLVILLNCVTLGMYQPCEDLKCQSEWCIVLQAFDDCIF-AFFAVEMVIKMIALGIFGINGYLGDTWNRLDFFIVMAGMMEYSLDGHNASLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTL 121          

HSP 10 Score: 58.151 bits (139), Expect = 1.918e-7
Identity = 32/94 (34.04%), Postives = 54/94 (57.45%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETK--KRETERMLMERKKQQ 1648
            NFDN+G A +++F +   + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + +  + E E  L+E K+Q+
Sbjct: 1315 NFDNLGQALMSLFVLSCKDGWVNIMYDGLDAVGVDQQPERNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQEEVEARLLELKRQK 1408          

HSP 11 Score: 54.6842 bits (130), Expect = 2.191e-6
Identity = 56/191 (29.32%), Postives = 98/191 (51.31%), Query Frame = 2
Query:  530 DYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLR---------AINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            D+ E   +  +  +  R  C K IS   F+ + +  I +NCIT+ + +P    S +      L   ++   + F  E+ +K+ A+G   G   Y   +WN LD V+V   LI+ + S   ++ T  R   +LR LR          I+R P ++++V  L+ +L  +GN++L+C   F +FGI+GVQ+++G
Sbjct: 1100 DHEEWSLYLFSPHNKFRMMCQKLISHKMFDYVVLVFIFLNCITIALERPHIQQSERLF----LLVSNYVFTVIFVAEMTVKVVALGFYSGNQSYLKSTWNVLDGVLVFVSLIDILVS---LAWTGNRIFGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCAFFIVFGILGVQLFKG 1283          

HSP 12 Score: 53.9138 bits (128), Expect = 3.945e-6
Identity = 28/97 (28.87%), Postives = 53/97 (54.64%), Query Frame = 2
Query: 4949 FSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            +SEC     N  K    NFDN+G A +++F + + +GWV IMY  +DA          ++ +  +YFI  +++  FF++N+ + V+   F + ++ +
Sbjct:  237 YSECKPGDLNPHKGA-VNFDNIGYAWIAIFQVITLEGWVDIMYYVMDA----------HSFYNFIYFILLIIVGSFFMINLCLVVIATQFAETKQRE 322          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1hb (calcium channel, voltage-dependent, T type, alpha 1H subunit b [Source:ZFIN;Acc:ZDB-GENE-090312-128])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 421/765 (55.03%), Postives = 532/765 (69.54%), Query Frame = 2
Query: 4313 WCSWLSKFF--------RAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCC--VSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDE---------------ENKEKLRENITSDVEEIENRGN------KEIKEQIIEPNNNNIVFEPKKIEIKCNRLSNSAAVKFNRNA---NSQDSADSG--KTPPDNGSGGTLHILNLPASRKLHEQLSQS 6496
            WC  L +          R H   SL++ +P N FR  CQ ++  K+FD+IVLFFI  NCIT+A+ERP I   S ER FL ++NY+FTVIF  EMT+KV++ GL  G  SYL+S WNV+DG LV +S+ DI++ L     +RI GILRV RLLRTLRPLRVISRAPGLKLVV+TL++SLRPIGNIVLICC FFI+FGI GVQLFKGKFY+C G D  ++ N SEC   K   W  ++YNFDNLGQALMSLFVLSSKDGWV IMY GLDAV V+QQP  N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE+EE  RR  KR +R+EKK++K +Q PY+  Y   RL IH L  S Y DL I  II +NV+TM+ME Y  P  L+  LK  NY FT VF+IEA +K +A+G +R+  +RWNQLD+ IV+LS+ GI +EE+  N  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG+L+C++ NPC GLSRHA F+NFGMAFLTLFR++TGDNWNGIMKDTLR       EC+ + C    P+++P+YFV FVLMAQFVLVNVVVAVLMKHLEES+    ++ E++ E++ E++                E  +   E ++ D  +  N GN        I   +  PN++ +++  K +    +  S+        ++    +Q S DS   + P   G+     + ++PA R L+++   S
Sbjct:  611 WCLILKRLLEPYKPQWCRDHEDWSLYLFAPQNNFRMRCQKVITHKMFDHIVLFFIFFNCITIALERPDIQPDSTERIFLKVSNYIFTVIFVAEMTVKVVSLGLYAGPGSYLKSSWNVLDGFLVFVSIVDILVSLASSGGNRILGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCAFFIVFGILGVQLFKGKFYHCEGFDTRNITNKSECLQAKYK-WIRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVAVDQQPIRNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQEEEEARRREEKRQKRMEKKRRKALQRPYYADYSPTRLYIHTLCTSHYLDLFITIIIAINVLTMSMEHYRQPKYLDEGLKYCNYFFTLVFVIEAALKLVAFGFRRFFKERWNQLDLAIVLLSIMGITLEEIDLNASLPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLDCTEENPCEGLSRHATFQNFGMAFLTLFRVSTGDNWNGIMKDTLR-------ECKNDKCLSYLPLLSPLYFVTFVLMAQFVLVNVVVAVLMKHLEESNIDAREEAEMDAELKLELEAGRRQSTASVGGAAGLEGTDAKIETLSHDQGKDPNYGNFLTVGRPSISRMLSLPNDSYMLYPIKPLYGSIHERSSKQDCTLPGSSLSLGTQPSEDSAVMQVP---GAASQTSLASVPAPRPLNQRARTS 1364          

HSP 2 Score: 284.263 bits (726), Expect = 1.832e-76
Identity = 165/240 (68.75%), Postives = 192/240 (80.00%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXX-XXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTE 3244
            R  +K IV  +YF RGI+IAILINTLSMG+EYH QP  LT+ LE SN++F  LF++EMLLK+ A GL  YISN +N+FDG IVI+ + E+  +    G SVLRTFRLLR+LKLVRF+PALR QL+V++KTMDNVATF  LL+LFIFIFSILGM LFG     + +NG    DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TS +AALYFVALMTFGNYVLFNLLVAILVEGF  E
Sbjct:  371 RAVLKRIVDSKYFNRGIMIAILINTLSMGVEYHEQPDELTDVLEISNIVFTSLFVLEMLLKLSACGLFDYISNPYNIFDGIIVIISVCEIVGQADG-GFSVLRTFRLLRVLKLVRFLPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFTLRLENGDTVSDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPYAALYFVALMTFGNYVLFNLLVAILVEGFQAE 609          

HSP 3 Score: 239.195 bits (609), Expect = 1.326e-62
Identity = 151/284 (53.17%), Postives = 194/284 (68.31%), Query Frame = 2
Query:  956 MRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYL--HLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNV-------SCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
            MRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC+   ++   Y   G ++S YY+V++T         FICS +  NG+++CS++P         + RV        +DN+   V        CVNWN YY+ C A  +NP+ GAINFDNIG+AW+AIFQVI++E W DIMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE + M  +R + +S  STL S  EP SCY E++K ++  CR L + V++ Y     K
Sbjct:    2 MRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFFDNNIRMLYNVSG-SVSEYYRVDETDD-----IPFICSTNRENGMLRCSNVP---------KRRVAGADCELTADNVTELVFKEAPHHGCVNWNLYYNTCNASEHNPHNGAINFDNIGYAWIAIFQVITLEGWADIMYYVMDAHSFYNFIYFIFLIIVGSFFMINLCLVVIATQFSETKQRENQLMQEQRARFRSNESTLASLAEPGSCYEEMLKYLAHVCRKLWRHVVRIYGDLCPK 270          

HSP 4 Score: 130.183 bits (326), Expect = 2.586e-29
Identity = 145/564 (25.71%), Postives = 269/564 (47.70%), Query Frame = 2
Query: 4391 RNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQP--PYW----------KFYPH--WRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFY-MMPVELE-VALKSLNYIFTSVFIIEALIKTIAY----GPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELF-GRL-ECSDYNP--------CTG-----LSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            R   + +++ K F+  ++  I +N +++ +E    P +  +   L I+N VFT +F +EM +K+ A GL      Y+ + +N+ DG++V+IS+ +     I+G +   F +LR FRLLR L+ +R +   P L+  +  L+ ++  +    ++   F  IF I G+ LF  KF          ++N    ++ K         NFD+L  A++++F + +++ W  ++Y G+ +           + +  LYF++ +    + + N+ V ++VE F                           K++++P  P W           F P   +R+    ++  K FD  +   I  N IT+A+E   + P   E + LK  NYIFT +F+ E  +K ++     GP  Y+   WN LD  +V +S+  I++    +    I   +  + R+LR  R L+++  A G++ +++T+I +L  +GN+ L+    F +F  LGV+LF G+   C  ++         C       + R  +F+N G A ++LF +++ D W  IM D L
Sbjct:  371 RAVLKRIVDSKYFNRGIMIAILINTLSMGVEYHEQPDELTD--VLEISNIVFTSLFVLEMLLKLSACGLF----DYISNPYNIFDGIIVIISVCE-----IVGQADGGFSVLRTFRLLRVLKLVRFL---PALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKF-------TLRLENGDTVSDRK---------NFDSLLWAIVTVFQILTQEDWNVVLYNGMAST----------SPYAALYFVALMTFGNYVLFNLLVAILVEGFQA------------------ESWCLILKRLLEPYKPQWCRDHEDWSLYLFAPQNNFRMRCQKVITHKMFDHIVLFFIFFNCITIALERPDIQPDSTERIFLKVSNYIFTVIFVAEMTVKVVSLGLYAGPGSYLKSSWNVLDGFLVFVSIVDILVSLASSGGNRILGILRVL-RLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCAFFIVFGILGVQLFKGKFYHCEGFDTRNITNKSECLQAKYKWIRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGL 875          

HSP 5 Score: 72.7886 bits (177), Expect = 7.090e-12
Identity = 57/208 (27.40%), Postives = 103/208 (49.52%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVL 3121
            R  + ++    Y    I I I IN L+M +E++ QP  L   L+Y N  F  +F++E  LK++A G   +    +N  D  IV+L ++ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C  +N      R   F +   A +T+F++ T ++WN ++
Sbjct:  962 RLYIHTLCTSHYLDLFITIIIAINVLTMSMEHYRQPKYLDEGLKYCNYFFTLVFVIEAALKLVAFGFRRFFKERWNQLDLAIVLLSIMGITLEEIDLNASLPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLDCTEENPCEGLSRHATFQNFGMAFLTLFRVSTGDNWNGIM 1169          

HSP 6 Score: 64.3142 bits (155), Expect = 2.691e-9
Identity = 70/283 (24.73%), Postives = 131/283 (46.29%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHN-QPVLLTNT-LEYSNMIFNGLFLVEMLLKILAEGLLG----YISNGFNVFDGGIVILG----LVELAQEGGASGLSVLRT---FRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDE 3256
            FR + + ++ H+ F   +L  I  N +++ +E  + QP       L+ SN IF  +F+ EM +K+++ GL      Y+ + +NV DG +V +     LV LA  GG   L +LR     R LR L+++   P L+L +  ++ ++  +     +   F  +F ILG+ L                     C     K    + NFD+L  A++++F + +++ W  ++  G+   +           W  LYF++ +   ++ + N+ V ++VE F   R D+
Sbjct:  644 FRMRCQKVITHKMFDHIVLFFIFFNCITIALERPDIQPDSTERIFLKVSNYIFTVIFVAEMTVKVVSLGLYAGPGSYLKSSWNVLDGFLVFVSIVDILVSLASSGGNRILGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCAFFIVFGILGVQLFKGKFYHCEGFDTRNITNKSECLQAKYKWIRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVAVDQQPIRNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQ 926          

HSP 7 Score: 55.4546 bits (132), Expect = 1.380e-6
Identity = 50/190 (26.32%), Postives = 96/190 (50.53%), Query Frame = 2
Query:  530 DYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKP-CEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLR-------AINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            D+ +   +     ++ R  C K I+   F+ + +  I  NCIT+ + +P  +  S + I  K+    ++   + F  E+ +K+ ++GL  GP  Y   SWN LD  +V   +++ + S        I  +  +  L         I+R P ++++V  L+ +L  +GN++L+C   F +FGI+GVQ+++G
Sbjct:  629 DHEDWSLYLFAPQNNFRMRCQKVITHKMFDHIVLFFIFFNCITIALERPDIQPDSTERIFLKV---SNYIFTVIFVAEMTVKVVSLGLYAGPGSYLKSSWNVLDGFLVFVSIVDILVSLASSGGNRILGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCAFFIVFGILGVQLFKG 815          

HSP 8 Score: 55.0694 bits (131), Expect = 1.464e-6
Identity = 35/100 (35.00%), Postives = 57/100 (57.00%), Query Frame = 2
Query: 4949 FSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVG-FFVLNMFVGVVVENFH--KCRENQ 5239
            ++ CN  + N   N   NFDN+G A +++F + + +GW  IMY  +DA          ++ +  +YFI FL++VG FF++N+ + V+   F   K RENQ
Sbjct:  129 YNTCNASEHNP-HNGAINFDNIGYAWIAIFQVITLEGWADIMYYVMDA----------HSFYNFIYFI-FLIIVGSFFMINLCLVVIATQFSETKQRENQ 216          

HSP 9 Score: 53.5286 bits (127), Expect = 5.125e-6
Identity = 27/80 (33.75%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRE 1612
            NFDN+G A +++F + S + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + ++ +
Sbjct:  847 NFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVAVDQQPIRNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQ 926          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1ha (calcium channel, voltage-dependent, T type, alpha 1H subunit a [Source:ZFIN;Acc:ZDB-GENE-130103-1])

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 386/601 (64.23%), Postives = 469/601 (78.04%), Query Frame = 2
Query: 4400 CQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENK 6199
            CQ L+  K+FD +VL FI LNCIT+A+ERP I Q   ER FL ++NYVFTVIF  EMT+KV+A G   G  SYL+S WNV+DG+LV +SL DI++ L     +RIFGILRV RLLRTLRPLRVISRAPGLKLVV+TL++SLRPIGNIVLICC FFI+FGI GVQLFKGKF++C G D  ++ N S+C       W  ++YNFDNLGQALMSLFVLS KDGWV IMY GLDAVGV+QQP+ N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE+ E      KR + +EKK++K ++ PY+  Y   RL IH L  + Y DL I GII +NV+TM++E +  P  L+ ALK  NY+FT +FIIEAL+K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE+K N  +PIN TIIR+ RVLRIARVLKLLKMA G+R+LLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG+LEC++ NPC GLS HA FENFGMAFLTLFR++TGDNWNGIMKDTLR    +  +C       P ++PIYFV FVLMAQFVLVNVVVAVLMKHLEES+K   +D E++  ++  I +E +
Sbjct:    2 CQKLISHKMFDYVVLVFIFLNCITIALERPHIQQS--ERLFLLVSNYVFTVIFVAEMTVKVVALGFYSGNQSYLKSTWNVLDGVLVFVSLIDILVSLA-WTGNRIFGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCAFFIVFGILGVQLFKGKFFHCEGGDTRNITNKSDCLQANLK-WIRRKYNFDNLGQALMSLFVLSCKDGWVNIMYDGLDAVGVDQQPERNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQEEVEARLLELKRQKLMEKKRRKALRRPYYADYSPARLYIHTLCTNHYLDLFITGIICINVVTMSIEHFNQPSYLDEALKYCNYVFTIIFIIEALLKLVAFGIRRFFKDRWNQLDLAIVLLSIMGITLEEIKMNAALPINPTIIRIMRVLRIARVLKLLKMATGMRSLLDTVMQALPQVGNLGLLFMLLFFIYAALGVELFGKLECTENNPCEGLSPHATFENFGMAFLTLFRVSTGDNWNGIMKDTLRECLPSETQCLSYL---PWVSPIYFVTFVLMAQFVLVNVVVAVLMKHLEESNKEAKEDAEMDAAIKLAILKETR 595          

HSP 2 Score: 71.633 bits (174), Expect = 1.032e-11
Identity = 64/239 (26.78%), Postives = 120/239 (50.21%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXD-RKNFDSLLWAIVTVFQILTQEDWNAVLISGM-----SQTSSWAALYFVALMTFGNYVL 3199
            R  + ++  + Y    I   I IN ++M IE+ NQP  L   L+Y N +F  +F++E LLK++A G+  +  + +N  D  IV+L ++ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C   N          F++   A +T+F++ T ++WN ++   +     S+T   + L +V+ + F  +VL
Sbjct:  313 RLYIHTLCTNHYLDLFITGIICINVVTMSIEHFNQPSYLDEALKYCNYVFTIIFIIEALLKLVAFGIRRFFKDRWNQLDLAIVLLSIMGITLEEIKMNAALPINPTIIRIMRVLRIARVLKLLKMATGMRSLLDTVMQALPQVGNLGLLFMLLFFIYAALGVELFGKLECTENNPCEGLSPHATFENFGMAFLTLFRVSTGDNWNGIMKDTLRECLPSETQCLSYLPWVSPIYFVTFVL 551          

HSP 3 Score: 56.225 bits (134), Expect = 5.226e-7
Identity = 32/94 (34.04%), Postives = 54/94 (57.45%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETK--KRETERMLMERKKQQ 1648
            NFDN+G A +++F +   + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + +  + E E  L+E K+Q+
Sbjct:  198 NFDNLGQALMSLFVLSCKDGWVNIMYDGLDAVGVDQQPERNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQEEVEARLLELKRQK 291          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1hb (calcium channel, voltage-dependent, T type, alpha 1H subunit b [Source:ZFIN;Acc:ZDB-GENE-090312-128])

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 399/641 (62.25%), Postives = 488/641 (76.13%), Query Frame = 2
Query: 4313 WCSWLSKFF--------RAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCC--VSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKE 6202
            WC  L +          R H   SL++ +P N FR  CQ ++  K+FD+IVLFFI  NCIT+A+ERP I   S ER FL ++NY+FTVIF  EMT+KV++ GL  G  SYL+S WNV+DG LV +S+ DI++ L     +RI GILRV RLLRTLRPLRVISRAPGLKLVV+TL++SLRPIGNIVLICC FFI+FGI GVQLFKGKFY+C G D  ++ N SEC   K   W  ++YNFDNLGQALMSLFVLSSKDGWV IMY GLDAV V+QQP  N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE+EE  RR  KR +R+EKK++K +Q PY+  Y   RL IH L  S Y DL I  II +NV+TM+ME Y  P  L+  LK  NY FT VF+IEA +K +A+G +R+  +RWNQLD+ IV+LS+ GI +EE+  N  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG+L+C++ NPC GLSRHA F+NFGMAFLTLFR++TGDNWNGIMKDTLR       EC+ + C    P+++P+YFV FVLMAQFVLVNVVVAVLMKHLEES+    ++ E++ E++ E++   ++
Sbjct:  936 WCLILKRLLEPYKPQWCRDHEDWSLYLFAPQNNFRMRCQKVITHKMFDHIVLFFIFFNCITIALERPDIQPDSTERIFLKVSNYIFTVIFVAEMTVKVVSLGLYAGPGSYLKSSWNVLDGFLVFVSIVDILVSLASSGGNRILGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCAFFIVFGILGVQLFKGKFYHCEGFDTRNITNKSECLQAKYK-WIRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVAVDQQPIRNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQEEEEARRREEKRQKRMEKKRRKALQRPYYADYSPTRLYIHTLCTSHYLDLFITIIIAINVLTMSMEHYRQPKYLDEGLKYCNYFFTLVFVIEAALKLVAFGFRRFFKERWNQLDLAIVLLSIMGITLEEIDLNASLPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLDCTEENPCEGLSRHATFQNFGMAFLTLFRVSTGDNWNGIMKDTLR-------ECKNDKCLSYLPLLSPLYFVTFVLMAQFVLVNVVVAVLMKHLEESNIDAREEAEMDAELKLELEAGRRQ 1568          

HSP 2 Score: 352.443 bits (903), Expect = 6.212e-98
Identity = 210/389 (53.98%), Postives = 270/389 (69.41%), Query Frame = 2
Query:  635 VIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNV-------SCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
            VI++NC+TLGM++PC+D  C T RC IL  FD  IF FFAVE+++K+ A+G+ GP  Y  ++WNRLD+ IV+AG++E       +S +AIRTVRVLRPLRAINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC+   N            YY+V++T         FICS +  NG+++CS++P         + RV        +DN+   V        CVNWN YY+ C A  +NP+ GAINFDNIG+AW+AIFQVI++E W DIMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE + M  +R + +S  STL S  EP SCY E++K ++  CR L + V++ Y     K
Sbjct:    3 VILLNCVTLGMFQPCQDLECHTDRCSILQAFDDFIFAFFAVEMVVKMVALGVFGPKCYLGDTWNRLDLFIVMAGMLEYSLDGHNVSFSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFFDNNIRIE--------YYRVDETDD-----IPFICSTNRENGMLRCSNVP---------KRRVAGADCELTADNVTELVFKEAPHHGCVNWNLYYNTCNASEHNPHNGAINFDNIGYAWIAIFQVITLEGWADIMYYVMDAHSFYNFIYFIFLIIVGSFFMINLCLVVIATQFSETKQRENQLMQEQRARFRSNESTLASLAEPGSCYEEMLKYLAHVCRKLWRHVVRIYGDLCPK 369          

HSP 3 Score: 283.493 bits (724), Expect = 2.629e-76
Identity = 199/398 (50.00%), Postives = 240/398 (60.30%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXX-XXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKH-NEEKMANLMKHEAHKNQET---TKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDREIFHQEMDSLSRKSQLMSNTDGESLGVPLVLQHDQRNL--------------SRRGSDSSINHQP 3664
            R  +K IV  +YF RGI+IAILINTLSMG+EYH QP  LT+ LE SN++F  LF++EMLLK+ A GL  YISN +N+FDG IVI+ + E+  +    G SVLRTFRLLR+LKLVRF+PALR QL+V++KTMDNVATF  LL+LFIFIFSILGM LFGCKF      G    DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TS +AALYFVALMTFGNYVLFNLLVAILVEGF  E        +      + +E+K+  L+        +T     N  +EP+  +  N                    TH      P    S      I+ Q     SR++   SNT  E         HDQR+L              SRR S +S+ H P
Sbjct:  499 RAVLKRIVDSKYFNRGIMIAILINTLSMGVEYHEQPDELTDVLEISNIVFTSLFVLEMLLKLSACGLFDYISNPYNIFDGIIVIISVCEIVGQADG-GFSVLRTFRLLRVLKLVRFLPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFTLRLENGDTVSDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPYAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDASRSDTDDDMSSDYGDEDKLRELLNSGTEMKMQTLMPISNGHLEPRASMPPNN-------------------THVQFNSTPRTEVS-----HIYSQ-----SRRN---SNTSTE--------LHDQRSLVRSSCGPFGTDLWGSRRSSWNSLGHAP 855          

HSP 4 Score: 92.0485 bits (227), Expect = 8.516e-18
Identity = 70/277 (25.27%), Postives = 140/277 (50.54%), Query Frame = 2
Query: 4391 RNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            R   + +++ K F+  ++  I +N +++ +E    P +  +   L I+N VFT +F +EM +K+ A GL      Y+ + +N+ DG++V+IS+ +     I+G +   F +LR FRLLR L+ +R +   P L+  +  L+ ++  +    ++   F  IF I G+ LF  KF          ++N    ++ K         NFD+L  A++++F + +++ W  ++Y G+ +           + +  LYF++ +    + + N+ V ++VE F 
Sbjct:  499 RAVLKRIVDSKYFNRGIMIAILINTLSMGVEYHEQPDELTD--VLEISNIVFTSLFVLEMLLKLSACGLF----DYISNPYNIFDGIIVIISVCE-----IVGQADGGFSVLRTFRLLRVLKLVRFL---PALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKF-------TLRLENGDTVSDRK---------NFDSLLWAIVTVFQILTQEDWNVVLYNGMAST----------SPYAALYFVALMTFGNYVLFNLLVAILVEGFQ 735          

HSP 5 Score: 72.7886 bits (177), Expect = 6.773e-12
Identity = 71/216 (32.87%), Postives = 120/216 (55.56%), Query Frame = 2
Query: 5345 RLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFG-----RLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            R ++  +V+SKYF+  I   I +N ++M +E++  P EL   L+  N +FTS+F++E L+K  A G   YI + +N  D +IVI+SV  IV +           +++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  FIF+ LG+ LFG     RLE  D      +S   +F++   A +T+F+I T ++WN ++ + +
Sbjct:  499 RAVLKRIVDSKYFNRGIMIAILINTLSMGVEYHEQPDELTDVLEISNIVFTSLFVLEMLLKLSACGLFDYISNPYNIFDGIIVIISVCEIVGQADG------GFSVLRTFRLL---RVLKLVRFLPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFTLRLENGD-----TVSDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGM 700          

HSP 6 Score: 70.4774 bits (171), Expect = 3.802e-11
Identity = 57/208 (27.40%), Postives = 103/208 (49.52%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVL 3121
            R  + ++    Y    I I I IN L+M +E++ QP  L   L+Y N  F  +F++E  LK++A G   +    +N  D  IV+L ++ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C  +N      R   F +   A +T+F++ T ++WN ++
Sbjct: 1287 RLYIHTLCTSHYLDLFITIIIAINVLTMSMEHYRQPKYLDEGLKYCNYFFTLVFVIEAALKLVAFGFRRFFKERWNQLDLAIVLLSIMGITLEEIDLNASLPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLDCTEENPCEGLSRHATFQNFGMAFLTLFRVSTGDNWNGIM 1494          

HSP 7 Score: 65.4698 bits (158), Expect = 1.139e-9
Identity = 56/156 (35.90%), Postives = 85/156 (54.49%), Query Frame = 2
Query: 4442 LFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            +  I LNC+TL M +P   +   +     L   +      FAVEM +K++A G+  G   YL   WN +D   + I +A ++   + GH+     I    R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G
Sbjct:    1 MLVILLNCVTLGMFQPCQDLECHTDRCSILQAFDDFIFAFFAVEMVVKMVALGVF-GPKCYLGDTWNRLD---LFIVMAGMLEYSLDGHNVSFSAI----RTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAG 148          

HSP 8 Score: 61.6178 bits (148), Expect = 1.814e-8
Identity = 70/283 (24.73%), Postives = 131/283 (46.29%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHN-QPVLLTNT-LEYSNMIFNGLFLVEMLLKILAEGLLG----YISNGFNVFDGGIVILG----LVELAQEGGASGLSVLRT---FRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDE 3256
            FR + + ++ H+ F   +L  I  N +++ +E  + QP       L+ SN IF  +F+ EM +K+++ GL      Y+ + +NV DG +V +     LV LA  GG   L +LR     R LR L+++   P L+L +  ++ ++  +     +   F  +F ILG+ L                     C     K    + NFD+L  A++++F + +++ W  ++  G+   +           W  LYF++ +   ++ + N+ V ++VE F   R D+
Sbjct:  969 FRMRCQKVITHKMFDHIVLFFIFFNCITIALERPDIQPDSTERIFLKVSNYIFTVIFVAEMTVKVVSLGLYAGPGSYLKSSWNVLDGFLVFVSIVDILVSLASSGGNRILGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCAFFIVFGILGVQLFKGKFYHCEGFDTRNITNKSECLQAKYKWIRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVAVDQQPIRNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQ 1251          

HSP 9 Score: 54.6842 bits (130), Expect = 2.120e-6
Identity = 50/190 (26.32%), Postives = 96/190 (50.53%), Query Frame = 2
Query:  530 DYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKP-CEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLR-------AINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            D+ +   +     ++ R  C K I+   F+ + +  I  NCIT+ + +P  +  S + I  K+    ++   + F  E+ +K+ ++GL  GP  Y   SWN LD  +V   +++ + S        I  +  +  L         I+R P ++++V  L+ +L  +GN++L+C   F +FGI+GVQ+++G
Sbjct:  954 DHEDWSLYLFAPQNNFRMRCQKVITHKMFDHIVLFFIFFNCITIALERPDIQPDSTERIFLKVS---NYIFTVIFVAEMTVKVVSLGLYAGPGSYLKSSWNVLDGFLVFVSIVDILVSLASSGGNRILGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCAFFIVFGILGVQLFKG 1140          

HSP 10 Score: 54.299 bits (129), Expect = 2.943e-6
Identity = 37/100 (37.00%), Postives = 56/100 (56.00%), Query Frame = 2
Query: 4949 FSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVG-FFVLNMFVGVVVENFH--KCRENQ 5239
            ++ CN  + N   N   NFDN+G A +++F + + +GW  IMY  +DA          YN    +YFI FL++VG FF++N+ + V+   F   K RENQ
Sbjct:  228 YNTCNASEHNP-HNGAINFDNIGYAWIAIFQVITLEGWADIMYYVMDA-------HSFYN---FIYFI-FLIIVGSFFMINLCLVVIATQFSETKQRENQ 315          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1ia (calcium voltage-gated channel subunit alpha1 Ia [Source:ZFIN;Acc:ZDB-GENE-060503-324])

HSP 1 Score: 603.208 bits (1554), Expect = 9.184e-178
Identity = 394/652 (60.43%), Postives = 497/652 (76.23%), Query Frame = 2
Query: 4259 QDQDDHNENEEKILCNYFWCSWLSKFFRAHYYD-----SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSEC--NNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDE 6190
            +D++D  +  +  LC  F    + + +R  + +     S+F+ SP N+FR  CQ+++  K+FD +VL FI  NCIT+A+ERP I Q S ER FLT++NY+FT IF  EMT+KV++ GL +G+ +YLRS WN++DG LV +SL DI++ +  G  ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL++SL+PIGNIVLICC FFIIFGI GVQLFKGKFYYC G DV ++ N S+C   N K   W + +YNFDNLGQALMSLFVL+SKDGWV IMY GLDAV V+QQP  N N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE EE  RR  KR RR+EKK++K  + PY+  Y H RL+IH L  S Y D+ I  II +NV+TM++E Y  P  LE+ALK  NY FTS F++EA++K IA+G +R+  DRWNQLD+ IV+LSV GI +EE++ +  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG L C++  PC G+SRHA FENFGMAFLTLF+++TGDNWNGIMKDTLR        C  +      I+P+YFV FVL AQFVL+NVVVAVLMKHL++S+K   ++ E++ E++ E+ +
Sbjct: 1007 KDREDLEDELDYSLC--FRIQKMMEVYRPDWCETREDWSVFLFSPQNKFRLLCQSIIAHKLFDYVVLAFIFSNCITVALERPKILQGSLERLFLTVSNYIFTAIFVGEMTLKVVSMGLYIGEQAYLRSSWNILDGFLVFVSLIDIVVSMAGG--AKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLITSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYYCLGLDVKNITNKSDCLLANYK---WVHHKYNFDNLGQALMSLFVLASKDGWVNIMYHGLDAVAVDQQPITNNNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEVEEAKRREEKRQRRMEKKRRKAQKLPYYASYSHVRLMIHTLCTSHYLDIFITFIICVNVVTMSLEHYSQPHSLEIALKYCNYFFTSTFVLEAVLKLIAFGFRRFFKDRWNQLDLAIVLLSVMGITLEEIEISAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGELVCNEDYPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRECPPGEYTCNPSL---QFISPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEEAEMDAEIEMELAQ 1648          

HSP 2 Score: 352.829 bits (904), Expect = 3.644e-97
Identity = 209/396 (52.78%), Postives = 274/396 (69.19%), Query Frame = 2
Query:  611 WFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNL-SYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCND------------SALPNSDNMPTNVS-CVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQSTSTLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKR 1756
            WFE++SI VI++NC+TLGMY+PCE+  C + RC++L  FD  I++FFA+E+++K+ A+G+ G   Y  ++WNRLD  IV+AG++E       ++ +AIRTVRVLRPL+AINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGI+GVQ+W G+LRNRCY   N +    GL L + YYQ  +        + FICS    NG++ CSD+P        G    C D            SA P  +   + +  CVNWNQYY++C     NP+ GAINFDNIG+AW+ IFQVI++E WV+IMYYV DAHSF+++ YF+ LIIIGSFFMINLCLVVIATQFSETK+RE + M  +R +  S+STL S  EP  CY E+ +L+     H+L+   +R
Sbjct:   12 WFERISIMVILLNCVTLGMYQPCENIDCTSERCQVLQAFDAFIYIFFALEMVVKMVALGIFGRRCYLGDTWNRLDFFIVMAGMVEYSLDLQNINFSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCYPEENFTLT-SGLTLPTPYYQPEE-----DDERPFICSLAQDNGIMSCSDVPAR----REGGRECCLDKEDALHRQALGLSAEPLVNGSASAMGLCVNWNQYYTRCHTGHTNPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFIFLIIIGSFFMINLCLVVIATQFSETKQREHQLMQEQRARYLSSSTLASLAEPGDCYEELFQLVC----HILRKARRR 393          

HSP 3 Score: 275.018 bits (702), Expect = 2.292e-73
Identity = 163/241 (67.63%), Postives = 189/241 (78.42%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVEL-AQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXX-DRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTE 3244
            R K+  IV  +YF RGI+IAILINT+SMGIE+HNQP  LTN LE  N++F  +F +EM+LK+ A G   Y+ N +N+FDG IVI+ + E+  Q  G  GLSVLRTFRLLR++KLVRFMPALR QL+V++KTMDNVATF  LL+LFIFIFSILGM +FGCKF           DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TS  AALYFVALMTFGNYVLFNLLVAILVEGF  E
Sbjct:  538 RVKLWGIVESKYFNRGIMIAILINTISMGIEHHNQPDELTNVLEICNIVFTSMFTLEMILKLTAFGFFEYLRNPYNIFDGIIVIISVCEIIGQSDG--GLSVLRTFRLLRVIKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLKTEAGDTVPDRKNFDSLLWAIVTVFQILTQEDWNMVLYNGMASTSPLAALYFVALMTFGNYVLFNLLVAILVEGFQAE 776          

HSP 4 Score: 93.5893 bits (231), Expect = 3.156e-18
Identity = 70/272 (25.74%), Postives = 135/272 (49.63%), Query Frame = 2
Query: 4406 NLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
             ++E K F+  ++  I +N I++ +E  + P +      L I N VFT +F +EM +K+ A G       YLR+ +N+ DG++V+IS+ +     IIG S     +LR FRLLR ++ +R +   P L+  +  L+ ++  +    ++   F  IF I G+ +F  KF                   +  +T  +++ NFD+L  A++++F + +++ W  ++Y G+ +           +    LYF++ +    + + N+ V ++VE F 
Sbjct:  543 GIVESKYFNRGIMIAILINTISMGIEHHNQPDELTN--VLEICNIVFTSMFTLEMILKLTAFGFF----EYLRNPYNIFDGIIVIISVCE-----IIGQSDGGLSVLRTFRLLRVIKLVRFM---PALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKF---------------SLKTEAGDTVPDRK-NFDSLLWAIVTVFQILTQEDWNMVLYNGMAST----------SPLAALYFVALMTFGNYVLFNLLVAILVEGFQ 774          

HSP 5 Score: 85.8853 bits (211), Expect = 7.833e-16
Identity = 69/277 (24.91%), Postives = 135/277 (48.74%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSW-----------AALYFVALMTFGNYVLFNLLVAILVEGF---STERVDEAKLAEKIHLE 3286
            R  + ++    Y    I   I +N ++M +E+++QP  L   L+Y N  F   F++E +LK++A G   +  + +N  D  IV+L ++ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C          R   F++   A +T+FQ+ T ++WN ++   + +               + LYFV+ +    +VL N++VA+L++     + E  +EA++  +I +E
Sbjct: 1369 RLMIHTLCTSHYLDIFITFIICVNVVTMSLEHYSQPHSLEIALKYCNYFFTSTFVLEAVLKLIAFGFRRFFKDRWNQLDLAIVLLSVMGITLEEIEISAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGELVCNEDYPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRECPPGEYTCNPSLQFISPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEEAEMDAEIEME 1645          

HSP 6 Score: 77.0258 bits (188), Expect = 3.773e-13
Identity = 57/161 (35.40%), Postives = 91/161 (56.52%), Query Frame = 2
Query: 4427 FDNIVLFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            F+ I +  I LNC+TL M +P  +I   S   + L   +    + FA+EM +K++A G+  G+  YL   WN +D  +V+  + +  + L   + S I       R +R LRPL+ I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G
Sbjct:   13 FERISIMVILLNCVTLGMYQPCENIDCTSERCQVLQAFDAFIYIFFALEMVVKMVALGIF-GRRCYLGDTWNRLDFFIVMAGMVEYSLDLQNINFSAI-------RTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAG 165          

HSP 7 Score: 72.0182 bits (175), Expect = 1.144e-11
Identity = 72/242 (29.75%), Postives = 127/242 (52.48%), Query Frame = 2
Query: 5345 RLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFG-----RLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFV 6055
            R+ + G+V SKYF+  I   I +N I+M +E +  P EL   L+  N +FTS+F +E ++K  A+G   Y+ + +N  D +IVI+SV  I+ +          ++++R FR+L   RV+KL++    +R  L  +++ +  V    +L  L  FIF+ LG+ +FG     + E  D  P        +F++   A +T+F+I T ++WN ++ + + +              SP +A +YFV
Sbjct:  538 RVKLWGIVESKYFNRGIMIAILINTISMGIEHHNQPDELTNVLEICNIVFTSMFTLEMILKLTAFGFFEYLRNPYNIFDGIIVIISVCEIIGQSDG------GLSVLRTFRLL---RVIKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLKTEAGDTVP-----DRKNFDSLLWAIVTVFQILTQEDWNMVLYNGMAS-------------TSP-LAALYFV 751          

HSP 8 Score: 68.1662 bits (165), Expect = 1.656e-10
Identity = 77/290 (26.55%), Postives = 140/290 (48.28%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLE-----YSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVEL--AQEGGASGLSVLRT---FRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTER----VDEA 3259
            +FR   +SI+AH+ F   +L  I  N +++ +E   +P +L  +LE      SN IF  +F+ EM LK+++ GL      Y+ + +N+ DG +V + L+++  +  GGA  L VLR     R LR L+++   P L+L +  ++ ++  +     +   F  IF ILG+ L                     C   N K    + NFD+L  A++++F + +++ W  ++  G+   +           W  LYF++ +   ++ + N+ V ++VE F   R    V+EA
Sbjct: 1052 KFRLLCQSIIAHKLFDYVVLAFIFSNCITVALE---RPKILQGSLERLFLTVSNYIFTAIFVGEMTLKVVSMGLYIGEQAYLRSSWNILDGFLVFVSLIDIVVSMAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLITSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYYCLGLDVKNITNKSDCLLANYKWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYHGLDAVAVDQQPITNNNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEVEEA 1338          

HSP 9 Score: 55.0694 bits (131), Expect = 1.469e-6
Identity = 35/127 (27.56%), Postives = 73/127 (57.48%), Query Frame = 2
Query: 2561 YFQRGILIAILINTLSMGIEYHNQPVLLTN----TLEYSNMIFNGLFLVEMLLKILAEGLLG---YISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTM 2920
            +F+R  ++ IL+N +++G+    + +  T+     L+  +      F +EM++K++A G+ G   Y+ + +N  D  IV+ G+VE + +      S +RT R+LR LK +  +P++R+ + ++L T+
Sbjct:   12 WFERISIMVILLNCVTLGMYQPCENIDCTSERCQVLQAFDAFIYIFFALEMVVKMVALGIFGRRCYLGDTWNRLDFFIVMAGMVEYSLDLQNINFSAIRTVRVLRPLKAINRVPSMRILVNLLLDTL 138          

HSP 10 Score: 53.9138 bits (128), Expect = 3.958e-6
Identity = 26/80 (32.50%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSF----------WDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRE 1612
            NFDN+G A +++F + S + WV+IMY+  DA +           W   YF+S ++I SFF++N+ + V+   F + ++ +
Sbjct: 1254 NFDNLGQALMSLFVLASKDGWVNIMYHGLDAVAVDQQPITNNNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQ 1333          

HSP 11 Score: 53.5286 bits (127), Expect = 4.341e-6
Identity = 68/210 (32.38%), Postives = 107/210 (50.95%), Query Frame = 2
Query:  503 EKNKDLPYPDYPE-----KVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFM---------FFAVELMIKICAMGL-LGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMS-----LTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            +K  ++  PD+ E      VF F  Q    R  C   I+   F+ + +A I  NCIT+ + +P           KIL G    +F+          F  E+ +K+ +MGL +G   Y   SWN LD  +V   LI+ + S    +     L  +R +R LRPLR I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 1025 QKMMEVYRPDWCETREDWSVFLFSPQNKF-RLLCQSIIAHKLFDYVVLAFIFSNCITVALERP-----------KILQGSLERLFLTVSNYIFTAIFVGEMTLKVVSMGLYIGEQAYLRSSWNILDGFLVFVSLIDIVVSMAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLITSLKPIGNIVLICCAFFIIFGILGVQLFKG 1222          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: efhd1 (EF-hand domain family member D1 [Source:Xenbase;Acc:XB-GENE-5738953])

HSP 1 Score: 633.639 bits (1633), Expect = 0.000e+0
Identity = 417/711 (58.65%), Postives = 525/711 (73.84%), Query Frame = 2
Query: 4124 NSQPSLKTSMFLPMVFIDSSF------VSKLPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNY--FWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVS-PIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITS 6226
            +++ SL    FLP+  + S +      +  +PS+L +  EK  ++     +  +D +     K+L  Y   WC       + H   SL++ SP N+FR  CQ ++  K+FD++VL FI LNCIT+A+ERP I   S ER FL+++NY+FT IF +EM IKV+A G + G+++YL+S WNV+DG+LV +S+ DI++ L     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSLRPIGNIVLICC FFIIFGI GVQLFKGKFYYC G +  ++ N SEC    R  W  ++YNFDNLGQALMSLFVLSSKDGWV IMY GLDAV  + QP +N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE EE  RR  KR RRLEKK++K  + PY+  Y   RL IH +  S Y DL I  II +NVITM+ME Y  P  L+ ALK  NY+FT VF+ EAL K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE++ N  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG+L C++ NPC GLSRHA FENFGMAFLTLFR++TGDNWNGIMKDTLR +C++ +   KNC    P+I+P+YFV FVL+AQFVLVNVVVAVLMKHLEES+K   +D E++ E++ E+  +   + R+   S
Sbjct: 1167 DTRGSLDIPDFLPLAMVPSDYQDCNGKMMHVPSDLFVRVEKHREDPLEYEDDIEDSYCFRIRKMLEPYKPTWC-------KTHEDWSLYMFSPQNQFRMMCQKVIAHKMFDHVVLVFIFLNCITIALERPDIDPNSLERIFLSVSNYIFTAIFVLEMAIKVVALGFVSGENTYLQSSWNVLDGILVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGLETRNITNRSECTR-ARYKWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVATDVQPVKNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRRPYYAEYSPARLYIHTMCTSHYLDLFITCIICINVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEALFKLVAFGFRRFFKDRWNQLDLAIVLLSIMGITLEEIEINASLPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNEENPCEGLSRHATFENFGMAFLTLFRVSTGDNWNGIMKDTLR-ECNSDD---KNCLTYLPVISPVYFVTFVLIAQFVLVNVVVAVLMKHLEESNKEAKEDAEMDAEIEMEMSRDGDFQRRDGSGS 1865          

HSP 2 Score: 404.445 bits (1038), Expect = 8.865e-113
Identity = 227/432 (52.55%), Postives = 296/432 (68.52%), Query Frame = 2
Query:  485 ERIENTEKNKDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
            E+   +E+ + +PYP     VFF L+QT  PR+WCL+ +  P +   S+ VI++NC+TLGM++PCEDT+C + RC IL  FD  IF FFAVE++IK+ A+G+ G   Y  ++WN LD  IV+AG++E       +SL+AIRTVRVLRPLRAINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC++  N    +    L  YYQV+           +ICS +  NG++KC DIPP +            D +     + P+  SCVN NQYY+ C+    NP+ GAINFDNIG+AW+AIFQVI++E WVDIMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE + M  +R +  S  ST+ S  EP SCY E++K I    R + +  ++ Y  +  K
Sbjct:   55 EQGMGSEEGEQVPYPALAPTVFFCLSQTTRPRNWCLRLVCNP-YPLHSMLVILLNCVTLGMFQPCEDTNCMSERCNILEAFDGFIFAFFAVEMVIKMVALGIFGQKCYLGDTWNWLDFFIVMAGMLEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFMDTNFVMSYNFTPLRPYYQVDDAE-----DNPYICSSNRDNGMLKCQDIPPKM------------DCSHVYYSDFPSRNSCVNINQYYNVCKPGEFNPHKGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRENQLMQEQRARYLSNDSTIASFSEPGSCYEELLKYICHIFRKVKRRTLRLYNNWQNK 468          

HSP 3 Score: 310.842 bits (795), Expect = 4.847e-84
Identity = 191/331 (57.70%), Postives = 231/331 (69.79%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXX-XXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVM--PIITHTDATPMPSPRASPFND 3508
            F  ++K IV  +YF RGI+IAILINTLSMGIEYH QP  LTN LE SN++F  +F +EMLLK+LA G+  YI N +N+FDG IV++ + E+  +    GLSVLRTFRLLR+LKLVRFMPALR QL+V++KTMDNVATF  LL+LFIFIFSILGM LFGCKF      G+   DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TSSWAALYFVALMTFGNYVLFNLLVAILVEGF  E        E+     + +E +  L +  A + +  +                +A+   G L+ +  M  PII  T ATPMP+P++SP  D
Sbjct:  749 FTVRLKRIVDSKYFNRGIMIAILINTLSMGIEYHEQPEELTNALEISNIVFTSMFALEMLLKLLAFGIFQYIKNPYNIFDGIIVVISVWEIIGQSDG-GLSVLRTFRLLRVLKLVRFMPALRRQLVVLVKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFTWTADTGETVKDRKNFDSLLWAIVTVFQILTQEDWNMVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDATRSDTEEDKASGNFDEDLEKLKELRAAELKMYS----------------LAVTPNGHLDPRSSMPPPIIMRTAATPMPTPKSSPCMD 1062          

HSP 4 Score: 104.76 bits (260), Expect = 2.170e-21
Identity = 73/273 (26.74%), Postives = 143/273 (52.38%), Query Frame = 2
Query: 4403 QNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            + +++ K F+  ++  I +N +++ +E    P++      L I+N VFT +FA+EM +K++A G+      Y+++ +N+ DG++VVIS+ +     IIG S     +LR FRLLR L+ +R +   P L+  +  L+ ++  +    ++   F  IF I G+ LF  KF + +               D   T K+++ NFD+L  A++++F + +++ W  ++Y G+ +           + W  LYF++ +    + + N+ V ++VE F 
Sbjct:  754 KRIVDSKYFNRGIMIAILINTLSMGIEYHEQPEELTNA--LEISNIVFTSMFALEMLLKLLAFGIF----QYIKNPYNIFDGIIVVISVWE-----IIGQSDGGLSVLRTFRLLRVLKLVRFM---PALRRQLVVLVKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFTWTA---------------DTGETVKDRK-NFDSLLWAIVTVFQILTQEDWNMVLYNGMAST----------SSWAALYFVALMTFGNYVLFNLLVAILVEGFQ 986          

HSP 5 Score: 102.064 bits (253), Expect = 1.236e-20
Identity = 105/358 (29.33%), Postives = 159/358 (44.41%), Query Frame = 2
Query: 4361 LFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQK--SREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKF--------------------------------YYCSGP---------------DVAHV--KNFSECN-----NDKRNTWKNQQY-------NFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH--KCRENQ 5239
             F LS   R RN C  L+    +    +  I LNC+TL M +P       S     L   +      FAVEM IK++A G+  G+  YL   WN +D  +V   +A ++   + GH+  +  I    R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G                                  Y CS                 D +HV   +F   N     N   N  K  ++       NFDN+G A +++F + + +GWV IMY  +DA          ++ +  +YFI  +++  FF++N+ + V+   F   K RENQ
Sbjct:   76 FFCLSQTTRPRNWCLRLVCNP-YPLHSMLVILLNCVTLGMFQPCEDTNCMSERCNILEAFDGFIFAFFAVEMVIKMVALGIF-GQKCYLGDTWNWLDFFIV---MAGMLEYSLDGHNVSLSAI----RTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFMDTNFVMSYNFTPLRPYYQVDDAEDNPYICSSNRDNGMLKCQDIPPKMDCSHVYYSDFPSRNSCVNINQYYNVCKPGEFNPHKGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDA----------HSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRENQ 414          

HSP 6 Score: 82.0333 bits (201), Expect = 1.457e-14
Identity = 80/341 (23.46%), Postives = 167/341 (48.97%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSS--WAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDRE 3514
            R  + ++    Y    I   I IN ++M +E++NQP  L   L+Y N +F  +F+ E L K++A G   +  + +N  D  IV+L ++ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C  +N      R   F++   A +T+F++ T ++WN ++   + + +S     L ++ +++   +V F     +L+  F    V  A L +  HLE+ N+E   +  + +A    E +++   + ++  S ++N+  ++K S+++   +P  ++     +P+  + P  + E
Sbjct: 1574 RLYIHTMCTSHYLDLFITCIICINVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEALFKLVAFGFRRFFKDRWNQLDLAIVLLSIMGITLEEIEINASLPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNEENPCEGLSRHATFENFGMAFLTLFRVSTGDNWNGIMKDTLRECNSDDKNCLTYLPVISPVYFVTF-----VLIAQFVLVNVVVAVLMK--HLEESNKEAKED-AEMDAEIEMEMSRDGDFQRRDG-SGSRNLLAVKKISVSRMLSLPNDSYMFRPVLPAKSSYPLQEVE 1905          

HSP 7 Score: 76.2554 bits (186), Expect = 8.076e-13
Identity = 64/205 (31.22%), Postives = 117/205 (57.07%), Query Frame = 2
Query: 5363 LVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            +V+SKYF+  I   I +N ++M +E++  P EL  AL+  N +FTS+F +E L+K +A+G  +YI + +N  D +IV++SV  I+ +          ++++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  FIF+ LG+ LFG       +    +    +F++   A +T+F+I T ++WN ++ + +
Sbjct:  756 IVDSKYFNRGIMIAILINTLSMGIEYHEQPEELTNALEISNIVFTSMFALEMLLKLLAFGIFQYIKNPYNIFDGIIVVISVWEIIGQSDG------GLSVLRTFRLL---RVLKLVRFMPALRRQLVVLVKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFTWTADTGETVKDRKNFDSLLWAIVTVFQILTQEDWNMVLYNGM 951          

HSP 8 Score: 73.1738 bits (178), Expect = 6.877e-12
Identity = 72/284 (25.35%), Postives = 138/284 (48.59%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLE-----YSNMIFNGLFLVEMLLKILAEGLLG----YISNGFNVFDGGIVILGLVE----LAQEGGASGLSVLRT---FRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSS----------WAALYFVALMTFGNYVLFNLLVAILVEGFSTER 3247
            +FR   + ++AH+ F   +L+ I +N +++ +E   +P +  N+LE      SN IF  +F++EM +K++A G +     Y+ + +NV DG +V + +++    LA  GGA  L VLR     R LR L+++   P L+L +  ++ ++  +     +   F  IF ILG+ L                     C     K    + NFD+L  A++++F + +++ W  ++  G+   ++          W  LYF++ +   ++ + N+ V ++VE F   R
Sbjct: 1255 QFRMMCQKVIAHKMFDHVVLVFIFLNCITIALE---RPDIDPNSLERIFLSVSNYIFTAIFVLEMAIKVVALGFVSGENTYLQSSWNVLDGILVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGLETRNITNRSECTRARYKWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVATDVQPVKNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCR 1535          

HSP 9 Score: 58.151 bits (139), Expect = 2.665e-7
Identity = 51/173 (29.48%), Postives = 90/173 (52.02%), Query Frame = 2
Query:  578 RDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            R  C K I+   F+ + +  I +NCIT+ + +P  D    ++    L   ++     F +E+ IK+ A+G + G + Y   SWN LD ++V   +I+ + S        I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 1257 RMMCQKVIAHKMFDHVVLVFIFLNCITIALERP--DIDPNSLERIFLSVSNYIFTAIFVLEMAIKVVALGFVSGENTYLQSSWNVLDGILVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKG 1427          

HSP 10 Score: 54.299 bits (129), Expect = 3.599e-6
Identity = 27/80 (33.75%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRE 1612
            NFDN+G A +++F + S + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + ++ +
Sbjct: 1459 NFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVATDVQPVKNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQ 1538          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: efhd1 (EF-hand domain family member D1 [Source:Xenbase;Acc:XB-GENE-5738953])

HSP 1 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 420/759 (55.34%), Postives = 532/759 (70.09%), Query Frame = 2
Query: 4196 LPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNY--FWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ-------XXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVS-PIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRGNKEIKEQIIEPNNNNIVFEPKKIEIKCNRLSNSAAVKFNRNA---NSQDSADSGKTPPDNGS 6430
            +PS+L +  EK  ++     +  +D +     K+L  Y   WC       + H   SL++ SP N+FR  CQ ++  K+FD++VL FI LNCIT+A+ERP I   S ER FL+++NY+FT IF +EM IKV+A G + G+++YL+S WNV+DG+LV +S+ DI++ L     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSLRPIGNIVLICC FFIIFGI GVQLFKGKFYYC G +  ++ N SEC    R  W  ++YNFDNLGQALMSLFVLSSKDGWV IMY GLDAV  + QP +N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++Q        +E++ RR  K+ R       +  + PY+  Y   RL IH +  S Y DL I  II +NVITM+ME Y  P  L+ ALK  NY+FT VF+ EAL K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE++ N  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG+L C++ NPC GLSRHA FENFGMAFLTLFR++TGDNWNGIMKDTLR +C++ +   KNC    P+I+P+YFV FVL+AQFVLVNVVVAVLMKHLEES+K   +D E++ E++ E+D      L       V  + +  N     + + P  ++   +    E++     NS  V+    A   N QDSAD  K PP + S
Sbjct: 1189 VPSDLFVRVEKHREDPLEYEDDIEDSYCFRIRKMLEPYKPTWC-------KTHEDWSLYMFSPQNQFRMMCQKVIAHKMFDHVVLVFIFLNCITIALERPDIDPNSLERIFLSVSNYIFTAIFVLEMAIKVVALGFVSGENTYLQSSWNVLDGILVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGLETRNITNRSECTR-ARYKWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVATDVQPVKNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRSKALYMSEAQRRPYYAEYSPARLYIHTMCTSHYLDLFITCIICINVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEALFKLVAFGFRRFFKDRWNQLDLAIVLLSIMGITLEEIEINASLPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNEENPCEGLSRHATFENFGMAFLTLFRVSTGDNWNGIMKDTLR-ECNSDD---KNCLTYLPVISPVYFVTFVLIAQFVLVNVVVAVLMKHLEESNKEAKEDAEMDAEIEMEMDGSGSRNLLAVKKISVSRMLSLPNDSYMFRPVLPAKSSYPLQ----EVETTE-DNSPHVECQPQASVSNHQDSADLPKIPPPHTS 1930          

HSP 2 Score: 404.831 bits (1039), Expect = 6.290e-113
Identity = 227/432 (52.55%), Postives = 297/432 (68.75%), Query Frame = 2
Query:  485 ERIENTEKNKDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
            E+   +E+ + +PYP     VFF L+QT  PR+WCL+ +  P +   S+ VI++NC+TLGM++PCEDT+C + RC IL  FD  IF FFAVE++IK+ A+G+ G   Y  ++WN LD  IV+AG++E       +SL+AIRTVRVLRPLRAINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC++  N    +    L  YYQV+      +    +ICS +  NG++KC DIPP +            D +     + P+  SCVN NQYY+ C+    NP+ GAINFDNIG+AW+AIFQVI++E WVDIMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE + M  +R +  S  ST+ S  EP SCY E++K I    R + +  ++ Y  +  K
Sbjct:   49 EQGMGSEEGEQVPYPALAPTVFFCLSQTTRPRNWCLRLVCNP-YPLHSMLVILLNCVTLGMFQPCEDTNCMSERCNILEAFDGFIFAFFAVEMVIKMVALGIFGQKCYLGDTWNWLDFFIVMAGMLEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFMDTNFVMSYNFTPLRPYYQVDD-----AEDNPYICSSNRDNGMLKCQDIPPKM------------DCSHVYYSDFPSRNSCVNINQYYNVCKPGEFNPHKGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRENQLMQEQRARYLSNDSTIASFSEPGSCYEELLKYICHIFRKVKRRTLRLYNNWQNK 462          

HSP 3 Score: 310.842 bits (795), Expect = 4.927e-84
Identity = 191/331 (57.70%), Postives = 231/331 (69.79%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXX-XXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVM--PIITHTDATPMPSPRASPFND 3508
            F  ++K IV  +YF RGI+IAILINTLSMGIEYH QP  LTN LE SN++F  +F +EMLLK+LA G+  YI N +N+FDG IV++ + E+  +    GLSVLRTFRLLR+LKLVRFMPALR QL+V++KTMDNVATF  LL+LFIFIFSILGM LFGCKF      G+   DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TSSWAALYFVALMTFGNYVLFNLLVAILVEGF  E        E+     + +E +  L +  A + +  +                +A+   G L+ +  M  PII  T ATPMP+P++SP  D
Sbjct:  743 FTVRLKRIVDSKYFNRGIMIAILINTLSMGIEYHEQPEELTNALEISNIVFTSMFALEMLLKLLAFGIFQYIKNPYNIFDGIIVVISVWEIIGQSDG-GLSVLRTFRLLRVLKLVRFMPALRRQLVVLVKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFTWTADTGETVKDRKNFDSLLWAIVTVFQILTQEDWNMVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDATRSDTEEDKASGNFDEDLEKLKELRAAELKMYS----------------LAVTPNGHLDPRSSMPPPIIMRTAATPMPTPKSSPCMD 1056          

HSP 4 Score: 104.76 bits (260), Expect = 1.985e-21
Identity = 73/273 (26.74%), Postives = 143/273 (52.38%), Query Frame = 2
Query: 4403 QNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            + +++ K F+  ++  I +N +++ +E    P++      L I+N VFT +FA+EM +K++A G+      Y+++ +N+ DG++VVIS+ +     IIG S     +LR FRLLR L+ +R +   P L+  +  L+ ++  +    ++   F  IF I G+ LF  KF + +               D   T K+++ NFD+L  A++++F + +++ W  ++Y G+ +           + W  LYF++ +    + + N+ V ++VE F 
Sbjct:  748 KRIVDSKYFNRGIMIAILINTLSMGIEYHEQPEELTNA--LEISNIVFTSMFALEMLLKLLAFGIF----QYIKNPYNIFDGIIVVISVWE-----IIGQSDGGLSVLRTFRLLRVLKLVRFM---PALRRQLVVLVKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFTWTA---------------DTGETVKDRK-NFDSLLWAIVTVFQILTQEDWNMVLYNGMAST----------SSWAALYFVALMTFGNYVLFNLLVAILVEGFQ 980          

HSP 5 Score: 102.834 bits (255), Expect = 9.087e-21
Identity = 105/358 (29.33%), Postives = 159/358 (44.41%), Query Frame = 2
Query: 4361 LFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQK--SREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKF--------------------------------YYCSGP---------------DVAHV--KNFSECN-----NDKRNTWKNQQY-------NFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH--KCRENQ 5239
             F LS   R RN C  L+    +    +  I LNC+TL M +P       S     L   +      FAVEM IK++A G+  G+  YL   WN +D  +V   +A ++   + GH+  +  I    R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G                                  Y CS                 D +HV   +F   N     N   N  K  ++       NFDN+G A +++F + + +GWV IMY  +DA          ++ +  +YFI  +++  FF++N+ + V+   F   K RENQ
Sbjct:   70 FFCLSQTTRPRNWCLRLVCNP-YPLHSMLVILLNCVTLGMFQPCEDTNCMSERCNILEAFDGFIFAFFAVEMVIKMVALGIF-GQKCYLGDTWNWLDFFIV---MAGMLEYSLDGHNVSLSAI----RTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFMDTNFVMSYNFTPLRPYYQVDDAEDNPYICSSNRDNGMLKCQDIPPKMDCSHVYYSDFPSRNSCVNINQYYNVCKPGEFNPHKGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDA----------HSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRENQ 408          

HSP 6 Score: 81.6481 bits (200), Expect = 1.868e-14
Identity = 83/341 (24.34%), Postives = 164/341 (48.09%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSS--WAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDRE 3514
            R  + ++    Y    I   I IN ++M +E++NQP  L   L+Y N +F  +F+ E L K++A G   +  + +N  D  IV+L ++ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C  +N      R   F++   A +T+F++ T ++WN ++   + + +S     L ++ +++   +V F     +L+  F    V  A L +  HLE+ N+E      K +A  + E      IE +   S ++N+  ++K S+++   +P  ++     +P+  + P  + E
Sbjct: 1573 RLYIHTMCTSHYLDLFITCIICINVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEALFKLVAFGFRRFFKDRWNQLDLAIVLLSIMGITLEEIEINASLPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNEENPCEGLSRHATFENFGMAFLTLFRVSTGDNWNGIMKDTLRECNSDDKNCLTYLPVISPVYFVTF-----VLIAQFVLVNVVVAVLMK--HLEESNKEA-----KEDAEMDAE------IEMEMDGSGSRNLLAVKKISVSRMLSLPNDSYMFRPVLPAKSSYPLQEVE 1895          

HSP 7 Score: 76.6406 bits (187), Expect = 6.580e-13
Identity = 64/205 (31.22%), Postives = 117/205 (57.07%), Query Frame = 2
Query: 5363 LVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            +V+SKYF+  I   I +N ++M +E++  P EL  AL+  N +FTS+F +E L+K +A+G  +YI + +N  D +IV++SV  I+ +          ++++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  FIF+ LG+ LFG       +    +    +F++   A +T+F+I T ++WN ++ + +
Sbjct:  750 IVDSKYFNRGIMIAILINTLSMGIEYHEQPEELTNALEISNIVFTSMFALEMLLKLLAFGIFQYIKNPYNIFDGIIVVISVWEIIGQSDG------GLSVLRTFRLL---RVLKLVRFMPALRRQLVVLVKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFTWTADTGETVKDRKNFDSLLWAIVTVFQILTQEDWNMVLYNGM 945          

HSP 8 Score: 73.559 bits (179), Expect = 5.747e-12
Identity = 72/284 (25.35%), Postives = 138/284 (48.59%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLE-----YSNMIFNGLFLVEMLLKILAEGLLG----YISNGFNVFDGGIVILGLVE----LAQEGGASGLSVLRT---FRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSS----------WAALYFVALMTFGNYVLFNLLVAILVEGFSTER 3247
            +FR   + ++AH+ F   +L+ I +N +++ +E   +P +  N+LE      SN IF  +F++EM +K++A G +     Y+ + +NV DG +V + +++    LA  GGA  L VLR     R LR L+++   P L+L +  ++ ++  +     +   F  IF ILG+ L                     C     K    + NFD+L  A++++F + +++ W  ++  G+   ++          W  LYF++ +   ++ + N+ V ++VE F   R
Sbjct: 1247 QFRMMCQKVIAHKMFDHVVLVFIFLNCITIALE---RPDIDPNSLERIFLSVSNYIFTAIFVLEMAIKVVALGFVSGENTYLQSSWNVLDGILVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGLETRNITNRSECTRARYKWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVATDVQPVKNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCR 1527          

HSP 9 Score: 58.151 bits (139), Expect = 2.726e-7
Identity = 51/173 (29.48%), Postives = 90/173 (52.02%), Query Frame = 2
Query:  578 RDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            R  C K I+   F+ + +  I +NCIT+ + +P  D    ++    L   ++     F +E+ IK+ A+G + G + Y   SWN LD ++V   +I+ + S        I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 1249 RMMCQKVIAHKMFDHVVLVFIFLNCITIALERP--DIDPNSLERIFLSVSNYIFTAIFVLEMAIKVVALGFVSGENTYLQSSWNVLDGILVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKG 1419          

HSP 10 Score: 54.299 bits (129), Expect = 3.652e-6
Identity = 27/80 (33.75%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRE 1612
            NFDN+G A +++F + S + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + ++ +
Sbjct: 1451 NFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVATDVQPVKNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQ 1530          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: efhd1 (EF-hand domain family member D1 [Source:Xenbase;Acc:XB-GENE-5738953])

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 422/773 (54.59%), Postives = 540/773 (69.86%), Query Frame = 2
Query: 4196 LPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNY--FWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ-------XXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVS-PIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRGNKEIKE----QIIEPNNNNIVFEP----------KKIEIKCNRLSNSAAVKFNRNA---NSQDSADSGKTPPDNGS 6430
            +PS+L +  EK  ++     +  +D +     K+L  Y   WC       + H   SL++ SP N+FR  CQ ++  K+FD++VL FI LNCIT+A+ERP I   S ER FL+++NY+FT IF +EM IKV+A G + G+++YL+S WNV+DG+LV +S+ DI++ L     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSLRPIGNIVLICC FFIIFGI GVQLFKGKFYYC G +  ++ N SEC    R  W  ++YNFDNLGQALMSLFVLSSKDGWV IMY GLDAV  + QP +N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++Q        +E++ RR  K+ R       +  + PY+  Y   RL IH +  S Y DL I  II +NVITM+ME Y  P  L+ ALK  NY+FT VF+ EAL K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE++ N  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG+L C++ NPC GLSRHA FENFGMAFLTLFR++TGDNWNGIMKDTLR +C++ +   KNC    P+I+P+YFV FVL+AQFVLVNVVVAVLMKHLEES+K   +D E++ E++ E+  +   + R+   S       R    +K+    +++   N++ +F P          +++E   +   NS  V+    A   N QDSAD  K PP + S
Sbjct: 1199 VPSDLFVRVEKHREDPLEYEDDIEDSYCFRIRKMLEPYKPTWC-------KTHEDWSLYMFSPQNQFRMMCQKVIAHKMFDHVVLVFIFLNCITIALERPDIDPNSLERIFLSVSNYIFTAIFVLEMAIKVVALGFVSGENTYLQSSWNVLDGILVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGLETRNITNRSECTR-ARYKWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVATDVQPVKNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRSKALYMSEAQRRPYYAEYSPARLYIHTMCTSHYLDLFITCIICINVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEALFKLVAFGFRRFFKDRWNQLDLAIVLLSIMGITLEEIEINASLPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNEENPCEGLSRHATFENFGMAFLTLFRVSTGDNWNGIMKDTLR-ECNSDD---KNCLTYLPVISPVYFVTFVLIAQFVLVNVVVAVLMKHLEESNKEAKEDAEMDAEIEMEMSRDGDFQRRDGSGS-------RNLLAVKKISVSRMLSLPNDSYMFRPVLPAKSSYPLQEVETTED---NSPHVECQPQASVSNHQDSADLPKIPPPHTS 1949          

HSP 2 Score: 404.06 bits (1037), Expect = 9.928e-113
Identity = 227/432 (52.55%), Postives = 297/432 (68.75%), Query Frame = 2
Query:  485 ERIENTEKNKDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
            E+   +E+ + +PYP     VFF L+QT  PR+WCL+ +  P +   S+ VI++NC+TLGM++PCEDT+C + RC IL  FD  IF FFAVE++IK+ A+G+ G   Y  ++WN LD  IV+AG++E       +SL+AIRTVRVLRPLRAINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC++  N    +    L  YYQV+      +    +ICS +  NG++KC DIPP +            D +     + P+  SCVN NQYY+ C+    NP+ GAINFDNIG+AW+AIFQVI++E WVDIMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE + M  +R +  S  ST+ S  EP SCY E++K I    R + +  ++ Y  +  K
Sbjct:   59 EQGMGSEEGEQVPYPALAPTVFFCLSQTTRPRNWCLRLVCNP-YPLHSMLVILLNCVTLGMFQPCEDTNCMSERCNILEAFDGFIFAFFAVEMVIKMVALGIFGQKCYLGDTWNWLDFFIVMAGMLEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFMDTNFVMSYNFTPLRPYYQVDD-----AEDNPYICSSNRDNGMLKCQDIPPKM------------DCSHVYYSDFPSRNSCVNINQYYNVCKPGEFNPHKGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRENQLMQEQRARYLSNDSTIASFSEPGSCYEELLKYICHIFRKVKRRTLRLYNNWQNK 472          

HSP 3 Score: 310.457 bits (794), Expect = 6.231e-84
Identity = 191/331 (57.70%), Postives = 231/331 (69.79%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXX-XXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVM--PIITHTDATPMPSPRASPFND 3508
            F  ++K IV  +YF RGI+IAILINTLSMGIEYH QP  LTN LE SN++F  +F +EMLLK+LA G+  YI N +N+FDG IV++ + E+  +    GLSVLRTFRLLR+LKLVRFMPALR QL+V++KTMDNVATF  LL+LFIFIFSILGM LFGCKF      G+   DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TSSWAALYFVALMTFGNYVLFNLLVAILVEGF  E        E+     + +E +  L +  A + +  +                +A+   G L+ +  M  PII  T ATPMP+P++SP  D
Sbjct:  753 FTVRLKRIVDSKYFNRGIMIAILINTLSMGIEYHEQPEELTNALEISNIVFTSMFALEMLLKLLAFGIFQYIKNPYNIFDGIIVVISVWEIIGQSDG-GLSVLRTFRLLRVLKLVRFMPALRRQLVVLVKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFTWTADTGETVKDRKNFDSLLWAIVTVFQILTQEDWNMVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDATRSDTEEDKASGNFDEDLEKLKELRAAELKMYS----------------LAVTPNGHLDPRSSMPPPIIMRTAATPMPTPKSSPCMD 1066          

HSP 4 Score: 104.375 bits (259), Expect = 2.554e-21
Identity = 73/273 (26.74%), Postives = 143/273 (52.38%), Query Frame = 2
Query: 4403 QNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            + +++ K F+  ++  I +N +++ +E    P++      L I+N VFT +FA+EM +K++A G+      Y+++ +N+ DG++VVIS+ +     IIG S     +LR FRLLR L+ +R +   P L+  +  L+ ++  +    ++   F  IF I G+ LF  KF + +               D   T K+++ NFD+L  A++++F + +++ W  ++Y G+ +           + W  LYF++ +    + + N+ V ++VE F 
Sbjct:  758 KRIVDSKYFNRGIMIAILINTLSMGIEYHEQPEELTNA--LEISNIVFTSMFALEMLLKLLAFGIF----QYIKNPYNIFDGIIVVISVWE-----IIGQSDGGLSVLRTFRLLRVLKLVRFM---PALRRQLVVLVKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFTWTA---------------DTGETVKDRK-NFDSLLWAIVTVFQILTQEDWNMVLYNGMAST----------SSWAALYFVALMTFGNYVLFNLLVAILVEGFQ 990          

HSP 5 Score: 101.679 bits (252), Expect = 1.735e-20
Identity = 105/358 (29.33%), Postives = 159/358 (44.41%), Query Frame = 2
Query: 4361 LFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQK--SREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKF--------------------------------YYCSGP---------------DVAHV--KNFSECN-----NDKRNTWKNQQY-------NFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH--KCRENQ 5239
             F LS   R RN C  L+    +    +  I LNC+TL M +P       S     L   +      FAVEM IK++A G+  G+  YL   WN +D  +V   +A ++   + GH+  +  I    R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G                                  Y CS                 D +HV   +F   N     N   N  K  ++       NFDN+G A +++F + + +GWV IMY  +DA          ++ +  +YFI  +++  FF++N+ + V+   F   K RENQ
Sbjct:   80 FFCLSQTTRPRNWCLRLVCNP-YPLHSMLVILLNCVTLGMFQPCEDTNCMSERCNILEAFDGFIFAFFAVEMVIKMVALGIF-GQKCYLGDTWNWLDFFIV---MAGMLEYSLDGHNVSLSAI----RTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFMDTNFVMSYNFTPLRPYYQVDDAEDNPYICSSNRDNGMLKCQDIPPKMDCSHVYYSDFPSRNSCVNINQYYNVCKPGEFNPHKGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDA----------HSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRENQ 418          

HSP 6 Score: 82.0333 bits (201), Expect = 1.717e-14
Identity = 80/341 (23.46%), Postives = 167/341 (48.97%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSS--WAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDRE 3514
            R  + ++    Y    I   I IN ++M +E++NQP  L   L+Y N +F  +F+ E L K++A G   +  + +N  D  IV+L ++ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C  +N      R   F++   A +T+F++ T ++WN ++   + + +S     L ++ +++   +V F     +L+  F    V  A L +  HLE+ N+E   +  + +A    E +++   + ++  S ++N+  ++K S+++   +P  ++     +P+  + P  + E
Sbjct: 1583 RLYIHTMCTSHYLDLFITCIICINVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEALFKLVAFGFRRFFKDRWNQLDLAIVLLSIMGITLEEIEINASLPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNEENPCEGLSRHATFENFGMAFLTLFRVSTGDNWNGIMKDTLRECNSDDKNCLTYLPVISPVYFVTF-----VLIAQFVLVNVVVAVLMK--HLEESNKEAKED-AEMDAEIEMEMSRDGDFQRRDG-SGSRNLLAVKKISVSRMLSLPNDSYMFRPVLPAKSSYPLQEVE 1914          

HSP 7 Score: 76.2554 bits (186), Expect = 9.052e-13
Identity = 64/205 (31.22%), Postives = 117/205 (57.07%), Query Frame = 2
Query: 5363 LVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            +V+SKYF+  I   I +N ++M +E++  P EL  AL+  N +FTS+F +E L+K +A+G  +YI + +N  D +IV++SV  I+ +          ++++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  FIF+ LG+ LFG       +    +    +F++   A +T+F+I T ++WN ++ + +
Sbjct:  760 IVDSKYFNRGIMIAILINTLSMGIEYHEQPEELTNALEISNIVFTSMFALEMLLKLLAFGIFQYIKNPYNIFDGIIVVISVWEIIGQSDG------GLSVLRTFRLL---RVLKLVRFMPALRRQLVVLVKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFTWTADTGETVKDRKNFDSLLWAIVTVFQILTQEDWNMVLYNGM 955          

HSP 8 Score: 72.7886 bits (177), Expect = 8.968e-12
Identity = 72/284 (25.35%), Postives = 138/284 (48.59%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLE-----YSNMIFNGLFLVEMLLKILAEGLLG----YISNGFNVFDGGIVILGLVE----LAQEGGASGLSVLRT---FRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSS----------WAALYFVALMTFGNYVLFNLLVAILVEGFSTER 3247
            +FR   + ++AH+ F   +L+ I +N +++ +E   +P +  N+LE      SN IF  +F++EM +K++A G +     Y+ + +NV DG +V + +++    LA  GGA  L VLR     R LR L+++   P L+L +  ++ ++  +     +   F  IF ILG+ L                     C     K    + NFD+L  A++++F + +++ W  ++  G+   ++          W  LYF++ +   ++ + N+ V ++VE F   R
Sbjct: 1257 QFRMMCQKVIAHKMFDHVVLVFIFLNCITIALE---RPDIDPNSLERIFLSVSNYIFTAIFVLEMAIKVVALGFVSGENTYLQSSWNVLDGILVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGLETRNITNRSECTRARYKWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVATDVQPVKNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCR 1537          

HSP 9 Score: 58.151 bits (139), Expect = 2.549e-7
Identity = 51/173 (29.48%), Postives = 90/173 (52.02%), Query Frame = 2
Query:  578 RDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            R  C K I+   F+ + +  I +NCIT+ + +P  D    ++    L   ++     F +E+ IK+ A+G + G + Y   SWN LD ++V   +I+ + S        I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 1259 RMMCQKVIAHKMFDHVVLVFIFLNCITIALERP--DIDPNSLERIFLSVSNYIFTAIFVLEMAIKVVALGFVSGENTYLQSSWNVLDGILVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKG 1429          

HSP 10 Score: 54.299 bits (129), Expect = 3.840e-6
Identity = 27/80 (33.75%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRE 1612
            NFDN+G A +++F + S + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + ++ +
Sbjct: 1461 NFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVATDVQPVKNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQ 1540          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: efhd1 (EF-hand domain family member D1 [Source:Xenbase;Acc:XB-GENE-5738953])

HSP 1 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 400/626 (63.90%), Postives = 489/626 (78.12%), Query Frame = 2
Query: 4313 WCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVS-PIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREI 6184
            WC       + H   SL++ SP N+FR  CQ ++  K+FD++VL FI LNCIT+A+ERP I   S ER FL+++NY+FT IF +EM IKV+A G + G+++YL+S WNV+DG+LV +S+ DI++ L     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSLRPIGNIVLICC FFIIFGI GVQLFKGKFYYC G +  ++ N SEC    R  W  ++YNFDNLGQALMSLFVLSSKDGWV IMY GLDAV  + QP +N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE EE  RR  KR RRLEKK++K  + PY+  Y   RL IH +  S Y DL I  II +NVITM+ME Y  P  L+ ALK  NY+FT VF+ EAL K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE++ N  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG+L C++ NPC GLSRHA FENFGMAFLTLFR++TGDNWNGIMKDTLR +C++ +   KNC    P+I+P+YFV FVL+AQFVLVNVVVAVLMKHLEES+K   +D E++ E++ E+
Sbjct: 1147 WC-------KTHEDWSLYMFSPQNQFRMMCQKVIAHKMFDHVVLVFIFLNCITIALERPDIDPNSLERIFLSVSNYIFTAIFVLEMAIKVVALGFVSGENTYLQSSWNVLDGILVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGLETRNITNRSECTR-ARYKWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVATDVQPVKNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRRPYYAEYSPARLYIHTMCTSHYLDLFITCIICINVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEALFKLVAFGFRRFFKDRWNQLDLAIVLLSIMGITLEEIEINASLPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNEENPCEGLSRHATFENFGMAFLTLFRVSTGDNWNGIMKDTLR-ECNSDD---KNCLTYLPVISPVYFVTFVLIAQFVLVNVVVAVLMKHLEESNKEAKEDAEMDAEIEMEM 1760          

HSP 2 Score: 402.905 bits (1034), Expect = 2.140e-112
Identity = 229/439 (52.16%), Postives = 301/439 (68.56%), Query Frame = 2
Query:  464 DSSAAEEERIENTEKNKDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
            D+S+   E+   +E+ + +PYP     VFF L+QT  PR+WCL+ +  P +   S+ VI++NC+TLGM++PCEDT+C + RC IL  FD  IF FFAVE++IK+ A+G+ G   Y  ++WN LD  IV+AG++E       +SL+AIRTVRVLRPLRAINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC++  N  +  P      YYQV+      +    +ICS +  NG++KC DIPP +            D +     + P+  SCVN NQYY+ C+    NP+ GAINFDNIG+AW+AIFQVI++E WVDIMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE + M  +R +  S  ST+ S  EP SCY E++K I    R + +  ++ Y  +  K
Sbjct:   18 DNSSQGREQGMGSEEGEQVPYPALAPTVFFCLSQTTRPRNWCLRLVCNP-YPLHSMLVILLNCVTLGMFQPCEDTNCMSERCNILEAFDGFIFAFFAVEMVIKMVALGIFGQKCYLGDTWNWLDFFIVMAGMLEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFMDTN--FVMP------YYQVDD-----AEDNPYICSSNRDNGMLKCQDIPPKM------------DCSHVYYSDFPSRNSCVNINQYYNVCKPGEFNPHKGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRENQLMQEQRARYLSNDSTIASFSEPGSCYEELLKYICHIFRKVKRRTLRLYNNWQNK 430          

HSP 3 Score: 307.375 bits (786), Expect = 4.926e-83
Identity = 192/329 (58.36%), Postives = 228/329 (69.30%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXX-XXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFND 3508
            F  ++K IV  +YF RGI+IAILINTLSMGIEYH QP  LTN LE SN++F  +F +EMLLK+LA G+  YI N +N+FDG IV++ + E+  +    GLSVLRTFRLLR+LKLVRFMPALR QL+V++KTMDNVATF  LL+LFIFIFSILGM LFGCKF      G+   DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TSSWAALYFVALMTFGNYVLFNLLVAILVEGF  E        E+   +K +E KM +L           T N  ++P+  +                    PII  T ATPMP+P++SP  D
Sbjct:  686 FTVRLKRIVDSKYFNRGIMIAILINTLSMGIEYHEQPEELTNALEISNIVFTSMFALEMLLKLLAFGIFQYIKNPYNIFDGIIVVISVWEIIGQSDG-GLSVLRTFRLLRVLKLVRFMPALRRQLVVLVKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFTWTADTGETVKDRKNFDSLLWAIVTVFQILTQEDWNMVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDATRSDTEE---DKASELKMYSL---------AVTPNGHLDPRSSMPP------------------PIIMRTAATPMPTPKSSPCMD 983          

HSP 4 Score: 103.605 bits (257), Expect = 4.041e-21
Identity = 105/350 (30.00%), Postives = 159/350 (45.43%), Query Frame = 2
Query: 4361 LFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQK--SREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKF------------------------YYCSGP---------------DVAHV--KNFSECN-----NDKRNTWKNQQY-------NFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH--KCRENQ 5239
             F LS   R RN C  L+    +    +  I LNC+TL M +P       S     L   +      FAVEM IK++A G+  G+  YL   WN +D  +V   +A ++   + GH+  +  I    R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G                          Y CS                 D +HV   +F   N     N   N  K  ++       NFDN+G A +++F + + +GWV IMY  +DA          ++ +  +YFI  +++  FF++N+ + V+   F   K RENQ
Sbjct:   46 FFCLSQTTRPRNWCLRLVCNP-YPLHSMLVILLNCVTLGMFQPCEDTNCMSERCNILEAFDGFIFAFFAVEMVIKMVALGIF-GQKCYLGDTWNWLDFFIV---MAGMLEYSLDGHNVSLSAI----RTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFMDTNFVMPYYQVDDAEDNPYICSSNRDNGMLKCQDIPPKMDCSHVYYSDFPSRNSCVNINQYYNVCKPGEFNPHKGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDA----------HSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRENQ 376          

HSP 5 Score: 103.605 bits (257), Expect = 4.821e-21
Identity = 73/273 (26.74%), Postives = 143/273 (52.38%), Query Frame = 2
Query: 4403 QNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            + +++ K F+  ++  I +N +++ +E    P++      L I+N VFT +FA+EM +K++A G+      Y+++ +N+ DG++VVIS+ +     IIG S     +LR FRLLR L+ +R +   P L+  +  L+ ++  +    ++   F  IF I G+ LF  KF + +               D   T K+++ NFD+L  A++++F + +++ W  ++Y G+ +           + W  LYF++ +    + + N+ V ++VE F 
Sbjct:  691 KRIVDSKYFNRGIMIAILINTLSMGIEYHEQPEELTNA--LEISNIVFTSMFALEMLLKLLAFGIF----QYIKNPYNIFDGIIVVISVWE-----IIGQSDGGLSVLRTFRLLRVLKLVRFM---PALRRQLVVLVKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFTWTA---------------DTGETVKDRK-NFDSLLWAIVTVFQILTQEDWNMVLYNGMAST----------SSWAALYFVALMTFGNYVLFNLLVAILVEGFQ 923          

HSP 6 Score: 75.8702 bits (185), Expect = 1.054e-12
Identity = 64/205 (31.22%), Postives = 117/205 (57.07%), Query Frame = 2
Query: 5363 LVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            +V+SKYF+  I   I +N ++M +E++  P EL  AL+  N +FTS+F +E L+K +A+G  +YI + +N  D +IV++SV  I+ +          ++++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  FIF+ LG+ LFG       +    +    +F++   A +T+F+I T ++WN ++ + +
Sbjct:  693 IVDSKYFNRGIMIAILINTLSMGIEYHEQPEELTNALEISNIVFTSMFALEMLLKLLAFGIFQYIKNPYNIFDGIIVVISVWEIIGQSDG------GLSVLRTFRLL---RVLKLVRFMPALRRQLVVLVKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFTWTADTGETVKDRKNFDSLLWAIVTVFQILTQEDWNMVLYNGM 888          

HSP 7 Score: 74.7146 bits (182), Expect = 2.987e-12
Identity = 70/270 (25.93%), Postives = 133/270 (49.26%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSS--WAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEE 3301
            R  + ++    Y    I   I IN ++M +E++NQP  L   L+Y N +F  +F+ E L K++A G   +  + +N  D  IV+L ++ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C  +N      R   F++   A +T+F++ T ++WN ++   + + +S     L ++ +++   +V F     +L+  F    V  A L +  HLE+ N+E
Sbjct: 1483 RLYIHTMCTSHYLDLFITCIICINVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEALFKLVAFGFRRFFKDRWNQLDLAIVLLSIMGITLEEIEINASLPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNEENPCEGLSRHATFENFGMAFLTLFRVSTGDNWNGIMKDTLRECNSDDKNCLTYLPVISPVYFVTF-----VLIAQFVLVNVVVAVLMK--HLEESNKE 1745          

HSP 8 Score: 72.0182 bits (175), Expect = 1.834e-11
Identity = 72/284 (25.35%), Postives = 138/284 (48.59%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLE-----YSNMIFNGLFLVEMLLKILAEGLLG----YISNGFNVFDGGIVILGLVE----LAQEGGASGLSVLRT---FRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSS----------WAALYFVALMTFGNYVLFNLLVAILVEGFSTER 3247
            +FR   + ++AH+ F   +L+ I +N +++ +E   +P +  N+LE      SN IF  +F++EM +K++A G +     Y+ + +NV DG +V + +++    LA  GGA  L VLR     R LR L+++   P L+L +  ++ ++  +     +   F  IF ILG+ L                     C     K    + NFD+L  A++++F + +++ W  ++  G+   ++          W  LYF++ +   ++ + N+ V ++VE F   R
Sbjct: 1164 QFRMMCQKVIAHKMFDHVVLVFIFLNCITIALE---RPDIDPNSLERIFLSVSNYIFTAIFVLEMAIKVVALGFVSGENTYLQSSWNVLDGILVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGLETRNITNRSECTRARYKWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVATDVQPVKNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCR 1444          

HSP 9 Score: 57.3806 bits (137), Expect = 4.680e-7
Identity = 51/173 (29.48%), Postives = 90/173 (52.02%), Query Frame = 2
Query:  578 RDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            R  C K I+   F+ + +  I +NCIT+ + +P  D    ++    L   ++     F +E+ IK+ A+G + G + Y   SWN LD ++V   +I+ + S        I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 1166 RMMCQKVIAHKMFDHVVLVFIFLNCITIALERP--DIDPNSLERIFLSVSNYIFTAIFVLEMAIKVVALGFVSGENTYLQSSWNVLDGILVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKG 1336          

HSP 10 Score: 54.299 bits (129), Expect = 4.482e-6
Identity = 27/80 (33.75%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRE 1612
            NFDN+G A +++F + S + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + ++ +
Sbjct: 1368 NFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVATDVQPVKNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQ 1447          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: CACNA1I (calcium channel, voltage-dependent, T type, alpha 1I subunit [Source:NCBI gene;Acc:100494599])

HSP 1 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 397/633 (62.72%), Postives = 488/633 (77.09%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRG 6253
            S+F+ SP NRFR  CQ ++  K+FD +VL FI LNCIT+A+ERP I  KS ER FL+I+NY+FT IF  EMT+KV++ GL  G  +YLRS WN++DG LV +SL DI++ +     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSL+PIGNIVLICC FFIIFGI GVQLFKGKF+YC G DV +V N S+C       W + +YNFDNLGQALMSLFVL+SKDGWV IMY GLDAV V+QQP  N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE EE  RR  KR RRLEKK++K  + PY+  Y   RLLIH +  S Y D+ I  II LNVITM++E Y  P  LE+ALK  NY+FT+VF++EA++K +A+G +R+  DRWNQLD+ IV+LSV GI +EE++ N  +PIN TIIR+ RVLRI RVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG+L C+D +PC G+SRHA FENFGMAFLTLF+++TGDNWNGIMKDTLR+   +   C  N      I+P+YFV FVL AQFVL+NVVVAVLMKHL++S+K   +D E++ E++ E+      +     TS V  ++N G
Sbjct: 1007 SIFLFSPQNRFRIMCQTIIAHKLFDYVVLAFIFLNCITIALERPQIEHKSTERLFLSISNYIFTAIFVAEMTLKVVSLGLYFGDQAYLRSSWNILDGFLVFVSLIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFFYCLGVDVRNVTNKSDCEAANYK-WVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCPARLLIHSVCTSHYLDIFITIIICLNVITMSLEHYSQPRSLEIALKYCNYMFTTVFVLEAVLKLVAFGFRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRITRVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDDHPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTSDDRSCLSNL---QFISPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAELDAEIEMELAHGLCSQ-----TSPVSGLDNGG 1630          

HSP 2 Score: 372.089 bits (954), Expect = 1.008e-103
Identity = 229/455 (50.33%), Postives = 297/455 (65.27%), Query Frame = 2
Query:  449 SSYMVDSSAAEEERIENTEKNKDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKD----FICSPDNFNGLVKCSDIPPSVIWLPSGEARVC---NDSALPNSDNMPTNVS--CVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQSTSTLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEKHEN 1786
            S +  D+ AAEE     ++ + D+PYPD    VFF L QT   R WC+K         LS+ VI++NC+TLGM++PCED  C + RC+IL  FD  IF+FFA+E+++K+ A+G+ G   Y  ++WNRLD  IV+AG++E       ++L+AIRTVRVLRPL+AINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGI+GVQ+W G+LRNRC+L  N + +   + L  YYQ         P +D    FICS    NG++ C +IPP    L       C    D    NS     NVS  CVNWNQYY+ C     NP+ GAINFDNIG+AW+ IFQVI++E WV+IMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE + M  +R    S+ST+ S  EP  CY EI + +    R   +  +  Y     + ++
Sbjct:   21 SPFSQDAPAAEEG---GSQADLDVPYPDLAPVVFFCLKQTTTLRYWCIKVC-------LSMMVILLNCVTLGMFQPCEDVDCSSERCQILQVFDDFIFIFFAMEMVVKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFLEENFTIQG-DITLPPYYQ---------PEEDDEMPFICSLSGDNGIMGCHEIPP----LRDRGHECCLDKEDYYYYNSIRHEFNVSGMCVNWNQYYNVCRTSNTNPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHQLMQEQRALYLSSSTVASYAEPGDCYEEIFQYVCHILRKAKRRTVGLYTSLQNRRQS 451          

HSP 3 Score: 279.641 bits (714), Expect = 8.202e-75
Identity = 163/240 (67.92%), Postives = 192/240 (80.00%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXX-DRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTE 3244
            R K++ IV  +YF RGI+IAIL+NT+SMGIE+H QP  LTN LE SN++F  +F +EM+LK+ A GL  Y+ N +N+FDG IVI+ + E+  +    GLSVLRTFRLLR+LKLVRFMPALR QL+V++KTMDNVATF  LL+LFIFIFSILGM +FGCKF    +      DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TS WAALYFVALMTFGNYVLFNLLVAILVEGF  E
Sbjct:  580 RVKLRGIVDSKYFNRGIMIAILVNTISMGIEHHEQPEELTNILEISNIVFTSMFALEMMLKLSAFGLFDYLRNPYNIFDGIIVIISVWEIIGQNDG-GLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDSGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAALYFVALMTFGNYVLFNLLVAILVEGFQAE 818          

HSP 4 Score: 98.5969 bits (244), Expect = 1.237e-19
Identity = 74/277 (26.71%), Postives = 141/277 (50.90%), Query Frame = 2
Query: 4391 RNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            R   + +++ K F+  ++  I +N I++ +E    P++      L I+N VFT +FA+EM +K+ A GL      YLR+ +N+ DG++V+IS+ +     IIG +     +LR FRLLR L+ +R +   P L+  +  L+ ++  +    ++   F  IF I G+ +F  KF                   D  +T  +++ NFD+L  A++++F + +++ W  ++Y G+ +           + W  LYF++ +    + + N+ V ++VE F 
Sbjct:  580 RVKLRGIVDSKYFNRGIMIAILVNTISMGIEHHEQPEELTN--ILEISNIVFTSMFALEMMLKLSAFGLF----DYLRNPYNIFDGIIVIISVWE-----IIGQNDGGLSVLRTFRLLRVLKLVRFM---PALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKF---------------SLRTDSGDTVPDRK-NFDSLLWAIVTVFQILTQEDWNVVLYNGMAST----------SPWAALYFVALMTFGNYVLFNLLVAILVEGFQ 816          

HSP 5 Score: 87.8113 bits (216), Expect = 2.759e-16
Identity = 72/277 (25.99%), Postives = 140/277 (50.54%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSS-----------WAALYFVALMTFGNYVLFNLLVAILVEGF---STERVDEAKLAEKIHLE 3286
            R  + S+    Y    I I I +N ++M +E+++QP  L   L+Y N +F  +F++E +LK++A G   +  + +N  D  IV+L ++ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C   +      R   F++   A +T+FQ+ T ++WN ++   +   +S            + LYFV+ +    +VL N++VA+L++     + E  ++A+L  +I +E
Sbjct: 1335 RLLIHSVCTSHYLDIFITIIICLNVITMSLEHYSQPRSLEIALKYCNYMFTTVFVLEAVLKLVAFGFRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRITRVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDDHPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTSDDRSCLSNLQFISPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAELDAEIEME 1611          

HSP 6 Score: 71.2478 bits (173), Expect = 2.572e-11
Identity = 67/216 (31.02%), Postives = 115/216 (53.24%), Query Frame = 2
Query: 5345 RLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFG-----RLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            R+ + G+V+SKYF+  I   I +N I+M +E +  P EL   L+  N +FTS+F +E ++K  A+G   Y+ + +N  D +IVI+SV          + I  N   + V R  R+ RVLKL++    +R  L  +++ +  V    +L  L  FIF+ LG+ +FG     R +  D  P        +F++   A +T+F+I T ++WN ++ + +
Sbjct:  580 RVKLRGIVDSKYFNRGIMIAILVNTISMGIEHHEQPEELTNILEISNIVFTSMFALEMMLKLSAFGLFDYLRNPYNIFDGIIVIISVW---------EIIGQNDGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDSGDTVP-----DRKNFDSLLWAIVTVFQILTQEDWNVVLYNGM 781          

HSP 7 Score: 68.9366 bits (167), Expect = 1.395e-10
Identity = 55/157 (35.03%), Postives = 88/157 (56.05%), Query Frame = 2
Query: 4442 LFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGI-LRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            +  I LNC+TL M +P   +   S   + L + +    + FA+EM +K++A G+  GK  YL   WN +D  +V+  + +        +S  +  I L   R +R LRPL+ I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G
Sbjct:   71 MMVILLNCVTLGMFQPCEDVDCSSERCQILQVFDDFIFIFFAMEMVVKMVALGIF-GKKCYLGDTWNRLDFFIVMAGMVE--------YSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAG 218          

HSP 8 Score: 66.6254 bits (161), Expect = 8.094e-10
Identity = 75/284 (26.41%), Postives = 139/284 (48.94%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNT-----LEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVEL----AQEGGASGLSVLRTFRLLRILKLVRFM---PALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTER 3247
            RFR   ++I+AH+ F   +L  I +N +++ +E   +P +   +     L  SN IF  +F+ EM LK+++ GL      Y+ + +N+ DG +V + L+++    A  GGA  L VLR  RLLR L+ +R +   P L+L +  ++ ++  +     +   F  IF ILG+ L                     C+  N K    + NFD+L  A++++F + +++ W  ++ +G+   +           W  LYF++ +   ++ + N+ V ++VE F   R
Sbjct: 1016 RFRIMCQTIIAHKLFDYVVLAFIFLNCITIALE---RPQIEHKSTERLFLSISNYIFTAIFVAEMTLKVVSLGLYFGDQAYLRSSWNILDGFLVFVSLIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFFYCLGVDVRNVTNKSDCEAANYKWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCR 1296          

HSP 9 Score: 56.9954 bits (136), Expect = 5.765e-7
Identity = 31/95 (32.63%), Postives = 52/95 (54.74%), Query Frame = 2
Query: 1358 SKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRE 1612
            S CEA      +   NFDN+G A +++F + S + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + ++ +
Sbjct: 1205 SDCEAANYKWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQ 1299          

HSP 10 Score: 54.6842 bits (130), Expect = 3.232e-6
Identity = 57/195 (29.23%), Postives = 94/195 (48.21%), Query Frame = 2
Query:  527 PDYPE-----KVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGL-LGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            PD+ E      +F F  Q    R  C   I+   F+ + +A I +NCIT+ + +P      K+     L   ++     F  E+ +K+ ++GL  G   Y   SWN LD  +V   LI+ + S        I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct:  997 PDWCELREDWSIFLFSPQNRF-RIMCQTIIAHKLFDYVVLAFIFLNCITIALERP--QIEHKSTERLFLSISNYIFTAIFVAEMTLKVVSLGLYFGDQAYLRSSWNILDGFLVFVSLIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKG 1188          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1h (calcium channel, voltage-dependent, T type, alpha 1H subunit [Source:MGI Symbol;Acc:MGI:1928842])

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 412/687 (59.97%), Postives = 509/687 (74.09%), Query Frame = 2
Query: 4142 KTSMFLPMVFID-SSFVSKLPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNYF--WCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDE 6190
            + +  LP  F D +  +  LPS   +  +   ++ +   +  +D       K+L  Y   WCS    +       +L++  P NR R SCQ ++  K+FD++VL FI LNCIT+A+ERP I   S ER FL+++NY+FT IF VEM +KV+A GLL G+H+YL+S WNV+DGLLV++SL DI++ +     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSLRPIGNIVLICC FFIIFGI GVQLFKGKFYYC G D  ++   +EC+      W  ++YNFDNLGQALMSLFVLSSKDGWV IMY GLDAVG++QQP +N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE EE  RR  KR RRLE++++K  + PY+  Y H R  IH L  S Y DL I  II LNVITM+ME Y  P  L+ ALK  NY+FT VF+ EA +K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE++ N  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFGRLECS+ NPC GLSRHA F NFGMAFLTLFR++TGDNWNGIMKDTLR      + C       P ++P+YFV FVL+AQFVLVNVVVAVLMKHLEES+K   +D E++ E++ EI +
Sbjct: 1216 RPATLLPTKFRDCNGQMVALPSEFFLRIDSHKEDAAEFDDDIEDSCCFRLHKVLEPYAPQWCSSRESW-------ALYLFPPQNRLRVSCQKVIAHKMFDHVVLVFIFLNCITIALERPDIDPGSTERAFLSVSNYIFTAIFVVEMMVKVVALGLLWGEHAYLQSSWNVLDGLLVLVSLVDIIVAVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGTDTRNITTKAECHA-AHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGIDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLERRRRKAQRRPYYADYSHTRRSIHSLCTSHYLDLFITFIICLNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSIMGIALEEIEMNAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFTNFGMAFLTLFRVSTGDNWNGIMKDTLRECTREDKHCLSYL---PALSPVYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAEMDAEIELEIAQ 1891          

HSP 2 Score: 393.66 bits (1010), Expect = 1.419e-109
Identity = 233/438 (53.20%), Postives = 301/438 (68.72%), Query Frame = 2
Query:  497 NTEKNKDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSY-RHPGLN-LSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPP--------SVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
              ++ + +PYP     VFF L QT  PR WCL+ +  PWFE +S+ VI++NC+TLGM++PCED  C++ RC IL  FD  IF FFAVE++IK+ A+GL G   Y  ++WNRLD  IV+AG++E       +SL+AIRTVRVLRPLRAINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC+  L+S++ R+  L  L  YYQ     T+      FICS    NG+ KCS IP         ++ W   G+ +  +  A  N        +C+NWNQYY+ C +   NP+ GAINFDNIG+AW+AIFQVI++E WVDIMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE + M  +R +  S  STL S  EP SCY E++K +    R + +  ++ Y R+  +
Sbjct:   63 GADEEQPVPYPALAATVFFCLGQTTRPRSWCLRLVCNPWFEHISMLVIMLNCVTLGMFRPCEDVECRSERCSILEAFDDFIFAFFAVEMVIKMVALGLFGQKCYLGDTWNRLDFFIVMAGMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCF--LDSAFVRNNNLTFLRPYYQ-----TEEGEENPFICSSRRDNGMQKCSHIPSRRELRVQCTLGWEAYGQPQAEDGGAGRN--------ACINWNQYYNVCRSGEFNPHNGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRENQLMREQRARYLSNDSTLASFSEPGSCYEELLKYVGHIFRKVKRRSLRLYARWQSR 485          

HSP 3 Score: 313.923 bits (803), Expect = 3.900e-85
Identity = 198/348 (56.90%), Postives = 242/348 (69.54%), Query Frame = 2
Query: 2513 LGVRFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXX-XXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTE----RVDEAKLAEKIHLEKHNEEKMANLMKHEAHK-NQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDREIFHQEMDS 3538
            L   F  K++ IV  +YF RGI+ AIL+NTLSMG+EYH QP  LTN LE SN++F  +F +EMLLK+LA G LGYI N +N+FDG +VI+ + E+  +    GLSVLRTFRLLR+LKLVRF+PALR QL+V+++TMDNVATF  LL+LFIFIFSILGM LFGCK   K  +G    DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TSSWAALYFVALMTFGNYVLFNLLVAILVEGF  E    R D  +     HLE+ + +K+ ++   E    +   T N  +E               +GSL      P+ITHT ATPMP+P++SP  D  + H  +DS
Sbjct:  775 LWASFSSKLRRIVDSKYFNRGIMAAILVNTLSMGVEYHEQPDELTNALEISNIVFTSMFALEMLLKLLACGPLGYIRNPYNIFDGIVVIISVWEIVGQADG-GLSVLRTFRLLRVLKLVRFLPALRRQLVVLMRTMDNVATFCMLLMLFIFIFSILGMHLFGCKFSLKTDSGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDATRSDTDEDKTSTHLEE-DFDKLRDVQATEMKMYSLAVTPNGHLE--------------GRGSLPP----PLITHTAATPMPTPKSSPHLD--MAHTLLDS 1100          

HSP 4 Score: 99.3673 bits (246), Expect = 6.874e-20
Identity = 72/278 (25.90%), Postives = 142/278 (51.08%), Query Frame = 2
Query: 4388 FRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            F +  + +++ K F+  ++  I +N +++ +E    P +      L I+N VFT +FA+EM +K++A G L     Y+R+ +N+ DG++V+IS+ +     I+G +     +LR FRLLR L+ +R +   P L+  +  L+ ++  +    ++   F  IF I G+ LF  KF                   D  +T  +++ NFD+L  A++++F + +++ W  ++Y G+ +           + W  LYF++ +    + + N+ V ++VE F 
Sbjct:  779 FSSKLRRIVDSKYFNRGIMAAILVNTLSMGVEYHEQPDELTNA--LEISNIVFTSMFALEMLLKLLACGPL----GYIRNPYNIFDGIVVIISVWE-----IVGQADGGLSVLRTFRLLRVLKLVRFL---PALRRQLVVLMRTMDNVATFCMLLMLFIFIFSILGMHLFGCKF---------------SLKTDSGDTVPDRK-NFDSLLWAIVTVFQILTQEDWNVVLYNGMAST----------SSWAALYFVALMTFGNYVLFNLLVAILVEGFQ 1016          

HSP 5 Score: 86.6557 bits (213), Expect = 4.777e-16
Identity = 73/198 (36.87%), Postives = 105/198 (53.03%), Query Frame = 2
Query: 4361 LFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKN 4948
             F L    R R+ C  L+    F++I +  I LNC+TL M RP   +  +S     L   +      FAVEM IK++A GL  G+  YL   WN +D  +V   +A +M   + GH+  +  I    R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G        D A V+N
Sbjct:   80 FFCLGQTTRPRSWCLRLVCNPWFEHISMLVIMLNCVTLGMFRPCEDVECRSERCSILEAFDDFIFAFFAVEMVIKMVALGLF-GQKCYLGDTWNRLDFFIV---MAGMMEYSLDGHNVSLSAI----RTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLDSAFVRN 269          

HSP 6 Score: 84.7297 bits (208), Expect = 1.656e-15
Identity = 85/351 (24.22%), Postives = 165/351 (47.01%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS--SWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEP-------QEVISNNKNIAIIRKGSLNQKQVMPIITHT--DATPMPSPRASPFNDREI 3517
            R+ + S+    Y    I   I +N ++M +E++NQP  L   L+Y N +F  +F+ E  LK++A G   +  + +N  D  IV+L ++ +A E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C   N      R   F +   A +T+F++ T ++WN ++   + + +      L ++  ++   +V F     +LV  F    V  A L +  HLE+ N+E   +  + +A    E  + S+ +P       Q    +  N+ ++RK S+++   +P  ++      P  +P + P  + E+
Sbjct: 1612 RRSIHSLCTSHYLDLFITFIICLNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSIMGIALEEIEMNAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFTNFGMAFLTLFRVSTGDNWNGIMKDTLRECTREDKHCLSYLPALSPVYFVTF-----VLVAQFVLVNVVVAVLMK--HLEESNKEARED-AEMDAEIELEIAQGSTAQPPSTAQESQGTEPDTPNLLVVRKVSVSRMLSLPNDSYMFRPVAPAAAPHSHPLQEVEM 1954          

HSP 7 Score: 75.8702 bits (185), Expect = 9.973e-13
Identity = 68/210 (32.38%), Postives = 118/210 (56.19%), Query Frame = 2
Query: 5363 LVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFG-----RLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            +V+SKYF+  I   I +N ++M +E++  P EL  AL+  N +FTS+F +E L+K +A GP  YI + +N  D ++VI+SV  IV +          ++++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  FIF+ LG+ LFG     + +  D  P        +F++   A +T+F+I T ++WN ++ + +
Sbjct:  786 IVDSKYFNRGIMAAILVNTLSMGVEYHEQPDELTNALEISNIVFTSMFALEMLLKLLACGPLGYIRNPYNIFDGIVVIISVWEIVGQADG------GLSVLRTFRLL---RVLKLVRFLPALRRQLVVLMRTMDNVATFCMLLMLFIFIFSILGMHLFGCKFSLKTDSGDTVP-----DRKNFDSLLWAIVTVFQILTQEDWNVVLYNGM 981          

HSP 8 Score: 73.1738 bits (178), Expect = 6.436e-12
Identity = 73/281 (25.98%), Postives = 135/281 (48.04%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNT--LEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVEL----AQEGGA---SGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTER 3247
            R R   + ++AH+ F   +L+ I +N +++ +E  +     T    L  SN IF  +F+VEM++K++A GLL     Y+ + +NV DG +V++ LV++    A  GGA     L VLR  R LR L+++   P L+L +  ++ ++  +     +   F  IF ILG+ L                     C   + +    + NFD+L  A++++F + +++ W  ++  G+               W  LYF++ +   ++ + N+ V ++VE F   R
Sbjct: 1293 RLRVSCQKVIAHKMFDHVVLVFIFLNCITIALERPDIDPGSTERAFLSVSNYIFTAIFVVEMMVKVVALGLLWGEHAYLQSSWNVLDGLLVLVSLVDIIVAVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGTDTRNITTKAECHAAHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGIDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCR 1573          

HSP 9 Score: 61.6178 bits (148), Expect = 1.861e-8
Identity = 53/170 (31.18%), Postives = 90/170 (52.94%), Query Frame = 2
Query:  587 CLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            C K I+   F+ + +  I +NCIT+ + +P  D    +     L   ++     F VE+M+K+ A+GLL G   Y   SWN LD ++V+  L++ I +        I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 1298 CQKVIAHKMFDHVVLVFIFLNCITIALERP--DIDPGSTERAFLSVSNYIFTAIFVVEMMVKVVALGLLWGEHAYLQSSWNVLDGLLVLVSLVDIIVAVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKG 1465          

HSP 10 Score: 54.299 bits (129), Expect = 2.751e-6
Identity = 27/80 (33.75%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRE 1612
            NFDN+G A +++F + S + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + ++ +
Sbjct: 1497 NFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGIDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQ 1576          

HSP 11 Score: 53.5286 bits (127), Expect = 4.829e-6
Identity = 33/99 (33.33%), Postives = 54/99 (54.55%), Query Frame = 2
Query: 4949 FSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH--KCRENQ 5239
            ++ C + + N   N   NFDN+G A +++F + + +GWV IMY  +DA          YN    +YFI  +++  FF++N+ + V+   F   K RENQ
Sbjct:  344 YNVCRSGEFNP-HNGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDA-------HSFYN---FIYFILLIIVGSFFMINLCLVVIATQFSETKQRENQ 431          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1h (calcium channel, voltage-dependent, T type, alpha 1H subunit [Source:MGI Symbol;Acc:MGI:1928842])

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 412/687 (59.97%), Postives = 509/687 (74.09%), Query Frame = 2
Query: 4142 KTSMFLPMVFID-SSFVSKLPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNYF--WCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDE 6190
            + +  LP  F D +  +  LPS   +  +   ++ +   +  +D       K+L  Y   WCS    +       +L++  P NR R SCQ ++  K+FD++VL FI LNCIT+A+ERP I   S ER FL+++NY+FT IF VEM +KV+A GLL G+H+YL+S WNV+DGLLV++SL DI++ +     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSLRPIGNIVLICC FFIIFGI GVQLFKGKFYYC G D  ++   +EC+      W  ++YNFDNLGQALMSLFVLSSKDGWV IMY GLDAVG++QQP +N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE EE  RR  KR RRLE++++K  + PY+  Y H R  IH L  S Y DL I  II LNVITM+ME Y  P  L+ ALK  NY+FT VF+ EA +K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE++ N  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFGRLECS+ NPC GLSRHA F NFGMAFLTLFR++TGDNWNGIMKDTLR      + C       P ++P+YFV FVL+AQFVLVNVVVAVLMKHLEES+K   +D E++ E++ EI +
Sbjct: 1216 RPATLLPTKFRDCNGQMVALPSEFFLRIDSHKEDAAEFDDDIEDSCCFRLHKVLEPYAPQWCSSRESW-------ALYLFPPQNRLRVSCQKVIAHKMFDHVVLVFIFLNCITIALERPDIDPGSTERAFLSVSNYIFTAIFVVEMMVKVVALGLLWGEHAYLQSSWNVLDGLLVLVSLVDIIVAVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGTDTRNITTKAECHA-AHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGIDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLERRRRKAQRRPYYADYSHTRRSIHSLCTSHYLDLFITFIICLNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSIMGIALEEIEMNAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFTNFGMAFLTLFRVSTGDNWNGIMKDTLRECTREDKHCLSYL---PALSPVYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAEMDAEIELEIAQ 1891          

HSP 2 Score: 393.66 bits (1010), Expect = 1.419e-109
Identity = 233/438 (53.20%), Postives = 301/438 (68.72%), Query Frame = 2
Query:  497 NTEKNKDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSY-RHPGLN-LSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPP--------SVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
              ++ + +PYP     VFF L QT  PR WCL+ +  PWFE +S+ VI++NC+TLGM++PCED  C++ RC IL  FD  IF FFAVE++IK+ A+GL G   Y  ++WNRLD  IV+AG++E       +SL+AIRTVRVLRPLRAINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC+  L+S++ R+  L  L  YYQ     T+      FICS    NG+ KCS IP         ++ W   G+ +  +  A  N        +C+NWNQYY+ C +   NP+ GAINFDNIG+AW+AIFQVI++E WVDIMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE + M  +R +  S  STL S  EP SCY E++K +    R + +  ++ Y R+  +
Sbjct:   63 GADEEQPVPYPALAATVFFCLGQTTRPRSWCLRLVCNPWFEHISMLVIMLNCVTLGMFRPCEDVECRSERCSILEAFDDFIFAFFAVEMVIKMVALGLFGQKCYLGDTWNRLDFFIVMAGMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCF--LDSAFVRNNNLTFLRPYYQ-----TEEGEENPFICSSRRDNGMQKCSHIPSRRELRVQCTLGWEAYGQPQAEDGGAGRN--------ACINWNQYYNVCRSGEFNPHNGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRENQLMREQRARYLSNDSTLASFSEPGSCYEELLKYVGHIFRKVKRRSLRLYARWQSR 485          

HSP 3 Score: 313.923 bits (803), Expect = 3.900e-85
Identity = 198/348 (56.90%), Postives = 242/348 (69.54%), Query Frame = 2
Query: 2513 LGVRFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXX-XXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTE----RVDEAKLAEKIHLEKHNEEKMANLMKHEAHK-NQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDREIFHQEMDS 3538
            L   F  K++ IV  +YF RGI+ AIL+NTLSMG+EYH QP  LTN LE SN++F  +F +EMLLK+LA G LGYI N +N+FDG +VI+ + E+  +    GLSVLRTFRLLR+LKLVRF+PALR QL+V+++TMDNVATF  LL+LFIFIFSILGM LFGCK   K  +G    DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TSSWAALYFVALMTFGNYVLFNLLVAILVEGF  E    R D  +     HLE+ + +K+ ++   E    +   T N  +E               +GSL      P+ITHT ATPMP+P++SP  D  + H  +DS
Sbjct:  775 LWASFSSKLRRIVDSKYFNRGIMAAILVNTLSMGVEYHEQPDELTNALEISNIVFTSMFALEMLLKLLACGPLGYIRNPYNIFDGIVVIISVWEIVGQADG-GLSVLRTFRLLRVLKLVRFLPALRRQLVVLMRTMDNVATFCMLLMLFIFIFSILGMHLFGCKFSLKTDSGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDATRSDTDEDKTSTHLEE-DFDKLRDVQATEMKMYSLAVTPNGHLE--------------GRGSLPP----PLITHTAATPMPTPKSSPHLD--MAHTLLDS 1100          

HSP 4 Score: 99.3673 bits (246), Expect = 6.874e-20
Identity = 72/278 (25.90%), Postives = 142/278 (51.08%), Query Frame = 2
Query: 4388 FRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            F +  + +++ K F+  ++  I +N +++ +E    P +      L I+N VFT +FA+EM +K++A G L     Y+R+ +N+ DG++V+IS+ +     I+G +     +LR FRLLR L+ +R +   P L+  +  L+ ++  +    ++   F  IF I G+ LF  KF                   D  +T  +++ NFD+L  A++++F + +++ W  ++Y G+ +           + W  LYF++ +    + + N+ V ++VE F 
Sbjct:  779 FSSKLRRIVDSKYFNRGIMAAILVNTLSMGVEYHEQPDELTNA--LEISNIVFTSMFALEMLLKLLACGPL----GYIRNPYNIFDGIVVIISVWE-----IVGQADGGLSVLRTFRLLRVLKLVRFL---PALRRQLVVLMRTMDNVATFCMLLMLFIFIFSILGMHLFGCKF---------------SLKTDSGDTVPDRK-NFDSLLWAIVTVFQILTQEDWNVVLYNGMAST----------SSWAALYFVALMTFGNYVLFNLLVAILVEGFQ 1016          

HSP 5 Score: 86.6557 bits (213), Expect = 4.777e-16
Identity = 73/198 (36.87%), Postives = 105/198 (53.03%), Query Frame = 2
Query: 4361 LFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKN 4948
             F L    R R+ C  L+    F++I +  I LNC+TL M RP   +  +S     L   +      FAVEM IK++A GL  G+  YL   WN +D  +V   +A +M   + GH+  +  I    R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G        D A V+N
Sbjct:   80 FFCLGQTTRPRSWCLRLVCNPWFEHISMLVIMLNCVTLGMFRPCEDVECRSERCSILEAFDDFIFAFFAVEMVIKMVALGLF-GQKCYLGDTWNRLDFFIV---MAGMMEYSLDGHNVSLSAI----RTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLDSAFVRN 269          

HSP 6 Score: 84.7297 bits (208), Expect = 1.656e-15
Identity = 85/351 (24.22%), Postives = 165/351 (47.01%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS--SWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEP-------QEVISNNKNIAIIRKGSLNQKQVMPIITHT--DATPMPSPRASPFNDREI 3517
            R+ + S+    Y    I   I +N ++M +E++NQP  L   L+Y N +F  +F+ E  LK++A G   +  + +N  D  IV+L ++ +A E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C   N      R   F +   A +T+F++ T ++WN ++   + + +      L ++  ++   +V F     +LV  F    V  A L +  HLE+ N+E   +  + +A    E  + S+ +P       Q    +  N+ ++RK S+++   +P  ++      P  +P + P  + E+
Sbjct: 1612 RRSIHSLCTSHYLDLFITFIICLNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSIMGIALEEIEMNAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFTNFGMAFLTLFRVSTGDNWNGIMKDTLRECTREDKHCLSYLPALSPVYFVTF-----VLVAQFVLVNVVVAVLMK--HLEESNKEARED-AEMDAEIELEIAQGSTAQPPSTAQESQGTEPDTPNLLVVRKVSVSRMLSLPNDSYMFRPVAPAAAPHSHPLQEVEM 1954          

HSP 7 Score: 75.8702 bits (185), Expect = 9.973e-13
Identity = 68/210 (32.38%), Postives = 118/210 (56.19%), Query Frame = 2
Query: 5363 LVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFG-----RLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            +V+SKYF+  I   I +N ++M +E++  P EL  AL+  N +FTS+F +E L+K +A GP  YI + +N  D ++VI+SV  IV +          ++++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  FIF+ LG+ LFG     + +  D  P        +F++   A +T+F+I T ++WN ++ + +
Sbjct:  786 IVDSKYFNRGIMAAILVNTLSMGVEYHEQPDELTNALEISNIVFTSMFALEMLLKLLACGPLGYIRNPYNIFDGIVVIISVWEIVGQADG------GLSVLRTFRLL---RVLKLVRFLPALRRQLVVLMRTMDNVATFCMLLMLFIFIFSILGMHLFGCKFSLKTDSGDTVP-----DRKNFDSLLWAIVTVFQILTQEDWNVVLYNGM 981          

HSP 8 Score: 73.1738 bits (178), Expect = 6.436e-12
Identity = 73/281 (25.98%), Postives = 135/281 (48.04%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNT--LEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVEL----AQEGGA---SGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTER 3247
            R R   + ++AH+ F   +L+ I +N +++ +E  +     T    L  SN IF  +F+VEM++K++A GLL     Y+ + +NV DG +V++ LV++    A  GGA     L VLR  R LR L+++   P L+L +  ++ ++  +     +   F  IF ILG+ L                     C   + +    + NFD+L  A++++F + +++ W  ++  G+               W  LYF++ +   ++ + N+ V ++VE F   R
Sbjct: 1293 RLRVSCQKVIAHKMFDHVVLVFIFLNCITIALERPDIDPGSTERAFLSVSNYIFTAIFVVEMMVKVVALGLLWGEHAYLQSSWNVLDGLLVLVSLVDIIVAVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGTDTRNITTKAECHAAHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGIDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCR 1573          

HSP 9 Score: 61.6178 bits (148), Expect = 1.861e-8
Identity = 53/170 (31.18%), Postives = 90/170 (52.94%), Query Frame = 2
Query:  587 CLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            C K I+   F+ + +  I +NCIT+ + +P  D    +     L   ++     F VE+M+K+ A+GLL G   Y   SWN LD ++V+  L++ I +        I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 1298 CQKVIAHKMFDHVVLVFIFLNCITIALERP--DIDPGSTERAFLSVSNYIFTAIFVVEMMVKVVALGLLWGEHAYLQSSWNVLDGLLVLVSLVDIIVAVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKG 1465          

HSP 10 Score: 54.299 bits (129), Expect = 2.751e-6
Identity = 27/80 (33.75%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRE 1612
            NFDN+G A +++F + S + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + ++ +
Sbjct: 1497 NFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGIDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQ 1576          

HSP 11 Score: 53.5286 bits (127), Expect = 4.829e-6
Identity = 33/99 (33.33%), Postives = 54/99 (54.55%), Query Frame = 2
Query: 4949 FSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH--KCRENQ 5239
            ++ C + + N   N   NFDN+G A +++F + + +GWV IMY  +DA          YN    +YFI  +++  FF++N+ + V+   F   K RENQ
Sbjct:  344 YNVCRSGEFNP-HNGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDA-------HSFYN---FIYFILLIIVGSFFMINLCLVVIATQFSETKQRENQ 431          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1h (calcium channel, voltage-dependent, T type, alpha 1H subunit [Source:MGI Symbol;Acc:MGI:1928842])

HSP 1 Score: 635.18 bits (1637), Expect = 0.000e+0
Identity = 412/687 (59.97%), Postives = 509/687 (74.09%), Query Frame = 2
Query: 4142 KTSMFLPMVFIDSSF-VSKLPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNYF--WCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDE 6190
            + +  LP  F D +  +  LPS   +  +   ++ +   +  +D       K+L  Y   WCS    +       +L++  P NR R SCQ ++  K+FD++VL FI LNCIT+A+ERP I   S ER FL+++NY+FT IF VEM +KV+A GLL G+H+YL+S WNV+DGLLV++SL DI++ +     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSLRPIGNIVLICC FFIIFGI GVQLFKGKFYYC G D  ++   +EC+      W  ++YNFDNLGQALMSLFVLSSKDGWV IMY GLDAVG++QQP +N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE EE  RR  KR RRLE++++K  + PY+  Y H R  IH L  S Y DL I  II LNVITM+ME Y  P  L+ ALK  NY+FT VF+ EA +K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE++ N  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFGRLECS+ NPC GLSRHA F NFGMAFLTLFR++TGDNWNGIMKDTLR      + C       P ++P+YFV FVL+AQFVLVNVVVAVLMKHLEES+K   +D E++ E++ EI +
Sbjct: 1110 RPATLLPTKFRDCNGQMVALPSEFFLRIDSHKEDAAEFDDDIEDSCCFRLHKVLEPYAPQWCSSRESW-------ALYLFPPQNRLRVSCQKVIAHKMFDHVVLVFIFLNCITIALERPDIDPGSTERAFLSVSNYIFTAIFVVEMMVKVVALGLLWGEHAYLQSSWNVLDGLLVLVSLVDIIVAVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGTDTRNITTKAECHA-AHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGIDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLERRRRKAQRRPYYADYSHTRRSIHSLCTSHYLDLFITFIICLNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSIMGIALEEIEMNAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFTNFGMAFLTLFRVSTGDNWNGIMKDTLRECTREDKHCLSYL---PALSPVYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAEMDAEIELEIAQ 1785          

HSP 2 Score: 347.051 bits (889), Expect = 1.619e-95
Identity = 213/391 (54.48%), Postives = 272/391 (69.57%), Query Frame = 2
Query:  635 VIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLN-LSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPP--------SVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
            VI++NC+TLGM++PCED  C++ RC IL  FD  IF FFAVE++IK+ A+GL G   Y  ++WNRLD  IV+AG++E       +SL+AIRTVRVLRPLRAINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC+L  ++  R+  L  L  YYQ     T+      FICS    NG+ KCS IP         ++ W   G+ +  +  A  N        +C+NWNQYY+ C +   NP+ GAINFDNIG+AW+AIFQVI++E WVDIMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE + M  +R +  S  STL S  EP SCY E++K +    R + +  ++ Y R+  +
Sbjct:    3 VIMLNCVTLGMFRPCEDVECRSERCSILEAFDDFIFAFFAVEMVIKMVALGLFGQKCYLGDTWNRLDFFIVMAGMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLD-SAFVRNNNLTFLRPYYQ-----TEEGEENPFICSSRRDNGMQKCSHIPSRRELRVQCTLGWEAYGQPQAEDGGAGRN--------ACINWNQYYNVCRSGEFNPHNGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRENQLMREQRARYLSNDSTLASFSEPGSCYEELLKYVGHIFRKVKRRSLRLYARWQSR 379          

HSP 3 Score: 312.768 bits (800), Expect = 4.990e-85
Identity = 196/348 (56.32%), Postives = 240/348 (68.97%), Query Frame = 2
Query: 2513 LGVRFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXX-XXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTE----RVDEAKLAEKIHLEKHNEEKMANLMKHEAHK-NQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDREIFHQEMDS 3538
            L   F  K++ IV  +YF RGI+ AIL+NTLSMG+EYH QP  LTN LE SN++F  +F +EMLLK+LA G LGYI N +N+FDG +VI+ + E+  +    GLSVLRTFRLLR+LKLVRF+PALR QL+V+++TMDNVATF  LL+LFIFIFSILGM LFG     K  +G    DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TSSWAALYFVALMTFGNYVLFNLLVAILVEGF  E    R D  +     HLE+ + +K+ ++   E    +   T N  +E               +GSL      P+ITHT ATPMP+P++SP  D  + H  +DS
Sbjct:  669 LWASFSSKLRRIVDSKYFNRGIMAAILVNTLSMGVEYHEQPDELTNALEISNIVFTSMFALEMLLKLLACGPLGYIRNPYNIFDGIVVIISVWEIVGQADG-GLSVLRTFRLLRVLKLVRFLPALRRQLVVLMRTMDNVATFCMLLMLFIFIFSILGMHLFGCKFSLKTDSGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDATRSDTDEDKTSTHLEE-DFDKLRDVQATEMKMYSLAVTPNGHLE--------------GRGSLPP----PLITHTAATPMPTPKSSPHLD--MAHTLLDS 994          

HSP 4 Score: 98.5969 bits (244), Expect = 1.142e-19
Identity = 72/278 (25.90%), Postives = 142/278 (51.08%), Query Frame = 2
Query: 4388 FRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            F +  + +++ K F+  ++  I +N +++ +E    P +      L I+N VFT +FA+EM +K++A G L     Y+R+ +N+ DG++V+IS+ +     I+G +     +LR FRLLR L+ +R +   P L+  +  L+ ++  +    ++   F  IF I G+ LF  KF                   D  +T  +++ NFD+L  A++++F + +++ W  ++Y G+ +           + W  LYF++ +    + + N+ V ++VE F 
Sbjct:  673 FSSKLRRIVDSKYFNRGIMAAILVNTLSMGVEYHEQPDELTNA--LEISNIVFTSMFALEMLLKLLACGPL----GYIRNPYNIFDGIVVIISVWE-----IVGQADGGLSVLRTFRLLRVLKLVRFL---PALRRQLVVLMRTMDNVATFCMLLMLFIFIFSILGMHLFGCKF---------------SLKTDSGDTVPDRK-NFDSLLWAIVTVFQILTQEDWNVVLYNGMAST----------SSWAALYFVALMTFGNYVLFNLLVAILVEGFQ 910          

HSP 5 Score: 84.7297 bits (208), Expect = 1.905e-15
Identity = 85/351 (24.22%), Postives = 165/351 (47.01%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS--SWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEP-------QEVISNNKNIAIIRKGSLNQKQVMPIITHT--DATPMPSPRASPFNDREI 3517
            R+ + S+    Y    I   I +N ++M +E++NQP  L   L+Y N +F  +F+ E  LK++A G   +  + +N  D  IV+L ++ +A E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C   N      R   F +   A +T+F++ T ++WN ++   + + +      L ++  ++   +V F     +LV  F    V  A L +  HLE+ N+E   +  + +A    E  + S+ +P       Q    +  N+ ++RK S+++   +P  ++      P  +P + P  + E+
Sbjct: 1506 RRSIHSLCTSHYLDLFITFIICLNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSIMGIALEEIEMNAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFTNFGMAFLTLFRVSTGDNWNGIMKDTLRECTREDKHCLSYLPALSPVYFVTF-----VLVAQFVLVNVVVAVLMK--HLEESNKEARED-AEMDAEIELEIAQGSTAQPPSTAQESQGTEPDTPNLLVVRKVSVSRMLSLPNDSYMFRPVAPAAAPHSHPLQEVEM 1848          

HSP 6 Score: 75.8702 bits (185), Expect = 7.646e-13
Identity = 66/205 (32.20%), Postives = 116/205 (56.59%), Query Frame = 2
Query: 5363 LVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            +V+SKYF+  I   I +N ++M +E++  P EL  AL+  N +FTS+F +E L+K +A GP  YI + +N  D ++VI+SV  IV +          ++++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  FIF+ LG+ LFG       +    +    +F++   A +T+F+I T ++WN ++ + +
Sbjct:  680 IVDSKYFNRGIMAAILVNTLSMGVEYHEQPDELTNALEISNIVFTSMFALEMLLKLLACGPLGYIRNPYNIFDGIVVIISVWEIVGQADG------GLSVLRTFRLL---RVLKLVRFLPALRRQLVVLMRTMDNVATFCMLLMLFIFIFSILGMHLFGCKFSLKTDSGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGM 875          

HSP 7 Score: 75.485 bits (184), Expect = 1.009e-12
Identity = 65/171 (38.01%), Postives = 93/171 (54.39%), Query Frame = 2
Query: 4442 LFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKN 4948
            +  I LNC+TL M RP   +  +S     L   +      FAVEM IK++A GL  G+  YL   WN +D  +V   +A +M   + GH+  +  I    R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G        D A V+N
Sbjct:    1 MLVIMLNCVTLGMFRPCEDVECRSERCSILEAFDDFIFAFFAVEMVIKMVALGLF-GQKCYLGDTWNRLDFFIV---MAGMMEYSLDGHNVSLSAI----RTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLDSAFVRN 163          

HSP 8 Score: 72.4034 bits (176), Expect = 9.849e-12
Identity = 73/281 (25.98%), Postives = 135/281 (48.04%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNT--LEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVEL----AQEGGAS---GLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTER 3247
            R R   + ++AH+ F   +L+ I +N +++ +E  +     T    L  SN IF  +F+VEM++K++A GLL     Y+ + +NV DG +V++ LV++    A  GGA     L VLR  R LR L+++   P L+L +  ++ ++  +     +   F  IF ILG+ L                     C   + +    + NFD+L  A++++F + +++ W  ++  G+               W  LYF++ +   ++ + N+ V ++VE F   R
Sbjct: 1187 RLRVSCQKVIAHKMFDHVVLVFIFLNCITIALERPDIDPGSTERAFLSVSNYIFTAIFVVEMMVKVVALGLLWGEHAYLQSSWNVLDGLLVLVSLVDIIVAVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGTDTRNITTKAECHAAHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGIDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCR 1467          

HSP 9 Score: 62.3882 bits (150), Expect = 1.029e-8
Identity = 53/170 (31.18%), Postives = 90/170 (52.94%), Query Frame = 2
Query:  587 CLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            C K I+   F+ + +  I +NCIT+ + +P  D    +     L   ++     F VE+M+K+ A+GLL G   Y   SWN LD ++V+  L++ I +        I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 1192 CQKVIAHKMFDHVVLVFIFLNCITIALERP--DIDPGSTERAFLSVSNYIFTAIFVVEMMVKVVALGLLWGEHAYLQSSWNVLDGLLVLVSLVDIIVAVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKG 1359          

HSP 10 Score: 53.9138 bits (128), Expect = 4.334e-6
Identity = 27/80 (33.75%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRE 1612
            NFDN+G A +++F + S + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + ++ +
Sbjct: 1391 NFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGIDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQ 1470          

HSP 11 Score: 53.1434 bits (126), Expect = 6.542e-6
Identity = 33/99 (33.33%), Postives = 54/99 (54.55%), Query Frame = 2
Query: 4949 FSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH--KCRENQ 5239
            ++ C + + N   N   NFDN+G A +++F + + +GWV IMY  +DA          YN    +YFI  +++  FF++N+ + V+   F   K RENQ
Sbjct:  238 YNVCRSGEFNP-HNGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDA-------HSFYN---FIYFILLIIVGSFFMINLCLVVIATQFSETKQRENQ 325          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1i (calcium channel, voltage-dependent, alpha 1I subunit [Source:MGI Symbol;Acc:MGI:2178051])

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 399/652 (61.20%), Postives = 500/652 (76.69%), Query Frame = 2
Query: 4262 DQDDHNENEEKILCNYFWCSWLSKFFRAHYYD--------SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPI--IAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREI 6184
            D+ D  E+EE+I  +Y  C  + K    +  D        S+++ SP+N+FR  CQ ++  K+FD +VL FI LNCIT+A+ERP I   S ER FLT++NY+FT IF  EMT+KV++ GL  G+ +YLRS WNV+DG LV +S+ DI++ +     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSL+PIGNIVLICC FFIIFGI GVQLFKGKFY+C G D  ++ N S+C       W + +YNFDNLGQALMSLFVL+SKDGWV IMY GLDAV V+QQP  N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE EE  RR  KR RRLEKK++K  + PY+  Y   RLLIH +  S Y D+ I  II LNV+TM++E Y  P  LE ALK  NY+FT+VF++EA++K +A+G +R+  DRWNQLD+ IV+LSV GI +EE++ N  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG+L C+D NPC G+SRHA FENFGMAFLTLF+++TGDNWNGIMKDTLR+ C + E      C+S +  ++P+YFV FVL AQFVL+NVVVAVLMKHL++S+K   +D E++ E++ E+
Sbjct: 1070 DRRDRGEDEEEI--DYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENKFRILCQTIIAHKLFDYVVLAFIFLNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCVAANYR-WVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCPTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRD-CTHDER----SCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAEIELEM 1713          

HSP 2 Score: 385.185 bits (988), Expect = 4.616e-107
Identity = 224/435 (51.49%), Postives = 295/435 (67.82%), Query Frame = 2
Query:  509 NKDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKD----FICSPDNFNGLVKCSDIPPSVIWLPSGEARVC----NDSALPNSDNMPTNVS--CVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQSTSTLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEKHE 1783
            N D+P+PD     FF L QT  PR+WC+K +  PWFE +S+ VI++NC+TLGMY+PC+D  C + RCKIL  FD  IF+FFA+E+++K+ A+G+ G   Y  ++WNRLD  IV+AG++E       ++L+AIRTVRVLRPL+AINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGI+GVQ+W G+LRNRC+L  N + +   + L  YYQ         P +D    FICS    NG++ C +IPP        + R C    +D     +     N S  CVNWN+YY+ C     NP+ GAINFDNIG+AW+ IFQVI++E WV+IMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE   ML +R++  S+ST+ S  EP  CY EI + +    R   +  +  Y+    + +
Sbjct:   44 NPDVPHPDLAPVAFFCLRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMECLSDRCKILQVFDDFIFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFLEENFTIQG-DVALPPYYQ---------PEEDDEMPFICSLSGDNGIMGCHEIPPL-----KEQGRECCLSKDDMYDFGAGRQDLNASGLCVNWNRYYNVCRTGNANPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYLSSSTVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQNRRQ 463          

HSP 3 Score: 257.684 bits (657), Expect = 5.551e-68
Identity = 158/240 (65.83%), Postives = 190/240 (79.17%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXX-XXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTE 3244
            R K++ IV  +YF RGI++AIL+NT+SMGIE+H QP  LTN LE  N++F  +F +EM+LK+ A GL  Y+ N +N+FD  IVI+ + E+  +    GLSVLRTFRLLR+LKLVRFMPALR QL+V++KTMDNVATF  LL+LFIFIFSILGM +FGCK   +   G    DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ T+ WA+LYFVALMTFGNYVLFNLLVAILVEGF  E
Sbjct:  588 RAKLRGIVDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIVGQADG-GLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTTPWASLYFVALMTFGNYVLFNLLVAILVEGFQAE 826          

HSP 4 Score: 92.8189 bits (229), Expect = 7.173e-18
Identity = 75/277 (27.08%), Postives = 141/277 (50.90%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLI-----------SGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGF---STERVDEAKLAEKIHLE 3286
            R  + S+    Y    I   I +N ++M +E++NQP  L   L+Y N +F  +F++E +LK++A GL  +  + +N  D  IV+L ++ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C  +N      R   F++   A +T+FQ+ T ++WN ++            S +S     + LYFV+ +    +VL N++VA+L++     + E  ++A++  +I LE
Sbjct: 1436 RLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAEIELE 1712          

HSP 5 Score: 78.9518 bits (193), Expect = 9.699e-14
Identity = 71/277 (25.63%), Postives = 138/277 (49.82%), Query Frame = 2
Query: 4391 RNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            R   + +++ K F+  ++  I +N +++ +E    P++      L I N VFT +FA+EM +K+ A GL      YLR+ +N+ D ++V+IS+ +I+     G +     +LR FRLLR L+ +R +   P L+  +  L+ ++  +    ++   F  IF I G+ +F  KF                   D  +T  +++ NFD+L  A++++F + +++ W  ++Y G+ +             W  LYF++ +    + + N+ V ++VE F 
Sbjct:  588 RAKLRGIVDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTN--ILEICNVVFTSMFALEMILKLAAFGLF----DYLRNPYNIFDSIIVIISIWEIV-----GQADGGLSVLRTFRLLRVLKLVRFM---PALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKF---------------SLRTDTGDTVPDRK-NFDSLLWAIVTVFQILTQEDWNVVLYNGMAST----------TPWASLYFVALMTFGNYVLFNLLVAILVEGFQ 824          

HSP 6 Score: 75.0998 bits (183), Expect = 1.552e-12
Identity = 61/185 (32.97%), Postives = 99/185 (53.51%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQK--SREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGI-LRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            + F L      RN C  ++    F+ + +  I LNC+TL M +P    +  S   + L + +    + FA+EM +K++A G+  GK  YL   WN +D  +V+  + +        +S  +  I L   R +R LRPL+ I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G
Sbjct:   56 AFFCLRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMECLSDRCKILQVFDDFIFIFFAMEMVLKMVALGIF-GKKCYLGDTWNRLDFFIVMAGMVE--------YSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAG 231          

HSP 7 Score: 69.3218 bits (168), Expect = 7.652e-11
Identity = 66/216 (30.56%), Postives = 118/216 (54.63%), Query Frame = 2
Query: 5345 RLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFG-----RLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            R  + G+V+SKYF+  I   I +N ++M +E +  P EL   L+  N +FTS+F +E ++K  A+G   Y+ + +N  D +IVI+S+  IV +          ++++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  FIF+ LG+ +FG     R +  D  P        +F++   A +T+F+I T ++WN ++ + +
Sbjct:  588 RAKLRGIVDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIVGQADG------GLSVLRTFRLL---RVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVP-----DRKNFDSLLWAIVTVFQILTQEDWNVVLYNGM 789          

HSP 8 Score: 64.6994 bits (156), Expect = 2.166e-9
Identity = 71/284 (25.00%), Postives = 136/284 (47.89%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLE-----YSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVEL----AQEGGASGLSVLRT---FRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTER 3247
            +FR   ++I+AH+ F   +L  I +N +++ +E   +P +   + E      SN IF  +F+ EM LK+++ GL      Y+ + +NV DG +V + ++++    A  GGA  L VLR     R LR L+++   P L+L +  ++ ++  +     +   F  IF ILG+ L                     C   N +    + NFD+L  A++++F + +++ W  ++ +G+   +           W  LYF++ +   ++ + N+ V ++VE F   R
Sbjct: 1117 KFRILCQTIIAHKLFDYVVLAFIFLNCITIALE---RPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCVAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCR 1397          

HSP 9 Score: 54.6842 bits (130), Expect = 2.088e-6
Identity = 30/95 (31.58%), Postives = 51/95 (53.68%), Query Frame = 2
Query: 1358 SKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRE 1612
            S C A      +   NFDN+G A +++F + S + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + ++ +
Sbjct: 1306 SDCVAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQ 1400          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1i (calcium channel, voltage-dependent, alpha 1I subunit [Source:MGI Symbol;Acc:MGI:2178051])

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 399/652 (61.20%), Postives = 500/652 (76.69%), Query Frame = 2
Query: 4262 DQDDHNENEEKILCNYFWCSWLSKFFRAHYYD--------SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPI--IAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREI 6184
            D+ D  E+EE+I  +Y  C  + K    +  D        S+++ SP+N+FR  CQ ++  K+FD +VL FI LNCIT+A+ERP I   S ER FLT++NY+FT IF  EMT+KV++ GL  G+ +YLRS WNV+DG LV +S+ DI++ +     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSL+PIGNIVLICC FFIIFGI GVQLFKGKFY+C G D  ++ N S+C       W + +YNFDNLGQALMSLFVL+SKDGWV IMY GLDAV V+QQP  N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE EE  RR  KR RRLEKK++K  + PY+  Y   RLLIH +  S Y D+ I  II LNV+TM++E Y  P  LE ALK  NY+FT+VF++EA++K +A+G +R+  DRWNQLD+ IV+LSV GI +EE++ N  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG+L C+D NPC G+SRHA FENFGMAFLTLF+++TGDNWNGIMKDTLR+ C + E      C+S +  ++P+YFV FVL AQFVL+NVVVAVLMKHL++S+K   +D E++ E++ E+
Sbjct: 1070 DRRDRGEDEEEI--DYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENKFRILCQTIIAHKLFDYVVLAFIFLNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCVAANYR-WVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCPTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRD-CTHDER----SCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAEIELEM 1713          

HSP 2 Score: 384.415 bits (986), Expect = 2.654e-107
Identity = 224/435 (51.49%), Postives = 295/435 (67.82%), Query Frame = 2
Query:  509 NKDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKD----FICSPDNFNGLVKCSDIPPSVIWLPSGEARVC----NDSALPNSDNMPTNVS--CVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQSTSTLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEKHE 1783
            N D+P+PD     FF L QT  PR+WC+K +  PWFE +S+ VI++NC+TLGMY+PC+D  C + RCKIL  FD  IF+FFA+E+++K+ A+G+ G   Y  ++WNRLD  IV+AG++E       ++L+AIRTVRVLRPL+AINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGI+GVQ+W G+LRNRC+L  N + +   + L  YYQ         P +D    FICS    NG++ C +IPP        + R C    +D     +     N S  CVNWN+YY+ C     NP+ GAINFDNIG+AW+ IFQVI++E WV+IMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE   ML +R++  S+ST+ S  EP  CY EI + +    R   +  +  Y+    + +
Sbjct:   44 NPDVPHPDLAPVAFFCLRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMECLSDRCKILQVFDDFIFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFLEENFTIQG-DVALPPYYQ---------PEEDDEMPFICSLSGDNGIMGCHEIPPL-----KEQGRECCLSKDDMYDFGAGRQDLNASGLCVNWNRYYNVCRTGNANPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYLSSSTVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQNRRQ 463          

HSP 3 Score: 255.758 bits (652), Expect = 1.397e-67
Identity = 158/240 (65.83%), Postives = 190/240 (79.17%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXX-DRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTE 3244
            R K++ IV  +YF RGI++AIL+NT+SMGIE+H QP  LTN LE  N++F  +F +EM+LK+ A GL  Y+ N +N+FD  IVI+ + E+  +    GLSVLRTFRLLR+LKLVRFMPALR QL+V++KTMDNVATF  LL+LFIFIFSILGM +FGCKF    +      DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ T+ WA+LYFVALMTFGNYVLFNLLVAILVEGF  E
Sbjct:  588 RAKLRGIVDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIVGQADG-GLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTTPWASLYFVALMTFGNYVLFNLLVAILVEGFQAE 826          

HSP 4 Score: 91.6633 bits (226), Expect = 1.550e-17
Identity = 75/277 (27.08%), Postives = 141/277 (50.90%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLI-----------SGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGF---STERVDEAKLAEKIHLE 3286
            R  + S+    Y    I   I +N ++M +E++NQP  L   L+Y N +F  +F++E +LK++A GL  +  + +N  D  IV+L ++ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C  +N      R   F++   A +T+FQ+ T ++WN ++            S +S     + LYFV+ +    +VL N++VA+L++     + E  ++A++  +I LE
Sbjct: 1436 RLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAEIELE 1712          

HSP 5 Score: 77.7962 bits (190), Expect = 2.096e-13
Identity = 71/277 (25.63%), Postives = 138/277 (49.82%), Query Frame = 2
Query: 4391 RNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            R   + +++ K F+  ++  I +N +++ +E    P++      L I N VFT +FA+EM +K+ A GL      YLR+ +N+ D ++V+IS+ +I+     G +     +LR FRLLR L+ +R +   P L+  +  L+ ++  +    ++   F  IF I G+ +F  KF                   D  +T  +++ NFD+L  A++++F + +++ W  ++Y G+ +             W  LYF++ +    + + N+ V ++VE F 
Sbjct:  588 RAKLRGIVDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTN--ILEICNVVFTSMFALEMILKLAAFGLF----DYLRNPYNIFDSIIVIISIWEIV-----GQADGGLSVLRTFRLLRVLKLVRFM---PALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKF---------------SLRTDTGDTVPDRK-NFDSLLWAIVTVFQILTQEDWNVVLYNGMAST----------TPWASLYFVALMTFGNYVLFNLLVAILVEGFQ 824          

HSP 6 Score: 75.0998 bits (183), Expect = 1.311e-12
Identity = 61/185 (32.97%), Postives = 99/185 (53.51%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQK--SREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGI-LRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            + F L      RN C  ++    F+ + +  I LNC+TL M +P    +  S   + L + +    + FA+EM +K++A G+  GK  YL   WN +D  +V+  + +        +S  +  I L   R +R LRPL+ I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G
Sbjct:   56 AFFCLRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMECLSDRCKILQVFDDFIFIFFAMEMVLKMVALGIF-GKKCYLGDTWNRLDFFIVMAGMVE--------YSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAG 231          

HSP 7 Score: 68.5514 bits (166), Expect = 1.260e-10
Identity = 66/216 (30.56%), Postives = 118/216 (54.63%), Query Frame = 2
Query: 5345 RLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFG-----RLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            R  + G+V+SKYF+  I   I +N ++M +E +  P EL   L+  N +FTS+F +E ++K  A+G   Y+ + +N  D +IVI+S+  IV +          ++++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  FIF+ LG+ +FG     R +  D  P        +F++   A +T+F+I T ++WN ++ + +
Sbjct:  588 RAKLRGIVDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIVGQADG------GLSVLRTFRLL---RVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVP-----DRKNFDSLLWAIVTVFQILTQEDWNVVLYNGM 789          

HSP 8 Score: 64.6994 bits (156), Expect = 2.311e-9
Identity = 71/284 (25.00%), Postives = 136/284 (47.89%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLE-----YSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVEL----AQEGGASGLSVLRT---FRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTER 3247
            +FR   ++I+AH+ F   +L  I +N +++ +E   +P +   + E      SN IF  +F+ EM LK+++ GL      Y+ + +NV DG +V + ++++    A  GGA  L VLR     R LR L+++   P L+L +  ++ ++  +     +   F  IF ILG+ L                     C   N +    + NFD+L  A++++F + +++ W  ++ +G+   +           W  LYF++ +   ++ + N+ V ++VE F   R
Sbjct: 1117 KFRILCQTIIAHKLFDYVVLAFIFLNCITIALE---RPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCVAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCR 1397          

HSP 9 Score: 54.299 bits (129), Expect = 2.649e-6
Identity = 30/95 (31.58%), Postives = 51/95 (53.68%), Query Frame = 2
Query: 1358 SKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRE 1612
            S C A      +   NFDN+G A +++F + S + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + ++ +
Sbjct: 1306 SDCVAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQ 1400          

HSP 10 Score: 52.7582 bits (125), Expect = 9.831e-6
Identity = 63/217 (29.03%), Postives = 105/217 (48.39%), Query Frame = 2
Query:  479 EEERIENT-----EKNKDLPYPDYPE-----KVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKP-CEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGL-LGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            +EE I+ T      K  D+  PD+ E      V+ F  +    R  C   I+   F+ + +A I +NCIT+ + +P  E  S + I    L   ++     F  E+ +K+ ++GL  G   Y   SWN LD  +V   +I+ + S        I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 1077 DEEEIDYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENKF-RILCQTIIAHKLFDYVVLAFIFLNCITIALERPQIEAGSTERI---FLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKG 1289          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|Q9EQ60|CAC1H_RAT (Voltage-dependent T-type calcium channel subunit alpha-1H OS=Rattus norvegicus OX=10116 GN=Cacna1h PE=2 SV=2)

HSP 1 Score: 635.18 bits (1637), Expect = 0.000e+0
Identity = 410/687 (59.68%), Postives = 509/687 (74.09%), Query Frame = 2
Query: 4142 KTSMFLPMVFID-SSFVSKLPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNYF--WCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDE 6190
            + +  LP  F D +  +  LPS   +  +   ++ +   +  +D       K+L  Y   WC       R+    +L++  P NR R SCQ ++  K+FD++VL FI LNCIT+A+ERP I   S ER FL+++NY+FT IF VEM +KV+A GLL G+H+YL+S WNV+DGLLV++SL DI++ +     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSLRPIGNIVLICC FFIIFGI GVQLFKGKFYYC G D  ++   +EC+      W  ++YNFDNLGQALMSLFVLSSKDGWV IMY GLDAVG++QQP +N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE EE  RR  KR RRLE++++K  + PY+  Y H R  IH L  S Y DL I  II LNVITM+ME Y  P  L+ ALK  NY+FT VF+ EA +K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE++ N  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFGRLECS+ NPC GLSRHA F NFGMAFLTLFR++TGDNWNGIMKDTLR      + C       P ++P+YFV F+L+AQFVLVNVVVAVLMKHLEES+K   +D E++ E++ E+ +
Sbjct: 1216 RPAALLPTKFHDCNGQMVALPSEFFLRIDSHKEDAAEFDDDIEDSCCFRLHKVLEPYAPQWC-------RSRESWALYLFPPQNRLRVSCQKVIAHKMFDHVVLVFIFLNCITIALERPDIDPGSTERAFLSVSNYIFTAIFVVEMMVKVVALGLLWGEHAYLQSSWNVLDGLLVLVSLVDIIVAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGTDTRNITTKAECHA-AHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGIDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLERRRRKAQRRPYYADYSHTRRSIHSLCTSHYLDLFITFIICLNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSIMGIALEEIEMNAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFTNFGMAFLTLFRVSTGDNWNGIMKDTLRECTREDKHCLSYL---PALSPVYFVTFMLVAQFVLVNVVVAVLMKHLEESNKEAREDAEMDAEIELEMAQ 1891          

HSP 2 Score: 393.66 bits (1010), Expect = 1.208e-108
Identity = 232/437 (53.09%), Postives = 299/437 (68.42%), Query Frame = 2
Query:  497 NTEKNKDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLN-LSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPP--------SVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
              ++ + +PYP     VFF L QT  PR WCL+ +  PWFE +S+ VI++NC+TLGM++PCED  C++ RC IL  FD  IF FFAVE++IK+ A+GL G   Y  ++WNRLD  IV+AG++E       +SL+AIRTVRVLRPLRAINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC+L  ++  R+  L  L  YYQ     T+      FICS    NG+ KCS IP         ++ W   G+ +  +  A  N        +C+NWNQYY+ C +   NP+ GAINFDNIG+AW+AIFQVI++E WVDIMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE + M  +R +  S  STL S  EP SCY E++K +    R + +  ++ Y R+  +
Sbjct:   63 GADEEQPVPYPALAATVFFCLGQTTRPRSWCLRLVCNPWFEHISMLVIMLNCVTLGMFRPCEDVECRSERCSILEAFDDFIFAFFAVEMVIKMVALGLFGQKCYLGDTWNRLDFFIVMAGMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLD-SAFVRNNNLTFLRPYYQ-----TEEGEENPFICSSRRDNGMQKCSHIPSRRELRVQCTLGWEAYGQPQAEDGGAGRN--------ACINWNQYYNVCRSGEFNPHNGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIMGSFFMINLCLVVIATQFSETKQRENQLMREQRARYLSNDSTLASFSEPGSCYEELLKYVGHIFRKVKRRSLRLYARWQSR 485          

HSP 3 Score: 310.457 bits (794), Expect = 3.147e-83
Identity = 196/348 (56.32%), Postives = 241/348 (69.25%), Query Frame = 2
Query: 2513 LGVRFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXX-XXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTE----RVDEAKLAEKIHLEKHNEEKMANLMKHEAHK-NQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDREIFHQEMDS 3538
            L   F  K++ IV  +YF RGI+ AIL+NTLSMG+EYH QP  LTN LE SN++F  +F +EMLLK+LA G LGYI N +N+FDG +V++ + E+  +    GLSVLRTFRLLR+LKLVRF+PALR QL+V+++TMDNVATF  LL+LFIFIFSILGM LFGCK   K  +G    DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TSSWAALYFVALMTFGNYVLFNLLVAILVEGF  E    R D  +      LE  + +K+ +L   E    +   T N  +E               +GSL      P+ITHT ATPMP+P++SP  + ++ H  +DS
Sbjct:  775 LWASFSGKLRRIVDSKYFNRGIMAAILVNTLSMGVEYHEQPEELTNALEISNIVFTSMFALEMLLKLLACGPLGYIRNPYNIFDGIVVVISVWEIVGQANG-GLSVLRTFRLLRVLKLVRFLPALRRQLVVLMRTMDNVATFCMLLMLFIFIFSILGMHLFGCKFSLKTDSGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDATRSDTDEDKTSTQLEG-DFDKLRDLRATEMKMYSLAVTPNGHLE--------------GRGSLPP----PLITHTAATPMPTPKSSP--NLDVAHALLDS 1100          

HSP 4 Score: 100.908 bits (250), Expect = 1.814e-19
Identity = 73/278 (26.26%), Postives = 143/278 (51.44%), Query Frame = 2
Query: 4388 FRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            F    + +++ K F+  ++  I +N +++ +E    P++      L I+N VFT +FA+EM +K++A G L     Y+R+ +N+ DG++VVIS+ +     I+G ++    +LR FRLLR L+ +R +   P L+  +  L+ ++  +    ++   F  IF I G+ LF  KF                   D  +T  +++ NFD+L  A++++F + +++ W  ++Y G+ +           + W  LYF++ +    + + N+ V ++VE F 
Sbjct:  779 FSGKLRRIVDSKYFNRGIMAAILVNTLSMGVEYHEQPEELTNA--LEISNIVFTSMFALEMLLKLLACGPL----GYIRNPYNIFDGIVVVISVWE-----IVGQANGGLSVLRTFRLLRVLKLVRFL---PALRRQLVVLMRTMDNVATFCMLLMLFIFIFSILGMHLFGCKF---------------SLKTDSGDTVPDRK-NFDSLLWAIVTVFQILTQEDWNVVLYNGMAST----------SSWAALYFVALMTFGNYVLFNLLVAILVEGFQ 1016          

HSP 5 Score: 86.6557 bits (213), Expect = 3.544e-15
Identity = 73/198 (36.87%), Postives = 105/198 (53.03%), Query Frame = 2
Query: 4361 LFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKN 4948
             F L    R R+ C  L+    F++I +  I LNC+TL M RP   +  +S     L   +      FAVEM IK++A GL  G+  YL   WN +D  +V   +A +M   + GH+  +  I    R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G        D A V+N
Sbjct:   80 FFCLGQTTRPRSWCLRLVCNPWFEHISMLVIMLNCVTLGMFRPCEDVECRSERCSILEAFDDFIFAFFAVEMVIKMVALGLF-GQKCYLGDTWNRLDFFIV---MAGMMEYSLDGHNVSLSAI----RTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLDSAFVRN 269          

HSP 6 Score: 84.3445 bits (207), Expect = 1.542e-14
Identity = 86/360 (23.89%), Postives = 168/360 (46.67%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS-----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEP-------QEVISNNKNIAIIRKGSLNQKQVMPIITHT--DATPMPSPRASPFNDREI 3517
            R+ + S+    Y    I   I +N ++M +E++NQP  L   L+Y N +F  +F+ E  LK++A G   +  + +N  D  IV+L ++ +A E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C   N      R   F +   A +T+F++ T ++WN ++   + + +           + + +YFV  M    +VL N++VA+L++                HLE+ N+E   +  + +A    E  + S+ +P       Q    +  N+ ++RK S+++   +P  ++      P  +P + P  + E+
Sbjct: 1612 RRSIHSLCTSHYLDLFITFIICLNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSIMGIALEEIEMNAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFTNFGMAFLTLFRVSTGDNWNGIMKDTLRECTREDKHCLSYLPALSPVYFVTFMLVAQFVLVNVVVAVLMK----------------HLEESNKEARED-AEMDAEIELEMAQGSTAQPPPTAQESQGTQPDTPNLLVVRKVSVSRMLSLPNDSYMFRPVAPAAAPHSHPLQEVEM 1954          

HSP 7 Score: 76.2554 bits (186), Expect = 5.287e-12
Identity = 67/210 (31.90%), Postives = 118/210 (56.19%), Query Frame = 2
Query: 5363 LVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFG-----RLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            +V+SKYF+  I   I +N ++M +E++  P EL  AL+  N +FTS+F +E L+K +A GP  YI + +N  D ++V++SV  IV +          ++++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  FIF+ LG+ LFG     + +  D  P        +F++   A +T+F+I T ++WN ++ + +
Sbjct:  786 IVDSKYFNRGIMAAILVNTLSMGVEYHEQPEELTNALEISNIVFTSMFALEMLLKLLACGPLGYIRNPYNIFDGIVVVISVWEIVGQANG------GLSVLRTFRLL---RVLKLVRFLPALRRQLVVLMRTMDNVATFCMLLMLFIFIFSILGMHLFGCKFSLKTDSGDTVP-----DRKNFDSLLWAIVTVFQILTQEDWNVVLYNGM 981          

HSP 8 Score: 72.7886 bits (177), Expect = 4.896e-11
Identity = 73/281 (25.98%), Postives = 135/281 (48.04%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNT--LEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVE----LAQEGGAS---GLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTER 3247
            R R   + ++AH+ F   +L+ I +N +++ +E  +     T    L  SN IF  +F+VEM++K++A GLL     Y+ + +NV DG +V++ LV+    +A  GGA     L VLR  R LR L+++   P L+L +  ++ ++  +     +   F  IF ILG+ L                     C   + +    + NFD+L  A++++F + +++ W  ++  G+               W  LYF++ +   ++ + N+ V ++VE F   R
Sbjct: 1293 RLRVSCQKVIAHKMFDHVVLVFIFLNCITIALERPDIDPGSTERAFLSVSNYIFTAIFVVEMMVKVVALGLLWGEHAYLQSSWNVLDGLLVLVSLVDIIVAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGTDTRNITTKAECHAAHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGIDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCR 1573          

HSP 9 Score: 61.2326 bits (147), Expect = 1.661e-7
Identity = 53/170 (31.18%), Postives = 90/170 (52.94%), Query Frame = 2
Query:  587 CLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            C K I+   F+ + +  I +NCIT+ + +P  D    +     L   ++     F VE+M+K+ A+GLL G   Y   SWN LD ++V+  L++ I +        I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 1298 CQKVIAHKMFDHVVLVFIFLNCITIALERP--DIDPGSTERAFLSVSNYIFTAIFVVEMMVKVVALGLLWGEHAYLQSSWNVLDGLLVLVSLVDIIVAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKG 1465          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|O88427|CAC1H_MOUSE (Voltage-dependent T-type calcium channel subunit alpha-1H OS=Mus musculus OX=10090 GN=Cacna1h PE=1 SV=3)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 411/693 (59.31%), Postives = 508/693 (73.30%), Query Frame = 2
Query: 4142 KTSMFLPMVFID-SSFVSKLPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNYF--WCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMM------QPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDE 6190
            + +  LP  F D +  +  LPS   +  +   ++ +   +  +D       K+L  Y   WCS    +       +L++  P NR R SCQ ++  K+FD++VL FI LNCIT+A+ERP I   S ER FL+++NY+FT IF VEM +KV+A GLL G+H+YL+S WNV+DGLLV++SL DI++ +     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSLRPIGNIVLICC FFIIFGI GVQLFKGKFYYC G D  ++   +EC+      W  ++YNFDNLGQALMSLFVLSSKDGWV IMY GLDAVG++QQP +N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE EE  RR  KR RRLE++++         + PY+  Y H R  IH L  S Y DL I  II LNVITM+ME Y  P  L+ ALK  NY+FT VF+ EA +K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE++ N  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFGRLECS+ NPC GLSRHA F NFGMAFLTLFR++TGDNWNGIMKDTLR      + C       P ++P+YFV FVL+AQFVLVNVVVAVLMKHLEES+K   +D E++ E++ EI +
Sbjct: 1216 RPATLLPTKFRDCNGQMVALPSEFFLRIDSHKEDAAEFDDDIEDSCCFRLHKVLEPYAPQWCSSRESW-------ALYLFPPQNRLRVSCQKVIAHKMFDHVVLVFIFLNCITIALERPDIDPGSTERAFLSVSNYIFTAIFVVEMMVKVVALGLLWGEHAYLQSSWNVLDGLLVLVSLVDIIVAVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGTDTRNITTKAECHA-AHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGIDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLERRRRSTFPNPEAQRRPYYADYSHTRRSIHSLCTSHYLDLFITFIICLNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSIMGIALEEIEMNAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFTNFGMAFLTLFRVSTGDNWNGIMKDTLRECTREDKHCLSYL---PALSPVYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAEMDAEIELEIAQ 1897          

HSP 2 Score: 392.119 bits (1006), Expect = 3.086e-108
Identity = 233/438 (53.20%), Postives = 301/438 (68.72%), Query Frame = 2
Query:  497 NTEKNKDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSY-RHPGLN-LSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPP--------SVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
              ++ + +PYP     VFF L QT  PR WCL+ +S  WFE +S+ VI++NC+TLGM++PCED  C++ RC IL  FD  IF FFAVE++IK+ A+GL G   Y  ++WNRLD  IV+AG++E       +SL+AIRTVRVLRPLRAINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC+  L+S++ R+  L  L  YYQ     T+      FICS    NG+ KCS IP         ++ W   G+ +  +  A  N        +C+NWNQYY+ C +   NP+ GAINFDNIG+AW+AIFQVI++E WVDIMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE + M  +R +  S  STL S  EP SCY E++K +    R + +  ++ Y R+  +
Sbjct:   63 GADEEQPVPYPALAATVFFCLGQTTRPRSWCLRLVSRRWFEHISMLVIMLNCVTLGMFRPCEDVECRSERCSILEAFDDFIFAFFAVEMVIKMVALGLFGQKCYLGDTWNRLDFFIVMAGMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCF--LDSAFVRNNNLTFLRPYYQ-----TEEGEENPFICSSRRDNGMQKCSHIPSRRELRVQCTLGWEAYGQPQAEDGGAGRN--------ACINWNQYYNVCRSGEFNPHNGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRENQLMREQRARYLSNDSTLASFSEPGSCYEELLKYVGHIFRKVKRRSLRLYARWQSR 485          

HSP 3 Score: 313.923 bits (803), Expect = 2.694e-84
Identity = 198/348 (56.90%), Postives = 242/348 (69.54%), Query Frame = 2
Query: 2513 LGVRFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXX-XXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTE----RVDEAKLAEKIHLEKHNEEKMANLMKHEAHK-NQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDREIFHQEMDS 3538
            L   F  K++ IV  +YF RGI+ AIL+NTLSMG+EYH QP  LTN LE SN++F  +F +EMLLK+LA G LGYI N +N+FDG +VI+ + E+  +    GLSVLRTFRLLR+LKLVRF+PALR QL+V+++TMDNVATF  LL+LFIFIFSILGM LFGCK   K  +G    DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TSSWAALYFVALMTFGNYVLFNLLVAILVEGF  E    R D  +     HLE+ + +K+ ++   E    +   T N  +E               +GSL      P+ITHT ATPMP+P++SP  D  + H  +DS
Sbjct:  775 LWASFSSKLRRIVDSKYFNRGIMAAILVNTLSMGVEYHEQPDELTNALEISNIVFTSMFALEMLLKLLACGPLGYIRNPYNIFDGIVVIISVWEIVGQADG-GLSVLRTFRLLRVLKLVRFLPALRRQLVVLMRTMDNVATFCMLLMLFIFIFSILGMHLFGCKFSLKTDSGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDATRSDTDEDKTSTHLEE-DFDKLRDVQATEMKMYSLAVTPNGHLE--------------GRGSLPP----PLITHTAATPMPTPKSSPHLD--MAHTLLDS 1100          

HSP 4 Score: 99.3673 bits (246), Expect = 4.892e-19
Identity = 72/278 (25.90%), Postives = 142/278 (51.08%), Query Frame = 2
Query: 4388 FRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            F +  + +++ K F+  ++  I +N +++ +E    P +      L I+N VFT +FA+EM +K++A G L     Y+R+ +N+ DG++V+IS+ +     I+G +     +LR FRLLR L+ +R +   P L+  +  L+ ++  +    ++   F  IF I G+ LF  KF                   D  +T  +++ NFD+L  A++++F + +++ W  ++Y G+ +           + W  LYF++ +    + + N+ V ++VE F 
Sbjct:  779 FSSKLRRIVDSKYFNRGIMAAILVNTLSMGVEYHEQPDELTNA--LEISNIVFTSMFALEMLLKLLACGPL----GYIRNPYNIFDGIVVIISVWE-----IVGQADGGLSVLRTFRLLRVLKLVRFL---PALRRQLVVLMRTMDNVATFCMLLMLFIFIFSILGMHLFGCKF---------------SLKTDSGDTVPDRK-NFDSLLWAIVTVFQILTQEDWNVVLYNGMAST----------SSWAALYFVALMTFGNYVLFNLLVAILVEGFQ 1016          

HSP 5 Score: 90.1225 bits (222), Expect = 3.000e-16
Identity = 73/198 (36.87%), Postives = 107/198 (54.04%), Query Frame = 2
Query: 4361 LFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKN 4948
             F L    R R+ C  L+ ++ F++I +  I LNC+TL M RP   +  +S     L   +      FAVEM IK++A GL  G+  YL   WN +D  +V   +A +M   + GH+  +  I    R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G        D A V+N
Sbjct:   80 FFCLGQTTRPRSWCLRLVSRRWFEHISMLVIMLNCVTLGMFRPCEDVECRSERCSILEAFDDFIFAFFAVEMVIKMVALGLF-GQKCYLGDTWNRLDFFIV---MAGMMEYSLDGHNVSLSAI----RTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLDSAFVRN 269          

HSP 6 Score: 84.7297 bits (208), Expect = 1.240e-14
Identity = 85/351 (24.22%), Postives = 165/351 (47.01%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS--SWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEP-------QEVISNNKNIAIIRKGSLNQKQVMPIITHT--DATPMPSPRASPFNDREI 3517
            R+ + S+    Y    I   I +N ++M +E++NQP  L   L+Y N +F  +F+ E  LK++A G   +  + +N  D  IV+L ++ +A E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C   N      R   F +   A +T+F++ T ++WN ++   + + +      L ++  ++   +V F     +LV  F    V  A L +  HLE+ N+E   +  + +A    E  + S+ +P       Q    +  N+ ++RK S+++   +P  ++      P  +P + P  + E+
Sbjct: 1618 RRSIHSLCTSHYLDLFITFIICLNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSIMGIALEEIEMNAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFTNFGMAFLTLFRVSTGDNWNGIMKDTLRECTREDKHCLSYLPALSPVYFVTF-----VLVAQFVLVNVVVAVLMK--HLEESNKEARED-AEMDAEIELEIAQGSTAQPPSTAQESQGTEPDTPNLLVVRKVSVSRMLSLPNDSYMFRPVAPAAAPHSHPLQEVEM 1960          

HSP 7 Score: 75.8702 bits (185), Expect = 7.097e-12
Identity = 68/210 (32.38%), Postives = 118/210 (56.19%), Query Frame = 2
Query: 5363 LVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFG-----RLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            +V+SKYF+  I   I +N ++M +E++  P EL  AL+  N +FTS+F +E L+K +A GP  YI + +N  D ++VI+SV  IV +          ++++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  FIF+ LG+ LFG     + +  D  P        +F++   A +T+F+I T ++WN ++ + +
Sbjct:  786 IVDSKYFNRGIMAAILVNTLSMGVEYHEQPDELTNALEISNIVFTSMFALEMLLKLLACGPLGYIRNPYNIFDGIVVIISVWEIVGQADG------GLSVLRTFRLL---RVLKLVRFLPALRRQLVVLMRTMDNVATFCMLLMLFIFIFSILGMHLFGCKFSLKTDSGDTVP-----DRKNFDSLLWAIVTVFQILTQEDWNVVLYNGM 981          

HSP 8 Score: 73.1738 bits (178), Expect = 4.657e-11
Identity = 72/277 (25.99%), Postives = 134/277 (48.38%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNT--LEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVEL----AQEGGA---SGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGF 3235
            R R   + ++AH+ F   +L+ I +N +++ +E  +     T    L  SN IF  +F+VEM++K++A GLL     Y+ + +NV DG +V++ LV++    A  GGA     L VLR  R LR L+++   P L+L +  ++ ++  +     +   F  IF ILG+ L                     C   + +    + NFD+L  A++++F + +++ W  ++  G+               W  LYF++ +   ++ + N+ V ++VE F
Sbjct: 1293 RLRVSCQKVIAHKMFDHVVLVFIFLNCITIALERPDIDPGSTERAFLSVSNYIFTAIFVVEMMVKVVALGLLWGEHAYLQSSWNVLDGLLVLVSLVDIIVAVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGTDTRNITTKAECHAAHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGIDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENF 1569          

HSP 9 Score: 61.6178 bits (148), Expect = 1.313e-7
Identity = 53/170 (31.18%), Postives = 90/170 (52.94%), Query Frame = 2
Query:  587 CLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            C K I+   F+ + +  I +NCIT+ + +P  D    +     L   ++     F VE+M+K+ A+GLL G   Y   SWN LD ++V+  L++ I +        I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 1298 CQKVIAHKMFDHVVLVFIFLNCITIALERP--DIDPGSTERAFLSVSNYIFTAIFVVEMMVKVVALGLLWGEHAYLQSSWNVLDGLLVLVSLVDIIVAVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKG 1465          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|O95180|CAC1H_HUMAN (Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens OX=9606 GN=CACNA1H PE=1 SV=4)

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 407/705 (57.73%), Postives = 509/705 (72.20%), Query Frame = 2
Query: 4187 VSKLPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNYF--WCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ------XXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQK--NCCVS--PIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRGNKE 6262
            V  LPS+  +  +   ++ + L +  +D       K+L  Y   WC       R+    +L++ SP NRFR SCQ ++  K+FD++VL FI LNC+T+A+ERP I   S ER FL+++NY+FT IF  EM +KV+A GLL G+H+YL+S WN++DGLLV++SL DI++ +     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSLRPIGNIVLICC FFIIFGI GVQLFKGKFYYC GPD  ++   ++C       W  ++YNFDNLGQALMSLFVLSSKDGWV IMY GLDAVGV+QQP +N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++Q       +EEK  R  +R RR      +  + PY+  Y   R  IH L  S Y DL I  II +NVITM+ME Y  P  L+ ALK  NY+FT VF+ EA +K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE++ +  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFGRLECS+ NPC GLSRHA F NFGMAFLTLFR++TGDNWNGIMKDTLR       EC +    C+S  P ++P+YFV FVL+AQFVLVNVVVAVLMKHLEES+K   +D E++ E++ E+ +      R +        E+ G ++
Sbjct: 1221 VVALPSDFFLRIDSHREDAAELDDDSEDSCCLRLHKVLEPYKPQWC-------RSREAWALYLFSPQNRFRVSCQKVITHKMFDHVVLVFIFLNCVTIALERPDIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGPDTRNISTKAQCRA-AHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLERRRRSTFPSPEAQRRPYYADYSPTRRSIHSLCTSHYLDLFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSLMGITLEEIEMSAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFLTLFRVSTGDNWNGIMKDTLR-------ECSREDKHCLSYLPALSPVYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAELDAEIELEMAQGPGSARRVDADRPPLPQESPGARD 1910          

HSP 2 Score: 394.045 bits (1011), Expect = 8.584e-109
Identity = 236/448 (52.68%), Postives = 303/448 (67.63%), Query Frame = 2
Query:  464 DSSAAEEERIENTEKNKDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLN-LSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIP-------PSVI-WLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
            +S AAE       ++ + +PYP     VFF L QT  PR WCL+ +  PWFE +S+ VI++NC+TLGM++PCED  C + RC IL  FD  IF FFAVE++IK+ A+GL G   Y  ++WNRLD  IV+AG++E       +SL+AIRTVRVLRPLRAINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC+L  ++  R+  L  L  YYQ     T+      FICS    NG+ KCS IP       P  + W    + +     A  N        +C+NWNQYY+ C +  +NP+ GAINFDNIG+AW+AIFQVI++E WVDIMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE++ M  +R +  S  STL S  EP SCY E++K +    R + +  ++ Y R+  +
Sbjct:   52 ESPAAERGAELGADEEQRVPYPALAATVFFCLGQTTRPRSWCLRLVCNPWFEHVSMLVIMLNCVTLGMFRPCEDVECGSERCNILEAFDAFIFAFFAVEMVIKMVALGLFGQKCYLGDTWNRLDFFIVVAGMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLD-SAFVRNNNLTFLRPYYQ-----TEEGEENPFICSSRRDNGMQKCSHIPGRRELRMPCTLGWEAYTQPQAEGVGAARN--------ACINWNQYYNVCRSGDSNPHNGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRARHLSNDSTLASFSEPGSCYEELLKYVGHIFRKVKRRSLRLYARWQSR 485          

HSP 3 Score: 312.383 bits (799), Expect = 7.501e-84
Identity = 193/333 (57.96%), Postives = 239/333 (71.77%), Query Frame = 2
Query: 2513 LGVRFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXX-XXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFND 3508
            L V F  K++ IV  +YF RGI++AIL+NTLSMG+EYH QP  LTN LE SN++F  +F +EMLLK+LA G LGYI N +N+FDG IV++ + E+  +    GLSVLRTFRLLR+LKLVRF+PALR QL+V++KTMDNVATF  LL+LFIFIFSILGM LFGCK   K   G    DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TSSWAALYFVALMTFGNYVLFNLLVAILVEGF  E   +A  ++       +E+K +   + + HK +E            ++ N ++    +GSL+     P+I  T ATPMP+P++SPF D
Sbjct:  778 LWVTFSGKLRRIVDSKYFSRGIMMAILVNTLSMGVEYHEQPEELTNALEISNIVFTSMFALEMLLKLLACGPLGYIRNPYNIFDGIIVVISVWEIVGQADG-GLSVLRTFRLLRVLKLVRFLPALRRQLVVLVKTMDNVATFCTLLMLFIFIFSILGMHLFGCKFSLKTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQAE--GDANRSDT------DEDKTSVHFEEDFHKLRELQTTELKMCSLAVTPNGHLE--GRGSLSP----PLIMCTAATPMPTPKSSPFLD 1095          

HSP 4 Score: 98.9821 bits (245), Expect = 6.897e-19
Identity = 73/278 (26.26%), Postives = 140/278 (50.36%), Query Frame = 2
Query: 4388 FRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            F    + +++ K F   ++  I +N +++ +E    P++      L I+N VFT +FA+EM +K++A G L     Y+R+ +N+ DG++VVIS+ +     I+G +     +LR FRLLR L+ +R +   P L+  +  L+ ++  +     +   F  IF I G+ LF  KF                   D  +T  +++ NFD+L  A++++F + +++ W  ++Y G+ +           + W  LYF++ +    + + N+ V ++VE F 
Sbjct:  782 FSGKLRRIVDSKYFSRGIMMAILVNTLSMGVEYHEQPEELTNA--LEISNIVFTSMFALEMLLKLLACGPL----GYIRNPYNIFDGIIVVISVWE-----IVGQADGGLSVLRTFRLLRVLKLVRFL---PALRRQLVVLVKTMDNVATFCTLLMLFIFIFSILGMHLFGCKF---------------SLKTDTGDTVPDRK-NFDSLLWAIVTVFQILTQEDWNVVLYNGMAST----------SSWAALYFVALMTFGNYVLFNLLVAILVEGFQ 1019          

HSP 5 Score: 84.3445 bits (207), Expect = 1.502e-14
Identity = 73/198 (36.87%), Postives = 104/198 (52.53%), Query Frame = 2
Query: 4361 LFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKN 4948
             F L    R R+ C  L+    F+++ +  I LNC+TL M RP   +   S     L   +      FAVEM IK++A GL  G+  YL   WN +D  +VV   A +M   + GH+  +  I    R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G        D A V+N
Sbjct:   80 FFCLGQTTRPRSWCLRLVCNPWFEHVSMLVIMLNCVTLGMFRPCEDVECGSERCNILEAFDAFIFAFFAVEMVIKMVALGLF-GQKCYLGDTWNRLDFFIVV---AGMMEYSLDGHNVSLSAI----RTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLDSAFVRN 269          

HSP 6 Score: 78.1814 bits (191), Expect = 1.165e-12
Identity = 84/344 (24.42%), Postives = 159/344 (46.22%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS-----------SWAALYFVALMTFGNYVLFNLLVAIL---VEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVM--PIITHTDATPMP 3481
            R+ + S+    Y    I   I +N ++M +E++NQP  L   L+Y N +F  +F+ E  LK++A G   +  + +N  D  IV+L L+ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C   N      R   F +   A +T+F++ T ++WN ++   + + S           + + +YFV  +    +VL N++VA+L   +E  + E  ++A+L  +I LE       A  +  +     + +  +   P  V    + +++ R  SL     M  P++  +   P P
Sbjct: 1607 RRSIHSLCTSHYLDLFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSLMGITLEEIEMSAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFLTLFRVSTGDNWNGIMKDTLRECSREDKHCLSYLPALSPVYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAELDAEIELEMAQGPGSARRVDADRPPLPQESPGARDAPNLVA---RKVSVSRMLSLPNDSYMFRPVVPASAPHPRP 1947          

HSP 7 Score: 74.3294 bits (181), Expect = 1.976e-11
Identity = 68/210 (32.38%), Postives = 116/210 (55.24%), Query Frame = 2
Query: 5363 LVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFG-----RLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            +V+SKYF   I   I +N ++M +E++  P EL  AL+  N +FTS+F +E L+K +A GP  YI + +N  D +IV++SV  IV +          ++++R FR+L   RVLKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG     + +  D  P        +F++   A +T+F+I T ++WN ++ + +
Sbjct:  789 IVDSKYFSRGIMMAILVNTLSMGVEYHEQPEELTNALEISNIVFTSMFALEMLLKLLACGPLGYIRNPYNIFDGIIVVISVWEIVGQADG------GLSVLRTFRLL---RVLKLVRFLPALRRQLVVLVKTMDNVATFCTLLMLFIFIFSILGMHLFGCKFSLKTDTGDTVP-----DRKNFDSLLWAIVTVFQILTQEDWNVVLYNGM 984          

HSP 8 Score: 59.6918 bits (143), Expect = 4.548e-7
Identity = 34/108 (31.48%), Postives = 61/108 (56.48%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNT--LEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVE----LAQEGGA 2815
            RFR   + ++ H+ F   +L+ I +N +++ +E  +     T    L  SN IF  +F+ EM++K++A GLL     Y+ + +N+ DG +V++ LV+    +A  GGA
Sbjct: 1282 RFRVSCQKVITHKMFDHVVLVFIFLNCVTIALERPDIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGA 1389          

HSP 9 Score: 56.9954 bits (136), Expect = 3.327e-6
Identity = 50/170 (29.41%), Postives = 89/170 (52.35%), Query Frame = 2
Query:  587 CLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            C K I+   F+ + +  I +NC+T+ + +P  D    +     L   ++     F  E+M+K+ A+GLL G   Y   SWN LD ++V+  L++ + +        I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 1287 CQKVITHKMFDHVVLVFIFLNCVTIALERP--DIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKG 1454          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|Q9P0X4|CAC1I_HUMAN (Voltage-dependent T-type calcium channel subunit alpha-1I OS=Homo sapiens OX=9606 GN=CACNA1I PE=1 SV=1)

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 406/673 (60.33%), Postives = 507/673 (75.33%), Query Frame = 2
Query: 4217 GNEKCADEDSSLLNQ------DQDDHNENEEKILCNYFWCSWLSKFFRAHYYD--------SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPI--IAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREI 6184
            G+E C     S+         D+ D  E+EE+I  +Y  C  + K    +  D        S+++ SP+NRFR  CQ ++  K+FD +VL FI LNCIT+A+ERP I   S ER FLT++NY+FT IF  EMT+KV++ GL  G+ +YLRS WNV+DG LV +S+ DI++ L     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSL+PIGNIVLICC FFIIFGI GVQLFKGKFY+C G D  ++ N S+C       W + +YNFDNLGQALMSLFVL+SKDGWV IMY GLDAV V+QQP  N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE EE  RR  KR RRLEKK++K  + PY+  Y H RLLIH +  S Y D+ I  II LNV+TM++E Y  P  LE ALK  NY+FT+VF++EA++K +A+G +R+  DRWNQLD+ IV+LSV GI +EE++ N  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG+L C+D NPC G+SRHA FENFGMAFLTLF+++TGDNWNGIMKDTLR+ C + E      C+S +  ++P+YFV FVL AQFVL+NVVVAVLMKHL++S+K   +D E++ E++ E+
Sbjct: 1090 GHEDCNGRMPSIAKDVFTKMGDRGDRGEDEEEI--DYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENRFRVLCQTIIAHKLFDYVVLAFIFLNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCMAANYR-WVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCHTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRD-CTHDER----SCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAELELEM 1754          

HSP 2 Score: 383.645 bits (984), Expect = 1.018e-105
Identity = 225/446 (50.45%), Postives = 301/446 (67.49%), Query Frame = 2
Query:  482 EERIENTEKNKDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKD----FICSPDNFNGLVKCSDIPPSVIWLPSGEARVC----NDSALPNSDNMPTNVS--CVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQSTSTLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEKHENL 1789
            EE ++  + +  +P+PD     FF L QT  PR+WC+K +  PWFE +S+ VI++NC+TLGMY+PC+D  C + RCKIL  FD  IF+FFA+E+++K+ A+G+ G   Y  ++WNRLD  IV+AG++E       ++L+AIRTVRVLRPL+AINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGI+GVQ+W G+LRNRC+L  N + +   + L  YYQ         P +D    FICS    NG++ C +IPP        + R C    +D     +     N S  CVNWN+YY+ C   + NP+ GAINFDNIG+AW+ IFQVI++E WV+IMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE   ML +R++  S+ST+ S  EP  CY EI + +    R   +  +  Y+    + + L
Sbjct:   39 EEPLDGADPH--VPHPDLAPIAFFCLRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMDCLSDRCKILQVFDDFIFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFLEENFTIQG-DVALPPYYQ---------PEEDDEMPFICSLSGDNGIMGCHEIPPL-----KEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYLSSSTVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQSRRQAL 467          

HSP 3 Score: 258.07 bits (658), Expect = 2.782e-67
Identity = 159/240 (66.25%), Postives = 190/240 (79.17%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXX-XXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTE 3244
            R K++ IV  +YF RGI++AIL+NT+SMGIE+H QP  LTN LE  N++F  +F +EM+LK+ A GL  Y+ N +N+FD  IVI+ + E+  +    GLSVLRTFRLLR+LKLVRFMPALR QL+V++KTMDNVATF  LL+LFIFIFSILGM +FGCK   +   G    DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TS WA+LYFVALMTFGNYVLFNLLVAILVEGF  E
Sbjct:  630 RAKLRGIVDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIVGQADG-GLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGFQAE 868          

HSP 4 Score: 91.2781 bits (225), Expect = 1.402e-16
Identity = 74/277 (26.71%), Postives = 141/277 (50.90%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLI-----------SGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGF---STERVDEAKLAEKIHLE 3286
            R  + S+    Y    I   I +N ++M +E++NQP  L   L+Y N +F  +F++E +LK++A GL  +  + +N  D  IV+L ++ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C  +N      R   F++   A +T+FQ+ T ++WN ++            S +S     + LYFV+ +    +VL N++VA+L++     + E  ++A++  ++ LE
Sbjct: 1477 RLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAELELE 1753          

HSP 5 Score: 78.9518 bits (193), Expect = 6.410e-13
Identity = 71/277 (25.63%), Postives = 138/277 (49.82%), Query Frame = 2
Query: 4391 RNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            R   + +++ K F+  ++  I +N +++ +E    P++      L I N VFT +FA+EM +K+ A GL      YLR+ +N+ D ++V+IS+       I+G +     +LR FRLLR L+ +R +   P L+  +  L+ ++  +    ++   F  IF I G+ +F  KF                   D  +T  +++ NFD+L  A++++F + +++ W  ++Y G+ +           + W  LYF++ +    + + N+ V ++VE F 
Sbjct:  630 RAKLRGIVDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTN--ILEICNVVFTSMFALEMILKLAAFGLF----DYLRNPYNIFDSIIVIISIW-----EIVGQADGGLSVLRTFRLLRVLKLVRFM---PALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKF---------------SLRTDTGDTVPDRK-NFDSLLWAIVTVFQILTQEDWNVVLYNGMAST----------SPWASLYFVALMTFGNYVLFNLLVAILVEGFQ 866          

HSP 6 Score: 74.7146 bits (182), Expect = 1.387e-11
Identity = 61/185 (32.97%), Postives = 99/185 (53.51%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGI-LRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            + F L      RN C  ++    F+ + +  I LNC+TL M +P   +   S   + L + +    + FA+EM +K++A G+  GK  YL   WN +D  +V+  + +        +S  +  I L   R +R LRPL+ I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G
Sbjct:   58 AFFCLRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMDCLSDRCKILQVFDDFIFIFFAMEMVLKMVALGIF-GKKCYLGDTWNRLDFFIVMAGMVE--------YSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAG 233          

HSP 7 Score: 69.3218 bits (168), Expect = 6.783e-10
Identity = 66/216 (30.56%), Postives = 118/216 (54.63%), Query Frame = 2
Query: 5345 RLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFG-----RLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            R  + G+V+SKYF+  I   I +N ++M +E +  P EL   L+  N +FTS+F +E ++K  A+G   Y+ + +N  D +IVI+S+  IV +          ++++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  FIF+ LG+ +FG     R +  D  P        +F++   A +T+F+I T ++WN ++ + +
Sbjct:  630 RAKLRGIVDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIVGQADG------GLSVLRTFRLL---RVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVP-----DRKNFDSLLWAIVTVFQILTQEDWNVVLYNGM 831          

HSP 8 Score: 67.3958 bits (163), Expect = 2.579e-9
Identity = 73/284 (25.70%), Postives = 136/284 (47.89%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLE-----YSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVE----LAQEGGASGLSVLRT---FRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTER 3247
            RFR   ++I+AH+ F   +L  I +N +++ +E   +P +   + E      SN IF  +F+ EM LK+++ GL      Y+ + +NV DG +V + +++    LA  GGA  L VLR     R LR L+++   P L+L +  ++ ++  +     +   F  IF ILG+ L                     C   N +    + NFD+L  A++++F + +++ W  ++ +G+   +           W  LYF++ +   ++ + N+ V ++VE F   R
Sbjct: 1158 RFRVLCQTIIAHKLFDYVVLAFIFLNCITIALE---RPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCMAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCR 1438          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|Q9Z0Y8|CAC1I_RAT (Voltage-dependent T-type calcium channel subunit alpha-1I OS=Rattus norvegicus OX=10116 GN=Cacna1i PE=1 SV=3)

HSP 1 Score: 615.535 bits (1586), Expect = 2.659e-180
Identity = 399/652 (61.20%), Postives = 499/652 (76.53%), Query Frame = 2
Query: 4262 DQDDHNENEEKILCNYFWCSWLSKFFRAHYYD--------SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPI--IAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREI 6184
            D  D  E+EE+I  +Y  C  + K    +  D        S+++ SP+N+FR  CQ ++  K+FD +VL FI LNCIT+A+ERP I   S ER FLT++NY+FT IF  EMT+KV++ GL  G+ +YLRS WNV+DG LV +S+ DI++ +     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL+SSL+PIGNIVLICC FFIIFGI GVQLFKGKFY+C G D  ++ N S+C       W + +YNFDNLGQALMSLFVL+SKDGWV IMY GLDAV V+QQP  N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE EE  RR  KR RRLEKK++K  + PY+  Y   RLLIH +  S Y D+ I  II LNV+TM++E Y  P  LE ALK  NY+FT+VF++EA++K +A+G +R+  DRWNQLD+ IV+LSV GI +EE++ N  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG+L C+D NPC G+SRHA FENFGMAFLTLF+++TGDNWNGIMKDTLR+ C + E      C+S +  ++P+YFV FVL AQFVL+NVVVAVLMKHL++S+K   +D E++ E++ E+
Sbjct: 1070 DCRDRGEDEEEI--DYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENKFRILCQTIIAHKLFDYVVLAFIFLNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCVAANYR-WVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCPTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRD-CTHDER----SCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAEIELEM 1713          

HSP 2 Score: 385.185 bits (988), Expect = 3.654e-106
Identity = 224/437 (51.26%), Postives = 296/437 (67.73%), Query Frame = 2
Query:  509 NKDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKD----FICSPDNFNGLVKCSDIPPSVIWLPSGEARVC----NDSALPNSDNMPTNVS--CVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQSTSTLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEKHENL 1789
            N D+P+PD     FF L QT  PR+WC+K +  PWFE +S+ VI++NC+TLGMY+PC+D  C + RCKIL  FD  IF+FFA+E+++K+ A+G+ G   Y  ++WNRLD  IV+AG++E       ++L+AIRTVRVLRPL+AINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGI+GVQ+W G+LRNRC+L  N + +   + L  YYQ         P +D    FICS    NG++ C +IPP        + R C    +D     +     N S  CVNWN+YY+ C     NP+ GAINFDNIG+AW+ IFQVI++E WV+IMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE   ML +R++  S+ST+ S  EP  CY EI + +    R   +  +  Y+    + + +
Sbjct:   44 NPDVPHPDLAPVAFFCLRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMECLSDRCKILQVFDDFIFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFLEENFTIQG-DVALPPYYQ---------PEEDDEMPFICSLTGDNGIMGCHEIPPL-----KEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRTGNANPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYLSSSTVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQNRRQAM 465          

HSP 3 Score: 257.684 bits (657), Expect = 3.542e-67
Identity = 158/240 (65.83%), Postives = 191/240 (79.58%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXX-XXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTE 3244
            R+K++ IV  +YF RGI++AIL+NT+SMGIE+H QP  LTN LE  N++F  +F +EM+LK+ A GL  Y+ N +N+FD  IVI+ + E+  +    GLSVLRTFRLLR+LKLVRFMPALR QL+V++KTMDNVATF  LL+LFIFIFSILGM +FGCK   +   G    DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ T+ WA+LYFVALMTFGNYVLFNLLVAILVEGF  E
Sbjct:  588 REKLRGIVDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIVGQADG-GLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTTPWASLYFVALMTFGNYVLFNLLVAILVEGFQAE 826          

HSP 4 Score: 92.4337 bits (228), Expect = 5.741e-17
Identity = 75/277 (27.08%), Postives = 141/277 (50.90%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLI-----------SGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGF---STERVDEAKLAEKIHLE 3286
            R  + S+    Y    I   I +N ++M +E++NQP  L   L+Y N +F  +F++E +LK++A GL  +  + +N  D  IV+L ++ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C  +N      R   F++   A +T+FQ+ T ++WN ++            S +S     + LYFV+ +    +VL N++VA+L++     + E  ++A++  +I LE
Sbjct: 1436 RLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAEIELE 1712          

HSP 5 Score: 79.337 bits (194), Expect = 6.292e-13
Identity = 71/277 (25.63%), Postives = 138/277 (49.82%), Query Frame = 2
Query: 4391 RNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            R   + +++ K F+  ++  I +N +++ +E    P++      L I N VFT +FA+EM +K+ A GL      YLR+ +N+ D ++V+IS+ +I+     G +     +LR FRLLR L+ +R +   P L+  +  L+ ++  +    ++   F  IF I G+ +F  KF                   D  +T  +++ NFD+L  A++++F + +++ W  ++Y G+ +             W  LYF++ +    + + N+ V ++VE F 
Sbjct:  588 REKLRGIVDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTN--ILEICNVVFTSMFALEMILKLAAFGLF----DYLRNPYNIFDSIIVIISIWEIV-----GQADGGLSVLRTFRLLRVLKLVRFM---PALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKF---------------SLRTDTGDTVPDRK-NFDSLLWAIVTVFQILTQEDWNVVLYNGMAST----------TPWASLYFVALMTFGNYVLFNLLVAILVEGFQ 824          

HSP 6 Score: 75.0998 bits (183), Expect = 1.050e-11
Identity = 61/185 (32.97%), Postives = 99/185 (53.51%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQK--SREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGI-LRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            + F L      RN C  ++    F+ + +  I LNC+TL M +P    +  S   + L + +    + FA+EM +K++A G+  GK  YL   WN +D  +V+  + +        +S  +  I L   R +R LRPL+ I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G
Sbjct:   56 AFFCLRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMECLSDRCKILQVFDDFIFIFFAMEMVLKMVALGIF-GKKCYLGDTWNRLDFFIVMAGMVE--------YSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAG 231          

HSP 7 Score: 68.5514 bits (166), Expect = 9.241e-10
Identity = 65/213 (30.52%), Postives = 117/213 (54.93%), Query Frame = 2
Query: 5354 IHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFG-----RLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            + G+V+SKYF+  I   I +N ++M +E +  P EL   L+  N +FTS+F +E ++K  A+G   Y+ + +N  D +IVI+S+  IV +          ++++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  FIF+ LG+ +FG     R +  D  P        +F++   A +T+F+I T ++WN ++ + +
Sbjct:  591 LRGIVDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIVGQADG------GLSVLRTFRLL---RVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVP-----DRKNFDSLLWAIVTVFQILTQEDWNVVLYNGM 789          

HSP 8 Score: 64.6994 bits (156), Expect = 1.541e-8
Identity = 71/284 (25.00%), Postives = 136/284 (47.89%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLE-----YSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVEL----AQEGGASGLSVLRT---FRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTER 3247
            +FR   ++I+AH+ F   +L  I +N +++ +E   +P +   + E      SN IF  +F+ EM LK+++ GL      Y+ + +NV DG +V + ++++    A  GGA  L VLR     R LR L+++   P L+L +  ++ ++  +     +   F  IF ILG+ L                     C   N +    + NFD+L  A++++F + +++ W  ++ +G+   +           W  LYF++ +   ++ + N+ V ++VE F   R
Sbjct: 1117 KFRILCQTIIAHKLFDYVVLAFIFLNCITIALE---RPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCVAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCR 1397          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. TrEMBL
Match: J9M5X0 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 1010.75 bits (2612), Expect = 0.000e+0
Identity = 683/1265 (53.99%), Postives = 851/1265 (67.27%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVEL--------AQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXX--------------XXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKH-------------NEEKMANLMKHEAHKNQETTKNSSIEP--QEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDREIFHQEMDSLSRKSQLMSNTDGESLGVPLVLQHDQRNLSRRGSDSSINHQPVGQQCRKTNCSPTRLHPNLTIPSSRTDGLSVIPAESNYSTAS--------TFRSRSPSLQLYGLPITLNKFNSNSGQIIQHSGVLVRRSSIGQNSNCSALSNQNTAGSLTLSEKGDEIYSKCPTPNTEHNNKDTDAEXXXXXXXXXXXXXXXXXXXXXXIHNSQPSLKTSMFLPMVFIDSSFVSKLPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNYFWC----SWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEV 6172
             R+ +K +V HR FQ+ IL+AILINTLSMGIEYHNQP  LT  +EYSN++F+ +F  EM LK++AEG  GY+SNGFNVFDG IVIL +VEL         Q  G SGLSVLRTFRLLRILKLVRFMP LR QL VML+TMDNVA FF+LLILFIFIFSILGM LFG K                  K+    CDRK+F+++LWA VTVFQILTQEDWN VL +GM +TS WAALYFV LMTFGNYVLFNLLVAILVEGFS+ER +  +   +    +              +++        +   N +++ +  IE   +++I+N  N    +  SL      PIITHT ATP  SP A+    R+   +   SL+  + L  +T+G    +      D  + S R S +S+  Q V +  +  N +P    P   + +        IP +  YS  +        +++   PSL+        +KF++   +     G+LV       N+N  +  N       +    G    SK P+PN    N                           +I  S  +++ S  +  V     +    P + T G     D+ +S    D D  +E  +  +   F+      WL    RA Y  SL++  P++ FR SC   +++K FDN VL FIALNCITLAMERP+IP  S+ER FL   NYVFTV+FA+EM +KV+A G+  G   Y +SGWN+MDGLLVV+S+ D+++ LI   S +IFGILRVFRLLR+LRPLRVI+RAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGI GVQLFKG F++C GP++ HV++  EC  DK+N W NQ+YNFD+LG+ALMSLFVLSS+DGWV IMYTGLDAVGV+QQP ENY+EW LLYFISF+LLVGFFVLNMFVGVVVENFH+CRE QEKEE+ RR AKRA+++EKK++KM +PPY++ Y + RLL+H +V SKYFDLAIA +IGLNV+TMA+EFYMMP  L  ALK  NY FT+VFI+E ++K +A G + Y+ D+WN LD+ IVILS+ GI +EE+++K IPIN TIIRV RV+RIARVLKLLKMAKGIRALLDTV+QALPQVGNLGLLFFLLFFIFAALGVELFGRLECSD + C GL  HAHF NFGMAFLTLFR+ATGDNWNGIMKD LR  CD++ +C KNCCV+  IAP++FVIFVLMAQFVLVNVVVAVLMKHLEESHK M D+ ++E ++
Sbjct:  684 LRECIKLLVNHRRFQQCILLAILINTLSMGIEYHNQPTELTVIVEYSNIVFSAIFAAEMFLKVIAEGPCGYVSNGFNVFDGIIVILSIVELTQSFENTSGQREGNSGLSVLRTFRLLRILKLVRFMPNLRRQLFVMLRTMDNVAVFFSLLILFIFIFSILGMYLFGGKFCMYGNGARECNCKEIVTKHPLCVCDRKHFNNVLWATVTVFQILTQEDWNIVLFNGMEKTSHWAALYFVTLMTFGNYVLFNLLVAILVEGFSSERNERRERERRELERQQQSSWCKCTCSCYGDDKGDCEFCTDKKSLNGKSSTDLKIENPNRDIITNKCNTH--KDTSLVIAPPPPIITHTAATPQDSPNAA-HESRDF--RRFQSLTPYTFLPFDTNGSGFSI------DSIDCSVRSSTNSL--QSVSKFPKINNRAPQISSPQKLVAN---QSFETIPEDVTYSGENGEKLQRRYSWKISRPSLR------RKSKFSNAECESADDQGILV------LNNNSHSAVNSGAGQDHSQCNGG---VSKSPSPNFRATNN--------------------MLSEYNTIERSPSTVQQST-VNYVLAGCQYDCCQPCD-TEGCAGATDDKASEPCCDCDAESETAKVDVRKVFYFFEEKGWLKD--RAEY--SLYIFPPEHGFRQSCGKFIKQKWFDNAVLTFIALNCITLAMERPNIPPDSKERTFLGTANYVFTVVFALEMFVKVVAAGMFYGTEPYFKSGWNIMDGLLVVVSIIDLLMSLISESSPKIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGTFFHCEGPNIKHVRDKKECLADKKNAWVNQKYNFDDLGKALMSLFVLSSRDGWVNIMYTGLDAVGVDQQPIENYSEWRLLYFISFILLVGFFVLNMFVGVVVENFHRCREEQEKEERVRRLAKRAKQMEKKRRKMHEPPYYRDYSNARLLVHSVVTSKYFDLAIAAVIGLNVVTMALEFYMMPKALTYALKIFNYFFTAVFILECVMKMLALGLQLYVKDKWNILDIGIVILSIVGITLEELESKIIPINPTIIRVMRVMRIARVLKLLKMAKGIRALLDTVMQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDEHSCQGLGEHAHFGNFGMAFLTLFRVATGDNWNGIMKDALREDCDSAADCVKNCCVADGIAPMFFVIFVLMAQFVLVNVVVAVLMKHLEESHKQMEDEMDMEDQL 1891          

HSP 2 Score: 428.328 bits (1100), Expect = 4.011e-117
Identity = 235/434 (54.15%), Postives = 307/434 (70.74%), Query Frame = 2
Query:  506 KNKDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKK---QQSTSTLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRY-----ERFSEKHE 1783
            + ++LPYP +      +L+Q   PR+WCL  I+ PWFE+ S+ VI++NC+TLGMY+PC D  C + RC+IL  FD  IF FF++E+++K+ AMG  GP  Y ++SWNRLD  IVIAG +E   +   ++ +AIRT+RVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGI+GVQ+W+GILR RC+L    +  +P + L  YY +N         KD+ICS ++ NG+  C D+PP+       +A +CN +A         N SCVNWN YY++C+++  NP+ G I+FDNIG AWVAIF VIS+E WVDIMYYVQDAHSFWDW YFV LI+IGSFFMINLCLVVIATQFSETKKRE ERM MER +     + ++  ++ EP SCY +++K ++   R   + +IK+Y      R +E+ E
Sbjct:   79 QQEELPYPGFVSISMRYLDQKSRPRNWCLAMITNPWFERASMLVILLNCVTLGMYQPCVDDQCISRRCRILQVFDDFIFAFFSLEMIVKMIAMGAYGPCTYLADSWNRLDFFIVIAGALEYCLNVENINFSAIRTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWEGILRQRCFLKPLPNVTYPKM-LPAYYTLNDE------EKDYICSKNDDNGMHSCFDLPPT----RGHDALICNATA----TMALANGSCVNWNYYYTECKSQGENPFQGTISFDNIGLAWVAIFVVISLEGWVDIMYYVQDAHSFWDWIYFVLLIVIGSFFMINLCLVVIATQFSETKKREMERMKMERARFHSTSTLTSSTNNSEPSSCYAQMVKYVAHLWRRGKRKLIKKYRVWMLRRQTEREE 497          

HSP 3 Score: 81.2629 bits (199), Expect = 4.578e-11
Identity = 64/185 (34.59%), Postives = 100/185 (54.05%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQK--SREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVI-SLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            S+  L   +R RN C  ++    F+   +  I LNC+TL M +P +  +  SR    L + +      F++EM +K+IA G   G  +YL   WN +D  +V+  +L   + V  I  S+         R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL++G
Sbjct:   92 SMRYLDQKSRPRNWCLAMITNPWFERASMLVILLNCVTLGMYQPCVDDQCISRRCRILQVFDDFIFAFFSLEMIVKMIAMGAY-GPCTYLADSWNRLDFFIVIAGALEYCLNVENINFSA--------IRTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWEG 267          

HSP 4 Score: 74.7146 bits (182), Expect = 3.802e-9
Identity = 62/196 (31.63%), Postives = 101/196 (51.53%), Query Frame = 2
Query:  530 DYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKP--CEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLR------------AINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            D  E   +     H  R  C KFI   WF+   +  I +NCITL M +P    D+  +T     LG  ++   + FA+E+ +K+ A G+  G   YF   WN +D ++V+  +I+ +     MSL +  + ++   LR             INR P ++++V  LL +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 1282 DRAEYSLYIFPPEHGFRQSCGKFIKQKWFDNAVLTFIALNCITLAMERPNIPPDSKERT----FLGTANYVFTVVFALEMFVKVVAAGMFYGTEPYFKSGWNIMDGLLVVVSIIDLL-----MSLISESSPKIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKG 1468          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. TrEMBL
Match: A0A2S2PRI1 (Voltage-dependent T-type calcium channel subunit alpha-1H OS=Schizaphis graminum OX=13262 GN=Cacna1h PE=4 SV=1)

HSP 1 Score: 1006.51 bits (2601), Expect = 0.000e+0
Identity = 691/1267 (54.54%), Postives = 847/1267 (66.85%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVEL--------AQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXX--------------XXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKH-------------NEEKMANLMKHEAHKNQETTKNSSIEP--QEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDREIFHQEMDSLSRKSQLMSNTDGESLGVPLVLQHDQRNLSRRGSDSSINHQPVGQQCRKTNCSPTRLHPNLTIPSSRTDGLSVIPAESNYSTAS--------TFRSRSPSLQLYGLPITLNKFNSNSGQIIQHSGVLVRRS--SIGQNSNCSALSNQNTAGSLTLSEKGDEIYSKCPTPNTEHNNKDTDAEXXXXXXXXXXXXXXXXXXXXXXIHNSQPSLKTSMFLPMVFIDSSFVSKLPSNLTMGNEKCADEDSSLLNQDQDDHNE----NEEKILCNYFWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEV 6172
             R+ +K +V HR FQ+ IL+AILINTLSMGIEYHNQP  LT  +EYSN++F+ +F  EM LK++AEG  GY+SNGFNVFDG IVIL +VEL         Q  G SGLSVLRTFRLLRILKLVRFMP LR QL VML+TMDNVA FF+LLILFIFIFSILGM LFG K                  K+    CDRK+F+++LWA VTVFQILTQEDWN VL +GM +TS WAALYFV LMTFGNYVLFNLLVAILVEGFS+ER +  +   +    +              +++    +   +   N +      IE   +++I+N  N    +  SL      PIITHT ATP  SP A+    R+   +   SL+  + L  +T+G    +      D  + S R S +S+  Q V +  +  N +P    P   + +        IP + +YS  +        +++   PSL+        +KF SN        G+LV  S  S   NS      +Q   G            SK P+PN    N +  ++ + I                       PS      +  V     +    P + T G    ADE SS    D D  +     N  K+   +    WL    RA Y  SL++  P++ FR SC   +++K FDN VL FIALNCITLAMERP+IP  S ER FL   NYVFTV+FA+EM +KV+A  +  G   Y +SGWN+MDGLLVV+S+ D+++ LI   S +IFGILRVFRLLR+LRPLRVI+RAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGI GVQLFKG F++C GP++ HV++  EC  DK+NTW NQ+YNFD+LG+ALMSLFVLSS+DGWV IMYTGLDAVGV+QQP ENY+EW LLYFISF+LLVGFFVLNMFVGVVVENFH+CRE QEKEE+ RR AKRA+++EKK++KM +PPY++ Y   RLL+H +V SKYFDLAIA +IGLNV+TMA+EFYMMP  L  ALK  NY FT+VFI+E ++K +A G + Y+ D+WN LD+ IVILS+ GI +EE+++K IPIN TIIRV RV+RIARVLKLLKMAKGIRALLDTV+QALPQVGNLGLLFFLLFFIFAALGVELFGRLECSD + C GL  HAHF NFGMAFLTLFR+ATGDNWNGIMKD LR  CDN+ +C KNCCV+  IAP++FVIFVLMAQFVLVNVVVAVLMKHLEESHK M D+ ++E ++
Sbjct:  793 LRECIKLLVNHRRFQQCILLAILINTLSMGIEYHNQPTELTVIVEYSNIVFSAIFAAEMFLKVIAEGPCGYVSNGFNVFDGIIVILSIVELTQSFENTSGQREGNSGLSVLRTFRLLRILKLVRFMPNLRRQLFVMLRTMDNVAVFFSLLILFIFIFSILGMYLFGGKFCMYGNGARECNCKEIVTKHPLCVCDRKHFNNVLWATVTVFQILTQEDWNIVLFNGMEKTSHWAALYFVTLMTFGNYVLFNLLVAILVEGFSSERNERRERERRELERQQQSSWCKCTCSCYGDDKGNCEMCTEKKSLNGKPNTELKIENPNRDIITNKCNTH--KDTSLVIVPPPPIITHTAATPQDSPNAA-HESRDF--RRFQSLTPYTFLPFDTNGSGFSI------DSIDCSVRSSTNSL--QSVSKFPKINNRTPQISSPQKLVVN---QSFETIPEDISYSGENGEKLQRRYSWKISRPSLK------RKSKF-SNVECESDDQGILVLNSQNSHSVNSGVGQDHSQCNGG-----------VSKSPSPNFRATNNNMLSDYNTI--------------------EKSPSTVQQSTVNYVLASCQYDCCQPCD-TEGCAGPADEKSSEPCCDCDAESSTAKVNVRKVFYFFEEKGWLKD--RAEY--SLYIFPPEHGFRQSCGKFIKQKWFDNAVLTFIALNCITLAMERPNIPPDSNERTFLGTANYVFTVVFALEMFVKVVAASMFYGSEPYFKSGWNIMDGLLVVVSIIDLLMSLISESSPKIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGTFFHCEGPNIKHVRDKKECLADKKNTWVNQKYNFDDLGKALMSLFVLSSRDGWVNIMYTGLDAVGVDQQPIENYSEWRLLYFISFILLVGFFVLNMFVGVVVENFHRCREEQEKEERVRRLAKRAKQMEKKRRKMHEPPYYRDYSSARLLVHSVVTSKYFDLAIAAVIGLNVVTMALEFYMMPKALTYALKIFNYFFTAVFILECVMKMLALGLQLYVKDKWNILDIGIVILSIVGITLEELESKIIPINPTIIRVMRVMRIARVLKLLKMAKGIRALLDTVMQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDEHTCQGLGEHAHFGNFGMAFLTLFRVATGDNWNGIMKDALREDCDNAADCVKNCCVADGIAPMFFVIFVLMAQFVLVNVVVAVLMKHLEESHKQMEDEMDMEDQL 2000          

HSP 2 Score: 432.95 bits (1112), Expect = 1.918e-118
Identity = 238/435 (54.71%), Postives = 309/435 (71.03%), Query Frame = 2
Query:  506 KNKDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMP-TNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKK---QQSTSTLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRY-----ERFSEKHE 1783
            + ++LPYP +      +L+Q   PR+WCL  I+ PWFE+ S+ VI++NC+TLGMY+PC D  C T RC+IL  FD  IF FF++E+++K+ AMG  GP  Y ++SWNRLD  IVIAG +E   +   ++ +AIRT+RVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGI+GVQ+W+GILR RC+L    +  +P + L  YY +N         KD+ICS ++ NG+  C D+PP+       +A +CN +A     NM   N SCVNWN YY++C+++  NP+ G I+FDNIG AWVAIF VIS+E WVDIMYYVQDAHSFWDW YFV LI+IGSFFMINLCLVVIATQFSETKKRE ERM MER +     + ++  ++ EP SCY +++K ++   R   + +IK+Y      R +E+ E
Sbjct:   80 QQEELPYPGFVSISMKYLDQKSRPRNWCLAMITNPWFERASMLVILLNCVTLGMYQPCVDDQCITRRCRILQVFDDFIFAFFSLEMIVKMIAMGAYGPCTYLADSWNRLDFFIVIAGALEYCLNVENINFSAIRTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWEGILRQRCFLKPLPNVTYPKM-LPAYYTLNDE------EKDYICSKNDDNGMHSCFDLPPT----RGHDALICNATA-----NMALANGSCVNWNHYYTECKSQGENPFQGTISFDNIGLAWVAIFVVISLEGWVDIMYYVQDAHSFWDWIYFVLLIVIGSFFMINLCLVVIATQFSETKKREMERMKMERARFHSTSTLTSSTNNSEPSSCYAQMVKYVAHLWRRGKRKLIKKYRVWMLRRQTEREE 498          

HSP 3 Score: 80.1073 bits (196), Expect = 9.749e-11
Identity = 63/185 (34.05%), Postives = 100/185 (54.05%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQK--SREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVI-SLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            S+  L   +R RN C  ++    F+   +  I LNC+TL M +P +  +  +R    L + +      F++EM +K+IA G   G  +YL   WN +D  +V+  +L   + V  I  S+         R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL++G
Sbjct:   93 SMKYLDQKSRPRNWCLAMITNPWFERASMLVILLNCVTLGMYQPCVDDQCITRRCRILQVFDDFIFAFFSLEMIVKMIAMGAY-GPCTYLADSWNRLDFFIVIAGALEYCLNVENINFSA--------IRTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWEG 268          

HSP 4 Score: 72.7886 bits (177), Expect = 1.708e-8
Identity = 61/196 (31.12%), Postives = 101/196 (51.53%), Query Frame = 2
Query:  530 DYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKP--CEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLR------------AINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            D  E   +     H  R  C KFI   WF+   +  I +NCITL M +P    D++ +T     LG  ++   + FA+E+ +K+ A  +  G   YF   WN +D ++V+  +I+ +     MSL +  + ++   LR             INR P ++++V  LL +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 1391 DRAEYSLYIFPPEHGFRQSCGKFIKQKWFDNAVLTFIALNCITLAMERPNIPPDSNERT----FLGTANYVFTVVFALEMFVKVVAASMFYGSEPYFKSGWNIMDGLLVVVSIIDLL-----MSLISESSPKIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKG 1577          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. TrEMBL
Match: G0YP35 (Voltage operated calcium channel Cav3 (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 848.581 bits (2191), Expect = 0.000e+0
Identity = 514/776 (66.24%), Postives = 610/776 (78.61%), Query Frame = 2
Query: 4238 EDSSLLNQDQDDHNENEEKILCNYFWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRGNKEIKEQIIEPNNNNIVFEPKKIEIKCNRLSNSAAVKFNRNANSQDSADSGKTPPDNGSGGTLHILNLPASRKLHEQLSQSQPLLLVNLNPDSLKNLNQISNTN 6565
            ++SS +N  +D  +E+ E ++C    C      F   YY S+++ S DN+FR  CQ  ++KK FD +VLFFI LNCITLAMERPSIP +S+ER FL++TNY+FT+IF  EM +KV++KGLL+G  +YL+SGWN+MDG LV ISL D+ I + +GHS+RIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGI GVQLFKGKFYYC GP + +V   ++C   +RN WKNQ+YNFDNLGQALM+LFVLSSKDGWVQIMYTG+DAV V+ QPQEN+NEW L+YFISFLLLV FFVLNMFVGVVVENFHKC+ENQEKEEKARRAAKRARRLEKK+K +  P YW+ Y  WR  I+ +V SKYFDLAIAG+IGLNVITMA EF+MMP  L+ ALK  NY FT+ F++EA++K +A G  RYI D+WNQLD++IVILS++G+V++E++N ++PIN TI+RV RVLRIARVLKLLKMA GIRALLDTVIQALPQVGNLGLLFFLLF+IFAALGVELFGRLECS+ NPC GL RHAHFENFGMAFLTLFRIATGDNWNGIMKDTLR+KC +SE+CQ+NCCVS IIAPIYFVIFVLMAQFVLVNVVVAVLMKHLEESHKMMCDD E+E+EVQR++DEE KE+ RE     ++E EN  N  I    IE + NN   E K+         N +  K      S D   S      N S   +H++N+ +     + LS+S P L VN +  S     Q +N N
Sbjct:  269 QNSSRINNVEDQDDEDIEAMVCLSKCCPQPKGIFAKRYYHSMYIFSVDNQFRQKCQYFVDKKWFDYLVLFFITLNCITLAMERPSIPPQSKERLFLSVTNYIFTIIFTGEMIVKVLSKGLLIGDQAYLKSGWNIMDGFLVFISLLDLFITISLGHSNRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGKFYYCDGPHLLNVTTKNDCIAHERNEWKNQKYNFDNLGQALMALFVLSSKDGWVQIMYTGIDAVSVDVQPQENHNEWALIYFISFLLLVAFFVLNMFVGVVVENFHKCQENQEKEEKARRAAKRARRLEKKRKHLRAPLYWENYSKWRRTINAVVTSKYFDLAIAGVIGLNVITMATEFHMMPHVLKTALKVFNYFFTTTFVLEAILKLVALGLTRYISDKWNQLDMIIVILSIAGVVVDEVENNFMPINPTIMRVMRVLRIARVLKLLKMASGIRALLDTVIQALPQVGNLGLLFFLLFYIFAALGVELFGRLECSELNPCVGLGRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRDKCTSSEDCQRNCCVSAIIAPIYFVIFVLMAQFVLVNVVVAVLMKHLEESHKMMCDDYELEREVQRDLDEEAKEQARE---KQLKEEENNENLLIN---IEKDKNNNCVEKKE---------NESVKKPQMKKLSCDDCYSINEKLKNISCQNVHLINICS-----KNLSKSHPHLFVNFDSSSFTRNIQTNNIN 1024          

HSP 2 Score: 84.7297 bits (208), Expect = 3.261e-12
Identity = 61/209 (29.19%), Postives = 109/209 (52.15%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG--------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVL 3121
            ++R+ + ++V  +YF   I   I +N ++M  E+H  P +L   L+  N  F   F++E +LK++A GL  YIS+ +N  D  IVIL +  +  +           + + V+R  R+ R+LKL++    +R  L  +++ +  V     L  L  +IF+ LG+ LFG   C   N      R  +F++   A +T+F+I T ++WN ++
Sbjct:  636 KWRRTINAVVTSKYFDLAIAGVIGLNVITMATEFHMMPHVLKTALKVFNYFFTTTFVLEAILKLVALGLTRYISDKWNQLDMIIVILSIAGVVVDEVENNFMPINPTIMRVMRVLRIARVLKLLKMASGIRALLDTVIQALPQVGNLGLLFFLLFYIFAALGVELFGRLECSELNPCVGLGRHAHFENFGMAFLTLFRIATGDNWNGIM 844          

HSP 3 Score: 73.559 bits (179), Expect = 7.221e-9
Identity = 66/282 (23.40%), Postives = 130/282 (46.10%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTL--EYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVEL--AQEGGASGLSVLRTFRLLRIL---------KLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL-----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGF 3235
            +FR+K +  V  ++F   +L  I +N +++ +E  + P      L    +N IF  +F  EM++K+L++GLL     Y+ +G+N+ DG +V + L++L      G S     R F +LR+          +++   P L+L +  +L ++  +     +   F  IF ILG+ L                         +  + K  + NFD+L  A++ +F + +++ W  ++ +G+   S           WA +YF++ +    + + N+ V ++VE F
Sbjct:  318 QFRQKCQYFVDKKWFDYLVLFFITLNCITLAMERPSIPPQSKERLFLSVTNYIFTIIFTGEMIVKVLSKGLLIGDQAYLKSGWNIMDGFLVFISLLDLFITISLGHSN----RIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGKFYYCDGPHLLNVTTKNDCIAHERNEWKNQKYNFDNLGQALMALFVLSSKDGWVQIMYTGIDAVSVDVQPQENHNEWALIYFISFLLLVAFFVLNMFVGVVVENF 595          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. TrEMBL
Match: W5KSK6 (Calcium channel, voltage-dependent, T type, alpha 1H subunit a OS=Astyanax mexicanus OX=7994 PE=4 SV=2)

HSP 1 Score: 845.884 bits (2184), Expect = 0.000e+0
Identity = 636/1258 (50.56%), Postives = 802/1258 (63.75%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXX-DRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDREIFHQEMDSLSRKSQLMSNTDGESLGVPLVLQHDQRNLSRRGSDSSINHQPVGQQCRKTNCSPTR--LHPNLTIPSSRTDGLSVIPAESNYSTASTFRSRSPSLQLYGLPITLNKFNSNSGQ---IIQHSGVLVRRSSI---GQNSNCSALSNQNTAGSL---TLSEKGDEIYSKCPTPNTEHNNKDTDAEXXXXXXXXXXXXXXXXXXXXXXIHNSQPSLKTSMFLPMVFIDSSFVSKLPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNYF---WCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSEC--NNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHK------MMCDDDEIEKEVQREIDEENKEKLRENITS 6226
            FR +MK IV  +YF RGI+IAILINTLSMGIE+H QP  LT+ LE SN++F  +F++EM+ K++A G+ GYI N +N+FDG IV++ + E+  +    GLSVLRTFRLLR+LKLVRF+PALR QL+V++K+MDNVATF  LL+LFIF FSILGM LFGCKFC          DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ +S  A+LYFVALMTFGNYVLFNLLVAILV         EA  AE       ++E+  ++   E  K  E           ++S N ++    +G+L      PII  T AT  P P                           T   SLG   V    +   SRRGS  SI+  P G   R  + SP R   HP       R+ G +     S++++ S    R+PSL          K    SG+   ++   G    R S      + N S  +   + GSL   +  E  D     C  P+ E+++ +  A                                  M LP         + LP+ L    E  A+E      +D DD      + + N +   WC       + H   SL++ SP+N+FR  C  ++  ++FD++VL FI LNCIT+A+ERP+I   S ER FL+I+NYVFTVIF  EMT+KV+A G     +SYL+S WN++DG+LV +SL DI++ L     +RI GILRV RLLRTLRPLRVISRAPGLKLVV+TL++SLRPIGNIV+IC  FFIIFGI GVQLFKGKFY+C G D  ++ N S+C   N K   W  ++YNFDNLGQALMSLFVLS KDGWV IMY GLDAVGV+QQP  N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE+EE   R  KR R+ EK+++K  + PY+ +Y   RL IH L ++ Y DL I  II +NV+TM++E Y  P  LE ALK  NY+FT  FI+EA++K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE+K N  +PIN TIIR+ RVLRIARVLKLLKMAKG+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG+L+C    PC GLSRHA FENFGMAFLTLFR++TGDNWNGIMKDTLR +C  ++ C       P+++P+YFV FVLMAQFVLVNVVVAVLMKHLEES+K       M  D E++KE+Q   ++E ++  +EN  S
Sbjct:  647 FRDRMKRIVDSKYFNRGIMIAILINTLSMGIEHHEQPKELTDILEISNIVFTSMFVLEMIFKLVAFGIYGYIKNPYNIFDGIIVVISVWEIIGQADG-GLSVLRTFRLLRVLKLVRFLPALRRQLVVLMKSMDNVATFCMLLMLFIFTFSILGMHLFGCKFCLKTENGDTIPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASSSPLASLYFVALMTFGNYVLFNLLVAILV---------EAFQAEGDANRSDSDEEKRSVDFEEEEKMGELRARELKMYSLMMSANGHVE--SRGNLPP----PIIMRTAAT--PMP---------------------------TPKSSLGPESVFGLGE---SRRGSGVSID--PNGYDQRSLS-SPRRSPCHP-------RSTGSNWGSRRSSWNSLS----RAPSL----------KRKDTSGERESLLSGEG----RGSFEDDDTDENLSGRAGSTSGGSLQHPSSLEFPDLAPGPCLYPSEEYHDCNGRA----------------------------------MQLP---------TDLPAELN--REDSANE------EDLDDSFCCRLRRMLNAYKPQWC-------KDHEDWSLYMFSPENKFRVICNRIISHRLFDHVVLVFIFLNCITIALERPNIKPHSTERVFLSISNYVFTVIFLAEMTVKVVALGF----YSYLQSTWNILDGMLVFVSLIDILVSLASSGGNRILGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVVICWAFFIIFGILGVQLFKGKFYHCEGLDTRNITNKSDCLLANYK---WVPRKYNFDNLGQALMSLFVLSCKDGWVNIMYDGLDAVGVDQQPVRNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQEEEEARLREEKRRRQQEKRRRKAQKIPYYAYYSPIRLYIHTLCSNHYLDLFITFIICINVVTMSIEHYDQPQYLEEALKYCNYVFTIFFILEAILKLVAFGIRRFFKDRWNQLDLAIVLLSIMGITLEEIKMNAALPINPTIIRIMRVLRIARVLKLLKMAKGMRALLDTVMQALPQVGNLGLLFMLLFFIYAALGVELFGKLDCIK-QPCEGLSRHATFENFGMAFLTLFRVSTGDNWNGIMKDTLR-ECIPADNCLSYL---PLVSPLYFVTFVLMAQFVLVNVVVAVLMKHLEESNKEAKEEAEMDSDTEMDKEIQ---NDEERQGTQENFLS 1755          

HSP 2 Score: 363.614 bits (932), Expect = 1.704e-97
Identity = 211/379 (55.67%), Postives = 272/379 (71.77%), Query Frame = 2
Query:  635 VIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERF 1768
            VI++NC+TLGMY+PCED +C++  C IL  FD CIF FFAVE++IK+ A+G+ GP+ Y  ++WNRLD  IV+AG++E        SL+AIRTVRVLRPL+AINR+PSM+ILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC++  N +  +  L++S YY       +      FICS +  NG+ +C ++PP    + +G     N S    + + P   SCVNWNQYY++C     NP+ GA+NFDNIG+AW+AIFQVI++E WVDIMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+R  + M  +R   QS  STL S  EP SCY E+++ IS    HL + V +R  R 
Sbjct:    3 VILLNCVTLGMYQPCEDVACQSEWCIILRAFDDCIFAFFAVEMVIKMMALGIFGPACYLGDTWNRLDFFIVMAGMLEYSLDGHNASLSAIRTVRVLRPLKAINRVPSMKILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFMKENFTDIY-NLSMSQYYM-----DEDGEDNPFICSSEKENGMRRCRNVPP---LMENGFNCTLNASFSHYTYSDPN--SCVNWNQYYNQCRPGDLNPHKGAVNFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRVNKLMKDQRVCYQSNDSTLASYSEPGSCYEEMLRYIS----HLYRKVKRRTSRL 366          

HSP 3 Score: 84.7297 bits (208), Expect = 4.176e-12
Identity = 82/340 (24.12%), Postives = 163/340 (47.94%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQT-SSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIE-PQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDRE 3514
            R  + ++ ++ Y    I   I IN ++M IE+++QP  L   L+Y N +F   F++E +LK++A G+  +  + +N  D  IV+L ++ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C  +  +       F++   A +T+F++ T ++WN ++   + +   +   L ++ L++   +V F     +L+  F    V  A L +  HLE+ N+E      K EA  + +T  +  I+  +E     +N    RK S+++   +P  ++      P+    P  + E
Sbjct: 1463 RLYIHTLCSNHYLDLFITFIICINVVTMSIEHYDQPQYLEEALKYCNYVFTIFFILEAILKLVAFGIRRFFKDRWNQLDLAIVLLSIMGITLEEIKMNAALPINPTIIRIMRVLRIARVLKLLKMAKGMRALLDTVMQALPQVGNLGLLFMLLFFIYAALGVELFGKLDCIKQPCEGLSRHATFENFGMAFLTLFRVSTGDNWNGIMKDTLRECIPADNCLSYLPLVSPLYFVTF-----VLMAQFVLVNVVVAVLMK--HLEESNKEA-----KEEAEMDSDTEMDKEIQNDEERQGTQENFLSPRKMSVSRMHSLPNDSYMFRPVRPASAPYPLQELE 1790          

HSP 4 Score: 78.1814 bits (191), Expect = 3.341e-10
Identity = 89/317 (28.08%), Postives = 165/317 (52.05%), Query Frame = 2
Query: 5327 KFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLE-ESHKMMCDDDEIEKEVQREIDEENKE------KLRENITSDVEEIENRGN 6256
            +++  +R  +  +V+SKYF+  I   I +N ++M +E +  P EL   L+  N +FTS+F++E + K +A+G   YI + +N  D +IV++SV  I+ +          ++++R FR+L   RVLKL++    +R  L  +++++  V    +L  L  F F+ LG+ LFG   C        +    +F++   A +T+F+I T ++WN ++ + + +              SP +A +YFV  +    +VL N++VA+L++  + E      D DE ++ V  E +E+  E      K+   + S    +E+RGN
Sbjct:  642 RYWEDFRDRMKRIVDSKYFNRGIMIAILINTLSMGIEHHEQPKELTDILEISNIVFTSMFVLEMIFKLVAFGIYGYIKNPYNIFDGIIVVISVWEIIGQADG------GLSVLRTFRLL---RVLKLVRFLPALRRQLVVLMKSMDNVATFCMLLMLFIFTFSILGMHLFGCKFCLKTENGDTIPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASS-------------SP-LASLYFVALMTFGNYVLFNLLVAILVEAFQAEGDANRSDSDEEKRSVDFEEEEKMGELRARELKMYSLMMSANGHVESRGN 935          

HSP 5 Score: 73.9442 bits (180), Expect = 6.235e-9
Identity = 58/156 (37.18%), Postives = 88/156 (56.41%), Query Frame = 2
Query: 4442 LFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            +  I LNC+TL M +P   +  +S     L   +      FAVEM IK++A G+  G   YL   WN +D  +V   +A ++   + GH++ +  I    R +R LRPL+ I+R P +K++V  LL +L  +GN++L+C   F IFGI GVQL+ G
Sbjct:    1 MLVILLNCVTLGMYQPCEDVACQSEWCIILRAFDDCIFAFFAVEMVIKMMALGIF-GPACYLGDTWNRLDFFIV---MAGMLEYSLDGHNASLSAI----RTVRVLRPLKAINRVPSMKILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAG 148          

HSP 6 Score: 70.8626 bits (172), Expect = 5.458e-8
Identity = 73/280 (26.07%), Postives = 130/280 (46.43%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNT--LEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVE----LAQEGG---ASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL---------------XXXXXXXXXXXXXXXDRK-NFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDE 3256
            +FR     I++HR F   +L+ I +N +++ +E  N     T    L  SN +F  +FL EM +K++A G   Y+ + +N+ DG +V + L++    LA  GG      L VLR  R LR L+++   P L+L +  ++ ++  +     +   F  IF ILG+ L                  K        +   RK NFD+L  A++++F +  ++ W  ++  G+               W  LYF++ +   ++ + N+ V ++VE F   R D+
Sbjct: 1148 KFRVICNRIISHRLFDHVVLVFIFLNCITIALERPNIKPHSTERVFLSISNYVFTVIFLAEMTVKVVALGFYSYLQSTWNILDGMLVFVSLIDILVSLASSGGNRILGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVVICWAFFIIFGILGVQLFKGKFYHCEGLDTRNITNKSDCLLANYKWVPRKYNFDNLGQALMSLFVLSCKDGWVNIMYDGLDAVGVDQQPVRNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQ 1427          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. TrEMBL
Match: A0A1I8J567 (CCHC-type domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 810.061 bits (2091), Expect = 0.000e+0
Identity = 482/601 (80.20%), Postives = 533/601 (88.69%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEI 6160
            +L++L P+NRFR  CQ ++ KK FD  VLFFIALNCITLAMERPSIP  S ER+FL+I+N +FT+IFA+EM +KV+AKGL++G H+YLRSGWNVMDG LV +SL D  + L++G SSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGI GVQLFKGKFYYC GPDV +V N ++C  DKRN WK  +YNFDNLGQALM+LFVLS+KDGWVQIMYTGLDAVG + QPQENYNE+ L+YFISFLLLVGFFVLNMFVGVVVENFHKCR +QEKEEKARRAAKRARR+EKK+K++ + PYW  Y  WR  IH  V+SKYFDL IA IIGLNVITMAMEFY+MP EL+ ALK+ NYIFTSVFIIEA+ K +A G KRY  DRWNQLDVLIV+LSVSGIV+EEM+ K IPIN TIIRV RVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNLGLLFFLLFFIFAALGVELFGRLECS  NPC GL+RHAHFENFGMAFLTLFRIATGDNWNGIMKDTLR KCD S++C KNCCVS +IAPIYFV+FVLMAQFVLVNVVVAVLMKHLEESHKMM DDDE+
Sbjct: 1401 ALYLLHPENRFRVLCQTMISKKCFDYTVLFFIALNCITLAMERPSIPPDSIERQFLSISNNIFTLIFAIEMLVKVLAKGLIIGDHTYLRSGWNVMDGSLVAVSLTDAFVTLLMGSSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGKFYYCEGPDVKNVVNKTDCLADKRNDWKKHKYNFDNLGQALMALFVLSTKDGWVQIMYTGLDAVGEDMQPQENYNEFLLVYFISFLLLVGFFVLNMFVGVVVENFHKCRASQEKEEKARRAAKRARRMEKKRKRIREIPYWAGYSRWRHTIHSFVDSKYFDLVIATIIGLNVITMAMEFYLMPKELDYALKTANYIFTSVFIIEAVCKVVALGAKRYFKDRWNQLDVLIVVLSVSGIVLEEMEAKIIPINPTIIRVMRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSLDNPCVGLNRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRKKCDASDQCVKNCCVSHVIAPIYFVVFVLMAQFVLVNVVVAVLMKHLEESHKMMSDDDEL 2001          

HSP 2 Score: 515.383 bits (1326), Expect = 1.800e-143
Identity = 259/375 (69.07%), Postives = 304/375 (81.07%), Query Frame = 2
Query:  611 WFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQSTSTLGSSIEPQSCYHEIIKLISRFCRHL 1735
            WFE++S+ VI+ NCITLGMY+PC D  C   RC+ L GFDH +F FFA EL +K+ AMG  G  GY  +SWNRLD  IV+AGL+E +P T ++SLTAIRT+RVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGI+GVQ+W+G+LRNRCYL LN+SY HPG+NL+ +Y++N +   L+  KDFIC+    NG+ +CS I P+V+WL  G    CN SA  NSDN+PTN SCVNWNQYY+ C    +NPY  AINFDNIGFAWVAIFQVIS+ESWVDIMYYVQDAHSFWDW YFVSLI+IGSFFMINLCLVVIATQFSETKKRE E+ML ERK+ QS+STL  S EP SCY +I+KL+ R C+ L
Sbjct:    5 WFERISMLVILANCITLGMYQPCVDEDCAMTRCRALSGFDHAVFAFFAWELCVKVAAMGFWGKLGYLGDSWNRLDGFIVVAGLLEYLPHTKDLSLTAIRTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWKGVLRNRCYLSLNASYLHPGVNLTEFYKLNNSIDNLAGAKDFICAGHESNGMQQCSQINPTVMWLEEGRYITCNRSANINSDNLPTNTSCVNWNQYYTNCNTTVHNPYMNAINFDNIGFAWVAIFQVISLESWVDIMYYVQDAHSFWDWIYFVSLIVIGSFFMINLCLVVIATQFSETKKREVEKMLQERKRFQSSSTLTDSSEPASCYGQIVKLLVRQCKRL 379          

HSP 3 Score: 202.601 bits (514), Expect = 8.063e-48
Identity = 130/202 (64.36%), Postives = 154/202 (76.24%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXX-------------XXXXXXXXXXXXDRKNFDSLLWAIVTVFQ 3088
            R R  +K +V HR+FQRGIL AILINTLSMGIEYH+QP  LT+ +EYSN++F  +F +EM+LK+ AEG L YIS+GFNVFD  IVIL + EL Q G +SGLSVLRTFRLLRILKLVRF+PALR QL VMLKTMDNVATFFALL+LFIFIFS+LGM+LFG                    NG   CDR NFD+++W++VTVFQ
Sbjct:  642 RMRLAVKRLVKHRFFQRGILFAILINTLSMGIEYHDQPKQLTDIIEYSNIVFCVIFGLEMVLKLTAEGPLLYISSGFNVFDAVIVILSIFELMQ-GHSSGLSVLRTFRLLRILKLVRFLPALRQQLFVMLKTMDNVATFFALLVLFIFIFSVLGMTLFGGKFCWHPDGTTCTCAERADPNGDCTCDRANFDTIMWSLVTVFQ 842          

HSP 4 Score: 112.849 bits (281), Expect = 1.175e-20
Identity = 65/161 (40.37%), Postives = 85/161 (52.80%), Query Frame = 2
Query: 3053 DSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHK---------NQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFND 3508
            D  L   +    ILTQEDWN VL +GM++TS WAALYF+ALMTFGNYVLFNLLVAILVEGFS+E+   +        +     +  +     +H+         N    K   + P+E              +     + PIITHT ATP P+P+ SP N+
Sbjct: 1015 DVFLLVFLLAPTILTQEDWNTVLYNGMARTSPWAALYFIALMTFGNYVLFNLLVAILVEGFSSEKAANSARGSINDNDCSESSQSDSDSSTSSHRCQQQHQQQQNFRQAKLKCLPPREA-----------PAAAGSALIPPIITHTAATPQPTPQGSPANE 1164          

HSP 5 Score: 83.1889 bits (204), Expect = 1.331e-11
Identity = 63/162 (38.89%), Postives = 90/162 (55.56%), Query Frame = 2
Query: 4427 FDNIVLFFIALNCITLAMERPSIPQK---SREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            F+ I +  I  NCITL M +P + +    +R R      + VF   FA E+ +KV A G   GK  YL   WN +DG +VV  L + +      H+  +   L   R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+KG
Sbjct:    6 FERISMLVILANCITLGMYQPCVDEDCAMTRCRALSGFDHAVFA-FFAWELCVKVAAMGFW-GKLGYLGDSWNRLDGFIVVAGLLEYL-----PHTKDL--SLTAIRTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWKG 158          

HSP 6 Score: 82.4185 bits (202), Expect = 1.926e-11
Identity = 65/219 (29.68%), Postives = 116/219 (52.97%), Query Frame = 2
Query: 4382 NRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLF 5038
            +R R + + L++ + F   +LF I +N +++ +E    P++  +   +  +N VF VIF +EM +K+ A+G L+    Y+ SG+NV D ++V++S+ ++M     GHSS +  +LR FRLLR L+ +R +   P L+  +  +L ++  +     +   F  IF + G+ LF GKF  C  PD            D        + NFD +  +L+++F
Sbjct:  641 DRMRLAVKRLVKHRFFQRGILFAILINTLSMGIEYHDQPKQLTD--IIEYSNIVFCVIFGLEMVLKLTAEGPLL----YISSGFNVFDAVIVILSIFELM----QGHSSGL-SVLRTFRLLRILKLVRFL---PALRQQLFVMLKTMDNVATFFALLVLFIFIFSVLGMTLFGGKF--CWHPDGTTCTCAERA--DPNGDCTCDRANFDTIMWSLVTVF 841          

HSP 7 Score: 73.9442 bits (180), Expect = 6.848e-9
Identity = 62/209 (29.67%), Postives = 108/209 (51.67%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVIL---GLVELAQEG-----GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVL 3121
            R+R  + S V  +YF   I   I +N ++M +E++  P  L   L+ +N IF  +F++E + K++A G   Y  + +N  D  IV+L   G+V    E        + + V+R  R+ R+LKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG   C   N     +R  +F++   A +T+F+I T ++WN ++
Sbjct: 1728 RWRHTIHSFVDSKYFDLVIATIIGLNVITMAMEFYLMPKELDYALKTANYIFTSVFIIEAVCKVVALGAKRYFKDRWNQLDVLIVVLSVSGIVLEEMEAKIIPINPTIIRVMRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSLDNPCVGLNRHAHFENFGMAFLTLFRIATGDNWNGIM 1936          

HSP 8 Score: 67.781 bits (164), Expect = 6.199e-7
Identity = 71/285 (24.91%), Postives = 133/285 (46.67%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQP--VLLTNTLEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGL----VELAQEGGASGLSVLRTF---RLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXX---------XXXXXXXXXXXDRK--------NFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDE 3256
            RFR   +++++ + F   +L  I +N +++ +E  + P   +    L  SN IF  +F +EML+K+LA+GL+     Y+ +G+NV DG +V + L    V L     +    +LR F   R LR L+++   P L+L +  +L ++  +     +   F  IF ILG+ LF  K                    D++        NFD+L  A++ +F + T++ W  ++ +G+               +  +YF++ +    + + N+ V ++VE F   R  +
Sbjct: 1410 RFRVLCQTMISKKCFDYTVLFFIALNCITLAMERPSIPPDSIERQFLSISNNIFTLIFAIEMLVKVLAKGLIIGDHTYLRSGWNVMDGSLVAVSLTDAFVTLLMGSSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGKFYYCEGPDVKNVVNKTDCLADKRNDWKKHKYNFDNLGQALMALFVLSTKDGWVQIMYTGLDAVGEDMQPQENYNEFLLVYFISFLLLVGFFVLNMFVGVVVENFHKCRASQ 1694          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: cacna1ha (calcium channel, voltage-dependent, T type, alpha 1H subunit a [Source:ZFIN;Acc:ZDB-GENE-130103-1])

HSP 1 Score: 845.884 bits (2184), Expect = 0.000e+0
Identity = 636/1258 (50.56%), Postives = 802/1258 (63.75%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXX-DRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDREIFHQEMDSLSRKSQLMSNTDGESLGVPLVLQHDQRNLSRRGSDSSINHQPVGQQCRKTNCSPTR--LHPNLTIPSSRTDGLSVIPAESNYSTASTFRSRSPSLQLYGLPITLNKFNSNSGQ---IIQHSGVLVRRSSI---GQNSNCSALSNQNTAGSL---TLSEKGDEIYSKCPTPNTEHNNKDTDAEXXXXXXXXXXXXXXXXXXXXXXIHNSQPSLKTSMFLPMVFIDSSFVSKLPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNYF---WCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSEC--NNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHK------MMCDDDEIEKEVQREIDEENKEKLRENITS 6226
            FR +MK IV  +YF RGI+IAILINTLSMGIE+H QP  LT+ LE SN++F  +F++EM+ K++A G+ GYI N +N+FDG IV++ + E+  +    GLSVLRTFRLLR+LKLVRF+PALR QL+V++K+MDNVATF  LL+LFIF FSILGM LFGCKFC          DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ +S  A+LYFVALMTFGNYVLFNLLVAILV         EA  AE       ++E+  ++   E  K  E           ++S N ++    +G+L      PII  T AT  P P                           T   SLG   V    +   SRRGS  SI+  P G   R  + SP R   HP       R+ G +     S++++ S    R+PSL          K    SG+   ++   G    R S      + N S  +   + GSL   +  E  D     C  P+ E+++ +  A                                  M LP         + LP+ L    E  A+E      +D DD      + + N +   WC       + H   SL++ SP+N+FR  C  ++  ++FD++VL FI LNCIT+A+ERP+I   S ER FL+I+NYVFTVIF  EMT+KV+A G     +SYL+S WN++DG+LV +SL DI++ L     +RI GILRV RLLRTLRPLRVISRAPGLKLVV+TL++SLRPIGNIV+IC  FFIIFGI GVQLFKGKFY+C G D  ++ N S+C   N K   W  ++YNFDNLGQALMSLFVLS KDGWV IMY GLDAVGV+QQP  N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE+EE   R  KR R+ EK+++K  + PY+ +Y   RL IH L ++ Y DL I  II +NV+TM++E Y  P  LE ALK  NY+FT  FI+EA++K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE+K N  +PIN TIIR+ RVLRIARVLKLLKMAKG+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG+L+C    PC GLSRHA FENFGMAFLTLFR++TGDNWNGIMKDTLR +C  ++ C       P+++P+YFV FVLMAQFVLVNVVVAVLMKHLEES+K       M  D E++KE+Q   ++E ++  +EN  S
Sbjct:  647 FRDRMKRIVDSKYFNRGIMIAILINTLSMGIEHHEQPKELTDILEISNIVFTSMFVLEMIFKLVAFGIYGYIKNPYNIFDGIIVVISVWEIIGQADG-GLSVLRTFRLLRVLKLVRFLPALRRQLVVLMKSMDNVATFCMLLMLFIFTFSILGMHLFGCKFCLKTENGDTIPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASSSPLASLYFVALMTFGNYVLFNLLVAILV---------EAFQAEGDANRSDSDEEKRSVDFEEEEKMGELRARELKMYSLMMSANGHVE--SRGNLPP----PIIMRTAAT--PMP---------------------------TPKSSLGPESVFGLGE---SRRGSGVSID--PNGYDQRSLS-SPRRSPCHP-------RSTGSNWGSRRSSWNSLS----RAPSL----------KRKDTSGERESLLSGEG----RGSFEDDDTDENLSGRAGSTSGGSLQHPSSLEFPDLAPGPCLYPSEEYHDCNGRA----------------------------------MQLP---------TDLPAELN--REDSANE------EDLDDSFCCRLRRMLNAYKPQWC-------KDHEDWSLYMFSPENKFRVICNRIISHRLFDHVVLVFIFLNCITIALERPNIKPHSTERVFLSISNYVFTVIFLAEMTVKVVALGF----YSYLQSTWNILDGMLVFVSLIDILVSLASSGGNRILGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVVICWAFFIIFGILGVQLFKGKFYHCEGLDTRNITNKSDCLLANYK---WVPRKYNFDNLGQALMSLFVLSCKDGWVNIMYDGLDAVGVDQQPVRNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQEEEEARLREEKRRRQQEKRRRKAQKIPYYAYYSPIRLYIHTLCSNHYLDLFITFIICINVVTMSIEHYDQPQYLEEALKYCNYVFTIFFILEAILKLVAFGIRRFFKDRWNQLDLAIVLLSIMGITLEEIKMNAALPINPTIIRIMRVLRIARVLKLLKMAKGMRALLDTVMQALPQVGNLGLLFMLLFFIYAALGVELFGKLDCIK-QPCEGLSRHATFENFGMAFLTLFRVSTGDNWNGIMKDTLR-ECIPADNCLSYL---PLVSPLYFVTFVLMAQFVLVNVVVAVLMKHLEESNKEAKEEAEMDSDTEMDKEIQ---NDEERQGTQENFLS 1755          

HSP 2 Score: 363.614 bits (932), Expect = 6.456e-101
Identity = 211/379 (55.67%), Postives = 272/379 (71.77%), Query Frame = 2
Query:  635 VIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERF 1768
            VI++NC+TLGMY+PCED +C++  C IL  FD CIF FFAVE++IK+ A+G+ GP+ Y  ++WNRLD  IV+AG++E        SL+AIRTVRVLRPL+AINR+PSM+ILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC++  N +  +  L++S YY       +      FICS +  NG+ +C ++PP    + +G     N S    + + P   SCVNWNQYY++C     NP+ GA+NFDNIG+AW+AIFQVI++E WVDIMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+R  + M  +R   QS  STL S  EP SCY E+++ IS    HL + V +R  R 
Sbjct:    3 VILLNCVTLGMYQPCEDVACQSEWCIILRAFDDCIFAFFAVEMVIKMMALGIFGPACYLGDTWNRLDFFIVMAGMLEYSLDGHNASLSAIRTVRVLRPLKAINRVPSMKILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFMKENFTDIY-NLSMSQYYM-----DEDGEDNPFICSSEKENGMRRCRNVPP---LMENGFNCTLNASFSHYTYSDPN--SCVNWNQYYNQCRPGDLNPHKGAVNFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRVNKLMKDQRVCYQSNDSTLASYSEPGSCYEEMLRYIS----HLYRKVKRRTSRL 366          

HSP 3 Score: 84.7297 bits (208), Expect = 1.582e-15
Identity = 82/340 (24.12%), Postives = 163/340 (47.94%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQT-SSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIE-PQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDRE 3514
            R  + ++ ++ Y    I   I IN ++M IE+++QP  L   L+Y N +F   F++E +LK++A G+  +  + +N  D  IV+L ++ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C  +  +       F++   A +T+F++ T ++WN ++   + +   +   L ++ L++   +V F     +L+  F    V  A L +  HLE+ N+E      K EA  + +T  +  I+  +E     +N    RK S+++   +P  ++      P+    P  + E
Sbjct: 1463 RLYIHTLCSNHYLDLFITFIICINVVTMSIEHYDQPQYLEEALKYCNYVFTIFFILEAILKLVAFGIRRFFKDRWNQLDLAIVLLSIMGITLEEIKMNAALPINPTIIRIMRVLRIARVLKLLKMAKGMRALLDTVMQALPQVGNLGLLFMLLFFIYAALGVELFGKLDCIKQPCEGLSRHATFENFGMAFLTLFRVSTGDNWNGIMKDTLRECIPADNCLSYLPLVSPLYFVTF-----VLMAQFVLVNVVVAVLMK--HLEESNKEA-----KEEAEMDSDTEMDKEIQNDEERQGTQENFLSPRKMSVSRMHSLPNDSYMFRPVRPASAPYPLQELE 1790          

HSP 4 Score: 78.1814 bits (191), Expect = 1.265e-13
Identity = 89/317 (28.08%), Postives = 165/317 (52.05%), Query Frame = 2
Query: 5327 KFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLE-ESHKMMCDDDEIEKEVQREIDEENKE------KLRENITSDVEEIENRGN 6256
            +++  +R  +  +V+SKYF+  I   I +N ++M +E +  P EL   L+  N +FTS+F++E + K +A+G   YI + +N  D +IV++SV  I+ +          ++++R FR+L   RVLKL++    +R  L  +++++  V    +L  L  F F+ LG+ LFG   C        +    +F++   A +T+F+I T ++WN ++ + + +              SP +A +YFV  +    +VL N++VA+L++  + E      D DE ++ V  E +E+  E      K+   + S    +E+RGN
Sbjct:  642 RYWEDFRDRMKRIVDSKYFNRGIMIAILINTLSMGIEHHEQPKELTDILEISNIVFTSMFVLEMIFKLVAFGIYGYIKNPYNIFDGIIVVISVWEIIGQADG------GLSVLRTFRLL---RVLKLVRFLPALRRQLVVLMKSMDNVATFCMLLMLFIFTFSILGMHLFGCKFCLKTENGDTIPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASS-------------SP-LASLYFVALMTFGNYVLFNLLVAILVEAFQAEGDANRSDSDEEKRSVDFEEEEKMGELRARELKMYSLMMSANGHVESRGN 935          

HSP 5 Score: 73.9442 bits (180), Expect = 2.362e-12
Identity = 58/156 (37.18%), Postives = 88/156 (56.41%), Query Frame = 2
Query: 4442 LFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            +  I LNC+TL M +P   +  +S     L   +      FAVEM IK++A G+  G   YL   WN +D  +V   +A ++   + GH++ +  I    R +R LRPL+ I+R P +K++V  LL +L  +GN++L+C   F IFGI GVQL+ G
Sbjct:    1 MLVILLNCVTLGMYQPCEDVACQSEWCIILRAFDDCIFAFFAVEMVIKMMALGIF-GPACYLGDTWNRLDFFIV---MAGMLEYSLDGHNASLSAI----RTVRVLRPLKAINRVPSMKILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAG 148          

HSP 6 Score: 70.8626 bits (172), Expect = 2.067e-11
Identity = 73/280 (26.07%), Postives = 130/280 (46.43%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNT--LEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVE----LAQEGG---ASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL---------------XXXXXXXXXXXXXXXDRK-NFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDE 3256
            +FR     I++HR F   +L+ I +N +++ +E  N     T    L  SN +F  +FL EM +K++A G   Y+ + +N+ DG +V + L++    LA  GG      L VLR  R LR L+++   P L+L +  ++ ++  +     +   F  IF ILG+ L                  K        +   RK NFD+L  A++++F +  ++ W  ++  G+               W  LYF++ +   ++ + N+ V ++VE F   R D+
Sbjct: 1148 KFRVICNRIISHRLFDHVVLVFIFLNCITIALERPNIKPHSTERVFLSISNYVFTVIFLAEMTVKVVALGFYSYLQSTWNILDGMLVFVSLIDILVSLASSGGNRILGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVVICWAFFIIFGILGVQLFKGKFYHCEGLDTRNITNKSDCLLANYKWVPRKYNFDNLGQALMSLFVLSCKDGWVNIMYDGLDAVGVDQQPVRNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQ 1427          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: cacna1ha (calcium channel, voltage-dependent, T type, alpha 1H subunit a [Source:ZFIN;Acc:ZDB-GENE-130103-1])

HSP 1 Score: 600.127 bits (1546), Expect = 5.644e-176
Identity = 408/710 (57.46%), Postives = 514/710 (72.39%), Query Frame = 2
Query: 4193 KLPSNLT--MGNEKCADEDSSLLNQDQDDHNENEEKILCNYFWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSEC--NNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ-------XXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRGNKEIKEQIIEP 6286
            +LP++L   +  E  A+E      +D DD      + + N +   W     + H   SL++ SP+N+FR  C  ++  ++FD++VL FI LNCIT+A+ERP+I   S ER FL+I+NYVFTVIF  EMT+KV+A G     +SYL+S WN++DG+LV +SL DI++ L     +RI GILRV RLLRTLRPLRVISRAPGLKLVV+TL++SLRPIGNIV+IC  FFIIFGI GVQLFKGKFY+C G D  ++ N S+C   N K   W  ++YNFDNLGQALMSLFVLS KDGWV IMY GLDAVGV+QQP  N+N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++Q        +E++ R+  KR R  E    +  + PY+ +Y   RL IH L ++ Y DL I  II +NV+TM++E Y  P  LE ALK  NY+FT  FI+EA++K +A+G +R+  DRWNQLD+ IV+LS+ GI +EE+K N  +PIN TIIR+ RVLRIARVLKLLKMAKG+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG+L+C    PC GLSRHA FENFGMAFLTLFR++TGDNWNGIMKDTLR +C  ++ C       P+++P+YFV FVLMAQFVLVNVVVAVLMKHLEES+K      E ++E + + D E  +++ +N T D    E+ G  E +E  + P
Sbjct: 1080 QLPTDLPAELNREDSANE------EDLDDSFCCRLRRMLNAYKPQWC----KDHEDWSLYMFSPENKFRVICNRIISHRLFDHVVLVFIFLNCITIALERPNIKPHSTERVFLSISNYVFTVIFLAEMTVKVVALGF----YSYLQSTWNILDGMLVFVSLIDILVSLASSGGNRILGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVVICWAFFIIFGILGVQLFKGKFYHCEGLDTRNITNKSDCLLANYK---WVPRKYNFDNLGQALMSLFVLSCKDGWVNIMYDGLDAVGVDQQPVRNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQEEEEARLREEKRRRQQEKRRRSKENYGSEAQKIPYYAYYSPIRLYIHTLCSNHYLDLFITFIICINVVTMSIEHYDQPQYLEEALKYCNYVFTIFFILEAILKLVAFGIRRFFKDRWNQLDLAIVLLSIMGITLEEIKMNAALPINPTIIRIMRVLRIARVLKLLKMAKGMRALLDTVMQALPQVGNLGLLFMLLFFIYAALGVELFGKLDCIK-QPCEGLSRHATFENFGMAFLTLFRVSTGDNWNGIMKDTLR-ECIPADNCLSYL---PLVSPLYFVTFVLMAQFVLVNVVVAVLMKHLEESNK------EAKEEAEMDSDTEMDKEI-QNATDDSG--ESSGGPEERETYVGP 1758          

HSP 2 Score: 363.999 bits (933), Expect = 1.201e-100
Identity = 211/379 (55.67%), Postives = 272/379 (71.77%), Query Frame = 2
Query:  635 VIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERF 1768
            VI++NC+TLGMY+PCED +C++  C IL  FD CIF FFAVE++IK+ A+G+ GP+ Y  ++WNRLD  IV+AG++E        SL+AIRTVRVLRPL+AINR+PSM+ILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC++  N +  +  L++S YY       +      FICS +  NG+ +C ++PP    + +G     N S    + + P   SCVNWNQYY++C     NP+ GA+NFDNIG+AW+AIFQVI++E WVDIMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+R  + M  +R   QS  STL S  EP SCY E+++ IS    HL + V +R  R 
Sbjct:    3 VILLNCVTLGMYQPCEDVACQSEWCIILRAFDDCIFAFFAVEMVIKMMALGIFGPACYLGDTWNRLDFFIVMAGMLEYSLDGHNASLSAIRTVRVLRPLKAINRVPSMKILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFMKENFTDIY-NLSMSQYYM-----DEDGEDNPFICSSEKENGMRRCRNVPP---LMENGFNCTLNASFSHYTYSDPN--SCVNWNQYYNQCRPGDLNPHKGAVNFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRVNKLMKDQRVCYQSNDSTLASYSEPGSCYEEMLRYIS----HLYRKVKRRTSRL 366          

HSP 3 Score: 294.278 bits (752), Expect = 2.743e-79
Identity = 189/329 (57.45%), Postives = 235/329 (71.43%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXX-XXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTE----RVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRAS 3496
            FR +MK IV  +YF RGI+IAILINTLSMGIE+H QP  LT+ LE SN++F  +F++EM+ K++A G+ GYI N +N+FDG IV++ + E+  +    GLSVLRTFRLLR+LKLVRF+PALR QL+V++K+MDNVATF  LL+LFIF FSILGM LFGCKF  K +NG    DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ +S  A+LYFVALMTFGNYVLFNLLVAILVE F  E    R D  +  EK  ++   EEKM  L   E        K  S+    ++S N ++    +G+L      PII  T ATPMP+P++S
Sbjct:  635 FRDRMKRIVDSKYFNRGIMIAILINTLSMGIEHHEQPKELTDILEISNIVFTSMFVLEMIFKLVAFGIYGYIKNPYNIFDGIIVVISVWEIIGQADG-GLSVLRTFRLLRVLKLVRFLPALRRQLVVLMKSMDNVATFCMLLMLFIFTFSILGMHLFGCKFCLKTENGDTIPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASSSPLASLYFVALMTFGNYVLFNLLVAILVEAFQAEGDANRSDSDE--EKRSVDFEEEEKMGELRARE-------LKMYSL----MMSANGHVE--SRGNLPP----PIIMRTAATPMPTPKSS 943          

HSP 4 Score: 99.3673 bits (246), Expect = 5.694e-20
Identity = 71/278 (25.54%), Postives = 140/278 (50.36%), Query Frame = 2
Query: 4388 FRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            FR+  + +++ K F+  ++  I +N +++ +E    P++  +   L I+N VFT +F +EM  K++A G+    + Y+++ +N+ DG++VVIS+ +     IIG +     +LR FRLLR L+ +R +   P L+  +  L+ S+  +    ++   F   F I G+ LF  KF                C   +       + NFD+L  A++++F + +++ W  ++Y G+     +  P  +      LYF++ +    + + N+ V ++VE F 
Sbjct:  635 FRDRMKRIVDSKYFNRGIMIAILINTLSMGIEHHEQPKELTD--ILEISNIVFTSMFVLEMIFKLVAFGI----YGYIKNPYNIFDGIIVVISVWE-----IIGQADGGLSVLRTFRLLRVLKLVRFL---PALRRQLVVLMKSMDNVATFCMLLMLFIFTFSILGMHLFGCKF----------------CLKTENGDTIPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGM----ASSSPLAS------LYFVALMTFGNYVLFNLLVAILVEAFQ 872          

HSP 5 Score: 81.6481 bits (200), Expect = 1.153e-14
Identity = 73/291 (25.09%), Postives = 144/291 (49.48%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQT-SSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIE 3370
            R  + ++ ++ Y    I   I IN ++M IE+++QP  L   L+Y N +F   F++E +LK++A G+  +  + +N  D  IV+L ++ +  E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C  +  +       F++   A +T+F++ T ++WN ++   + +   +   L ++ L++   +V F     +L+  F    V  A L +  HLE+ N+E      K EA  + +T  +  I+
Sbjct: 1458 RLYIHTLCSNHYLDLFITFIICINVVTMSIEHYDQPQYLEEALKYCNYVFTIFFILEAILKLVAFGIRRFFKDRWNQLDLAIVLLSIMGITLEEIKMNAALPINPTIIRIMRVLRIARVLKLLKMAKGMRALLDTVMQALPQVGNLGLLFMLLFFIYAALGVELFGKLDCIKQPCEGLSRHATFENFGMAFLTLFRVSTGDNWNGIMKDTLRECIPADNCLSYLPLVSPLYFVTF-----VLMAQFVLVNVVVAVLMK--HLEESNKEA-----KEEAEMDSDTEMDKEIQ 1736          

HSP 6 Score: 77.7962 bits (190), Expect = 1.798e-13
Identity = 89/317 (28.08%), Postives = 165/317 (52.05%), Query Frame = 2
Query: 5327 KFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLE-ESHKMMCDDDEIEKEVQREIDEENKE------KLRENITSDVEEIENRGN 6256
            +++  +R  +  +V+SKYF+  I   I +N ++M +E +  P EL   L+  N +FTS+F++E + K +A+G   YI + +N  D +IV++SV  I+ +          ++++R FR+L   RVLKL++    +R  L  +++++  V    +L  L  F F+ LG+ LFG   C        +    +F++   A +T+F+I T ++WN ++ + + +              SP +A +YFV  +    +VL N++VA+L++  + E      D DE ++ V  E +E+  E      K+   + S    +E+RGN
Sbjct:  630 RYWEDFRDRMKRIVDSKYFNRGIMIAILINTLSMGIEHHEQPKELTDILEISNIVFTSMFVLEMIFKLVAFGIYGYIKNPYNIFDGIIVVISVWEIIGQADG------GLSVLRTFRLL---RVLKLVRFLPALRRQLVVLMKSMDNVATFCMLLMLFIFTFSILGMHLFGCKFCLKTENGDTIPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASS-------------SP-LASLYFVALMTFGNYVLFNLLVAILVEAFQAEGDANRSDSDEEKRSVDFEEEEKMGELRARELKMYSLMMSANGHVESRGN 923          

HSP 7 Score: 74.3294 bits (181), Expect = 2.236e-12
Identity = 58/156 (37.18%), Postives = 88/156 (56.41%), Query Frame = 2
Query: 4442 LFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            +  I LNC+TL M +P   +  +S     L   +      FAVEM IK++A G+  G   YL   WN +D  +V   +A ++   + GH++ +  I    R +R LRPL+ I+R P +K++V  LL +L  +GN++L+C   F IFGI GVQL+ G
Sbjct:    1 MLVILLNCVTLGMYQPCEDVACQSEWCIILRAFDDCIFAFFAVEMVIKMMALGIF-GPACYLGDTWNRLDFFIV---MAGMLEYSLDGHNASLSAI----RTVRVLRPLKAINRVPSMKILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAG 148          

HSP 8 Score: 68.1662 bits (165), Expect = 1.608e-10
Identity = 73/280 (26.07%), Postives = 130/280 (46.43%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNT--LEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVE----LAQEGG---ASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRKNFDSLL----W------------AIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDE 3256
            +FR     I++HR F   +L+ I +N +++ +E  N     T    L  SN +F  +FL EM +K++A G   Y+ + +N+ DG +V + L++    LA  GG      L VLR  R LR L+++   P L+L +  ++ ++  +     +   F  IF ILG+ LF  KF   +    +      D LL    W            A++++F +  ++ W  ++  G+               W  LYF++ +   ++ + N+ V ++VE F   R D+
Sbjct: 1136 KFRVICNRIISHRLFDHVVLVFIFLNCITIALERPNIKPHSTERVFLSISNYVFTVIFLAEMTVKVVALGFYSYLQSTWNILDGMLVFVSLIDILVSLASSGGNRILGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVVICWAFFIIFGILGVQLFKGKFYHCEGLDTRNITNKSDCLLANYKWVPRKYNFDNLGQALMSLFVLSCKDGWVNIMYDGLDAVGVDQQPVRNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQ 1415          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: cacna1ib (calcium voltage-gated channel subunit alpha1 Ib [Source:ZFIN;Acc:ZDB-GENE-120215-18])

HSP 1 Score: 582.022 bits (1499), Expect = 2.460e-170
Identity = 378/656 (57.62%), Postives = 480/656 (73.17%), Query Frame = 2
Query: 4253 LNQDQDDHNENEEKILCNYFWCSWLSKFFRAHYYD--------SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQV-GNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDE 6190
            LN  +D  + +EE    +Y  C  + K    +  D        S+++ SP N+FR +CQ ++  K+FD +VL FI LNCIT+A+ERP I Q S ER FLTI+NY+FT IF  EMT+KV++ GL +G+ +YLRS WN++DG LV +SL DI++ +  G  ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL++SL+PIGNIVLICC FFIIFGI GVQLFKGKFYYC G DV ++ N S+C + K   W + +YNFDNLGQALMSLFVL+SKDGWV IMY GLDAVG++QQP  N N W LLYFISFLL+V FFVLNMFVGVVVENFHKCR++QE EE  RR  KR RR+EKK++K  + PY+  Y H RL+IH    S Y DL I  II +NV+TM++E Y  P      LK  NY F+S F++EA++K IA+G +R+  DRWNQLD+ IV+LSV GI +EE++ N  +PIN TIIR+ RVLRIARVLKLLKMA G+RALLDTV+QALPQV   L L    ++    +    L   L C+  +PC G+SRHA FENFGMAFLTLF+++TGDNWNGIMKDTLR +C +      N  +   I+P+YFV FVL AQFVL+NVVVAVLMKHL++S+K   +D E++ E++ E+ +
Sbjct: 1021 LNARKDRPHLDEET---DYSLCFRIQKMMEVYRPDWCETRENWSVYLFSPQNKFRLTCQKIIAHKLFDYVVLAFIFLNCITVALERPKIHQGSLERVFLTISNYIFTAIFVAEMTVKVVSMGLYLGERAYLRSSWNILDGFLVFVSLIDIVVSMAGG--AKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLITSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYYCVGLDVKNITNKSDCLSAKYK-WVHHKYNFDNLGQALMSLFVLASKDGWVNIMYHGLDAVGIDQQPVINNNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEVEEAKRREEKRLRRMEKKRRKAQKLPYYAGYSHIRLMIHSFCTSHYLDLFITLIICINVVTMSLEHYDQP----KGLKYCNYFFSSTFVVEAMLKLIAFGFRRFFKDRWNQLDLAIVLLSVMGITLEEIEINASLPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVHAGLALFPSFIYHHLTSSFFSLSLYLVCNADHPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLR-ECPHGNNHSCNASLQ-FISPMYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAEIELELAQ 1664          

HSP 2 Score: 338.576 bits (867), Expect = 7.006e-93
Identity = 211/468 (45.09%), Postives = 278/468 (59.40%), Query Frame = 2
Query:  482 EERIENTEKNKD----------LPYPDYPEKVFFFLNQTHHPRDWCLKFISWP------WFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNL-SYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCND------------SALP--NSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQSTSTLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEKHENLT 1792
            EER  + E+  D          +PYP+    VFF L QT  PR WC++ +S P      WFE++S+ VII+NC+TLGMY+PCE+  C + RC+IL  FD  I++FFAVE+++K+  +G+ G   Y  ++WNRLD  IV+AG++E       ++ TAIRTVRVLRPL+AINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGI+GVQ+W G+LRNRCY   N +    G+ L + YY  ++        + FICS    NG++ CSDIP        G    C D            +A P  N+        CVNWN+YY++C     NP+ GAINFDNIG+AW+ IFQV ++                    YF    ++GSFFMINLCLVVIATQFSETK+RE + M  +R    S+STL S  EP  CY E+ +L     R   +     +  F  +  +L+
Sbjct:   32 EERAGHVEEVDDDVSSELSGLVVPYPELAPVVFFCLKQTTFPRSWCIRLVSSPYPLLFTWFERVSMMVIILNCVTLGMYQPCENIDCSSQRCQILQAFDAMIYIFFAVEMVVKMVGLGIFGRRCYLGDTWNRLDFFIVMAGVVEYSLDLQNINFTAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCYPEDNFTLSS-GMALPTPYYSPDEED-----ERPFICSLPQDNGIMSCSDIPVRR----EGGRNCCLDVEDALHWQALGMAAEPIFNASAGAVPGLCVNWNRYYTRCLTGYKNPHKGAINFDNIGYAWIVIFQVFTI--------------------YFFFYQMVGSFFMINLCLVVIATQFSETKQREHQLMQEQRAACLSSSTLASLAEPGDCYEELFQLACHILRKARRRSAALFRAFRRRPRDLS 469          

HSP 3 Score: 275.789 bits (704), Expect = 1.325e-73
Identity = 162/245 (66.12%), Postives = 190/245 (77.55%), Query Frame = 2
Query: 2513 LGVRFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXX-DRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTE 3244
            L +  R K+  IV  +YF RGI+IAILINT+SMGIE+H QP  LTN LE  N++F  +F +EM+LK+ A G   Y+ N +N+FDG IVI+ + E+  +    GLSVLRTFRLLR+LKLVRFMPALR QL+V++KTMDNVATF  LL+LFIFIFSILGM +FGCKF    +      DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TS  AALYFVALMTFGNYVLFNLLVAILVEGF  E
Sbjct:  560 LWIEMRIKLWGIVESKYFNRGIMIAILINTISMGIEHHEQPEELTNVLEICNIVFTSMFALEMILKLTAFGCFNYLRNPYNIFDGIIVIISVCEIVGQSDG-GLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLKTDAGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPLAALYFVALMTFGNYVLFNLLVAILVEGFQAE 803          

HSP 4 Score: 97.0561 bits (240), Expect = 3.001e-19
Identity = 72/272 (26.47%), Postives = 137/272 (50.37%), Query Frame = 2
Query: 4406 NLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
             ++E K F+  ++  I +N I++ +E    P++      L I N VFT +FA+EM +K+ A G      +YLR+ +N+ DG++V+IS+ +     I+G S     +LR FRLLR L+ +R +   P L+  +  L+ ++  +    ++   F  IF I G+ +F  KF                   D  +T  +++ NFD+L  A++++F + +++ W  ++Y G+ +           +    LYF++ +    + + N+ V ++VE F 
Sbjct:  570 GIVESKYFNRGIMIAILINTISMGIEHHEQPEELTN--VLEICNIVFTSMFALEMILKLTAFGCF----NYLRNPYNIFDGIIVIISVCE-----IVGQSDGGLSVLRTFRLLRVLKLVRFM---PALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKF---------------SLKTDAGDTVPDRK-NFDSLLWAIVTVFQILTQEDWNVVLYNGMAST----------SPLAALYFVALMTFGNYVLFNLLVAILVEGFQ 801          

HSP 5 Score: 76.2554 bits (186), Expect = 5.689e-13
Identity = 55/161 (34.16%), Postives = 92/161 (57.14%), Query Frame = 2
Query: 4427 FDNIVLFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            F+ + +  I LNC+TL M +P  +I   S+  + L   + +  + FAVEM +K++  G+  G+  YL   WN +D  +V+  + +  + L   + + I       R +R LRPL+ I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G
Sbjct:   92 FERVSMMVIILNCVTLGMYQPCENIDCSSQRCQILQAFDAMIYIFFAVEMVVKMVGLGIF-GRRCYLGDTWNRLDFFIVMAGVVEYSLDLQNINFTAI-------RTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAG 244          

HSP 6 Score: 72.4034 bits (176), Expect = 8.163e-12
Identity = 67/216 (31.02%), Postives = 118/216 (54.63%), Query Frame = 2
Query: 5345 RLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFG-----RLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            R+ + G+V SKYF+  I   I +N I+M +E +  P EL   L+  N +FTS+F +E ++K  A+G   Y+ + +N  D +IVI+SV  IV +          ++++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  FIF+ LG+ +FG     + +  D  P        +F++   A +T+F+I T ++WN ++ + +
Sbjct:  565 RIKLWGIVESKYFNRGIMIAILINTISMGIEHHEQPEELTNVLEICNIVFTSMFALEMILKLTAFGCFNYLRNPYNIFDGIIVIISVCEIVGQSDG------GLSVLRTFRLL---RVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLKTDAGDTVP-----DRKNFDSLLWAIVTVFQILTQEDWNVVLYNGM 766          

HSP 7 Score: 67.0106 bits (162), Expect = 3.579e-10
Identity = 75/290 (25.86%), Postives = 139/290 (47.93%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLE-----YSNMIFNGLFLVEMLLKILAEGL-LG---YISNGFNVFDGGIVILGLVEL--AQEGGAS---GLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTER----VDEA 3259
            +FR   + I+AH+ F   +L  I +N +++ +E   +P +   +LE      SN IF  +F+ EM +K+++ GL LG   Y+ + +N+ DG +V + L+++  +  GGA     L VLR  R LR L+++   P L+L +  ++ ++  +     +   F  IF ILG+ L                     C     K    + NFD+L  A++++F + +++ W  ++  G+               W  LYF++ +   ++ + N+ V ++VE F   R    V+EA
Sbjct: 1070 KFRLTCQKIIAHKLFDYVVLAFIFLNCITVALE---RPKIHQGSLERVFLTISNYIFTAIFVAEMTVKVVSMGLYLGERAYLRSSWNILDGFLVFVSLIDIVVSMAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLITSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYYCVGLDVKNITNKSDCLSAKYKWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYHGLDAVGIDQQPVINNNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEVEEA 1356          

HSP 8 Score: 55.0694 bits (131), Expect = 1.579e-6
Identity = 65/201 (32.34%), Postives = 106/201 (52.74%), Query Frame = 2
Query:  503 EKNKDLPYPDYPE-----KVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGL-LGPSGYFSESWNRLDMVIVIAGLIECIPSTG-----EMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            +K  ++  PD+ E      V+ F  Q    R  C K I+   F+ + +A I +NCIT+ + +P       ++    L   ++     F  E+ +K+ +MGL LG   Y   SWN LD  +V   LI+ + S          L  +R +R LRPLR I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct: 1043 QKMMEVYRPDWCETRENWSVYLFSPQNKF-RLTCQKIIAHKLFDYVVLAFIFLNCITVALERP--KIHQGSLERVFLTISNYIFTAIFVAEMTVKVVSMGLYLGERAYLRSSWNILDGFLVFVSLIDIVVSMAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLITSLKPIGNIVLICCAFFIIFGILGVQLFKG 1240          

HSP 9 Score: 54.299 bits (129), Expect = 2.593e-6
Identity = 36/128 (28.12%), Postives = 64/128 (50.00%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSF----------WDWSYFVSLIIIGSFFMINLCLVVIATQFSETKK-RETER---------MLMERKKQQSTSTLGSSIEPQSCYHEIIKLISRFC 1726
            NFDN+G A +++F + S + WV+IMY+  DA             W   YF+S ++I SFF++N+ + V+   F + ++ +E E            ME+K++++       +   + Y  I  +I  FC
Sbjct: 1272 NFDNLGQALMSLFVLASKDGWVNIMYHGLDAVGIDQQPVINNNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEVEEAKRREEKRLRRMEKKRRKA-----QKLPYYAGYSHIRLMIHSFC 1394          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: ENSAMXT00000033959.1 (pep primary_assembly:Astyanax_mexicanus-2.0:4:2732409:2930308:1 gene:ENSAMXG00000029856.1 transcript:ENSAMXT00000033959.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 304.679 bits (779), Expect = 1.425e-91
Identity = 192/371 (51.75%), Postives = 247/371 (66.58%), Query Frame = 2
Query:  434 NDLDRSSYMVDSSAAEEERIENTEKNKDLPYPDYPEKVFFFLNQTHHPRDWCLKFI--SWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIII 1540
            NDL       +   AE+       +++ LPYP     VFF+L QT  PR WCLK +   +P+     + VI++NC+TLGM+ PCED+ C + RCKIL  FD  IF FFA+E++IK+ A+G+ G   Y  ++WNRLD  IV+AG++E   +   +S +A+RTVRVLRPLRAINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGIVGVQ+W G+LRNRC+L  N S     L+L  YY      T+      FICS    NG+ +CS IP     +   E   C+      + N   N +CVNWNQYY+ C A   NP+ GAINFDNIG+AW+AIFQVI++E WVDIMY+V DAHSF+++ YF+ LII+
Sbjct:   31 NDLSGGGEHAEQEGAEQG--AERRESEALPYPSLAPVVFFYLKQTTRPRSWCLKMVCNPYPFIPNPDMLVILLNCVTLGMFHPCEDSDCDSERCKILEDFDDFIFAFFAIEMVIKMVALGIFGKKCYLGDTWNRLDFFIVLAGMLEYSLNLQNVSFSAVRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLPENFSLPQT-LDLHTYYH-----TENDDESPFICSQPRENGMRQCSSIP-----MLLEETVQCHLDM--GAYNTTDNTTCVNWNQYYTNCSAGEVNPFKGAINFDNIGYAWIAIFQVITLEGWVDIMYFVMDAHSFYNFIYFILLIIV 386          

HSP 2 Score: 72.7886 bits (177), Expect = 1.767e-12
Identity = 97/340 (28.53%), Postives = 143/340 (42.06%), Query Frame = 2
Query: 4364 FVLSPDNRFRNSCQNLM--EKKVFDNIVLFFIALNCITLAMERPSIPQK--SREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKF--------------------YY-----------CSGPDVAHVKNFS----------ECN------NDKRNT----WKNQQY---------------NFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVG 5173
            F L    R R+ C  ++        N  +  I LNC+TL M  P       S   + L   +      FA+EM IK++A G+  GK  YL   WN +D  +V+  + +  + L     S +       R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G                      YY           CS P    ++  S          +C+      N   NT    W NQ Y               NFDN+G A +++F + + +GWV IMY  +DA          YN    +YFI  +++ G
Sbjct:   68 FYLKQTTRPRSWCLKMVCNPYPFIPNPDMLVILLNCVTLGMFHPCEDSDCDSERCKILEDFDDFIFAFFAIEMVIKMVALGIF-GKKCYLGDTWNRLDFFIVLAGMLEYSLNLQNVSFSAV-------RTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLPENFSLPQTLDLHTYYHTENDDESPFICSQPRENGMRQCSSIPMLLEETVQCHLDMGAYNTTDNTTCVNW-NQYYTNCSAGEVNPFKGAINFDNIGYAWIAIFQVITLEGWVDIMYFVMDA-------HSFYN---FIYFILLIIVRG 388          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: ENSAMXT00000056794.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:27265512:27410284:-1 gene:ENSAMXG00000029376.1 transcript:ENSAMXT00000056794.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 296.59 bits (758), Expect = 6.485e-89
Identity = 173/342 (50.58%), Postives = 235/342 (68.71%), Query Frame = 2
Query:  518 LPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVS-CVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIII 1540
            +P+P+    VFF L QT  PR+WC++        ++SI VI++NC+TLGMY+PCE+  C + RC+IL  FD  I++FFA+E+++K+ A+G+ G   Y  ++WNRLD  IV+AG++E       ++L+AIRTVRVLRPL+AINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGI+GVQ+W G+LRNR    ++ S   P +    YYQ  +        + FICS    NG++ C+D+P        G    C D      D   + +  CVNWNQYY++C    +NP+ GAINFDNIG+AW+ IFQVI++E WV+IMYYV DAHSF+++ YF+ LII+
Sbjct:   49 VPFPELAPVVFFCLKQTTCPRNWCIRM-------RISIMVILLNCVTLGMYQPCENIDCTSDRCQILQAFDAFIYIFFALEMVVKMVALGIFGRRCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRFQTKIDPSGISPPVP---YYQPEEDD-----ERPFICSLAQDNGIMSCTDVPTRR----EGGTECCLD----KEDVFVSAMGLCVNWNQYYTRCFTGNSNPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFIFLIIV 367          

HSP 2 Score: 80.8777 bits (198), Expect = 4.110e-15
Identity = 86/305 (28.20%), Postives = 134/305 (43.93%), Query Frame = 2
Query: 4436 IVLFFIALNCITLAMERPS--IPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGI-LRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG-----------------------------KFYYC---------SGPDV-AHVKNFSECNNDKRNTWK---------NQQY---------------NFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFI 5152
            I +  I LNC+TL M +P   I   S   + L   +    + FA+EM +K++A G+  G+  YL   WN +D  +V+  + +        +S  +  I L   R +R LRPL+ I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G                             + + C         S  DV    +  +EC  DK + +          NQ Y               NFDN+G A + +F + + +GWV+IMY  +DA          YN  Y ++ I
Sbjct:   77 ISIMVILLNCVTLGMYQPCENIDCTSDRCQILQAFDAFIYIFFALEMVVKMVALGIF-GRRCYLGDTWNRLDFFIVMAGMVE--------YSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRFQTKIDPSGISPPVPYYQPEEDDERPFICSLAQDNGIMSCTDVPTRREGGTECCLDKEDVFVSAMGLCVNWNQYYTRCFTGNSNPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDA-------HSFYNFIYFIFLI 365          

HSP 3 Score: 51.9878 bits (123), Expect = 6.796e-6
Identity = 34/121 (28.10%), Postives = 70/121 (57.85%), Query Frame = 2
Query: 2579 LIAILINTLSMGIEYHNQPVLLTN----TLEYSNMIFNGLFLVEMLLKILAEGLLG---YISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTM 2920
            ++ IL+N +++G+    + +  T+     L+  +      F +EM++K++A G+ G   Y+ + +N  D  IV+ G+VE + +     LS +RT R+LR LK +  +P++R+ + ++L T+
Sbjct:   79 IMVILLNCVTLGMYQPCENIDCTSDRCQILQAFDAFIYIFFALEMVVKMVALGIFGRRCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTL 199          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001901.1 (pep scaffold:Pmarinus_7.0:GL477793:3961:23506:1 gene:ENSPMAG00000001722.1 transcript:ENSPMAT00000001901.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 275.404 bits (703), Expect = 1.036e-82
Identity = 168/279 (60.22%), Postives = 209/279 (74.91%), Query Frame = 2
Query: 4331 KFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQ---ENYNEWYLLYFISF 5158
            KF  +    SL++ +P N+ R  C+ ++  KVFD++VL FI LNCIT+A+ERP I   S ER F+TI+NY+FT +F  EM+IKVIA  L+ G  +YLRS WN +DG LV++SL DI++ L     +RI GILRV RLLRTLRPLRVISRAPGLKLVV+TL++SL+PIGNIVLICC FFIIFGI GVQLFKGKFYYC G D  ++ N S+C       W   +YNFDNLGQALMSLFVLSSKDGWV IMYTGLDAVG++QQ     +N N++++L   +F
Sbjct:    5 KFCESRKEWSLYLFAPHNKVRMQCRKIIAHKVFDHVVLLFIFLNCITIALERPDIGADSPERLFMTISNYIFTAVFVTEMSIKVIAMALVFGDGAYLRSTWNTLDGFLVLVSLVDIIVSLASDSGARILGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGLDTKNITNKSDCLRANYK-WLKHKYNFDNLGQALMSLFVLSSKDGWVNIMYTGLDAVGLDQQRSKDPKNSNDFFVLKCCTF 282          

HSP 2 Score: 55.4546 bits (132), Expect = 8.684e-8
Identity = 74/247 (29.96%), Postives = 121/247 (48.99%), Query Frame = 2
Query: 5324 WKFYPH--WRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMM----PVELEVALKSLNYIFTSVFIIEALIKTIA----YGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLS------------------RHAH-FENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            + F PH   R+    ++  K FD  +   I LN IT+A+E   +    P  L + +   NYIFT+VF+ E  IK IA    +G   Y+   WN LD  +V++S+  I++    +    I   +  + R+LR  R L+++  A G++ +++T+I +L  +GN+ L+    F IF  LGV+LF       +  C GL                   +H + F+N G A ++LF +++ D W  IM   L
Sbjct:   16 YLFAPHNKVRMQCRKIIAHKVFDHVVLLFIFLNCITIALERPDIGADSPERLFMTIS--NYIFTAVFVTEMSIKVIAMALVFGDGAYLRSTWNTLDGFLVLVSLVDIIVSLASDSGARILGILRVL-RLLRTLRPLRVISRAPGLKLVVETLITSLKPIGNIVLICCAFFIIFGILGVQLFK----GKFYYCEGLDTKNITNKSDCLRANYKWLKHKYNFDNLGQALMSLFVLSSKDGWVNIMYTGL 255          

HSP 3 Score: 55.4546 bits (132), Expect = 8.761e-8
Identity = 51/173 (29.48%), Postives = 88/173 (50.87%), Query Frame = 2
Query:  578 RDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLR-------AINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            R  C K I+   F+ + +  I +NCIT+ + +P  D    +     +   ++     F  E+ IK+ AM L+ G   Y   +WN LD  +V+  L++ I S    S   I  +  +  L         I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct:   25 RMQCRKIIAHKVFDHVVLLFIFLNCITIALERP--DIGADSPERLFMTISNYIFTAVFVTEMSIKVIAMALVFGDGAYLRSTWNTLDGFLVLVSLVDIIVSLASDSGARILGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLKPIGNIVLICCAFFIIFGILGVQLFKG 195          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001900.1 (pep scaffold:Pmarinus_7.0:GL477793:3961:23576:1 gene:ENSPMAG00000001722.1 transcript:ENSPMAT00000001900.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 276.174 bits (705), Expect = 1.282e-82
Identity = 172/300 (57.33%), Postives = 219/300 (73.00%), Query Frame = 2
Query: 4331 KFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQ---ENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            KF  +    SL++ +P N+ R  C+ ++  KVFD++VL FI LNCIT+A+ERP I   S ER F+TI+NY+FT +F  EM+IKVIA  L+ G  +YLRS WN +DG LV++SL DI++ L     +RI GILRV RLLRTLRPLRVISRAPGLKLVV+TL++SL+PIGNIVLICC FFIIFGI GVQLFKGKFYYC G D  ++ N S+C       W   +YNFDNLGQALMSLFVLSSKDGWV IMYTGLDAVG++QQ     +N N++++L   +FL L+   ++ M +   + + H
Sbjct:    5 KFCESRKEWSLYLFAPHNKVRMQCRKIIAHKVFDHVVLLFIFLNCITIALERPDIGADSPERLFMTISNYIFTAVFVTEMSIKVIAMALVFGDGAYLRSTWNTLDGFLVLVSLVDIIVSLASDSGARILGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGLDTKNITNKSDCLRANYK-WLKHKYNFDNLGQALMSLFVLSSKDGWVNIMYTGLDAVGLDQQRSKDPKNSNDFFVLKCCTFLRLLLLLLMTMMITAPLHSRH 303          

HSP 2 Score: 55.8398 bits (133), Expect = 7.357e-8
Identity = 74/247 (29.96%), Postives = 121/247 (48.99%), Query Frame = 2
Query: 5324 WKFYPH--WRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMM----PVELEVALKSLNYIFTSVFIIEALIKTIA----YGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLS------------------RHAH-FENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            + F PH   R+    ++  K FD  +   I LN IT+A+E   +    P  L + +   NYIFT+VF+ E  IK IA    +G   Y+   WN LD  +V++S+  I++    +    I   +  + R+LR  R L+++  A G++ +++T+I +L  +GN+ L+    F IF  LGV+LF       +  C GL                   +H + F+N G A ++LF +++ D W  IM   L
Sbjct:   16 YLFAPHNKVRMQCRKIIAHKVFDHVVLLFIFLNCITIALERPDIGADSPERLFMTIS--NYIFTAVFVTEMSIKVIAMALVFGDGAYLRSTWNTLDGFLVLVSLVDIIVSLASDSGARILGILRVL-RLLRTLRPLRVISRAPGLKLVVETLITSLKPIGNIVLICCAFFIIFGILGVQLFK----GKFYYCEGLDTKNITNKSDCLRANYKWLKHKYNFDNLGQALMSLFVLSSKDGWVNIMYTGL 255          

HSP 3 Score: 55.8398 bits (133), Expect = 7.753e-8
Identity = 51/173 (29.48%), Postives = 88/173 (50.87%), Query Frame = 2
Query:  578 RDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLR-------AINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            R  C K I+   F+ + +  I +NCIT+ + +P  D    +     +   ++     F  E+ IK+ AM L+ G   Y   +WN LD  +V+  L++ I S    S   I  +  +  L         I+R P ++++V  L+ +L  +GN++L+C   F IFGI+GVQ+++G
Sbjct:   25 RMQCRKIIAHKVFDHVVLLFIFLNCITIALERP--DIGADSPERLFMTISNYIFTAVFVTEMSIKVIAMALVFGDGAYLRSTWNTLDGFLVLVSLVDIIVSLASDSGARILGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLKPIGNIVLICCAFFIIFGILGVQLFKG 195          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001904.1 (pep scaffold:Pmarinus_7.0:GL477793:127370:134209:1 gene:ENSPMAG00000001732.1 transcript:ENSPMAT00000001904.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 224.557 bits (571), Expect = 4.750e-66
Identity = 153/231 (66.23%), Postives = 185/231 (80.09%), Query Frame = 2
Query: 5468 ALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDE 6157
             LK  NY+FTSVF++EAL+K +A+G +RY  DRWNQLD+ IV+LS+ GI++EE++ +  +PIN TIIR+ RVLRI RVLKL+KMA G++ALL  V+QALPQVGNLGLLF LLFFI+AALGVELFG L C DY PC GLSRHA FENFGMA LTLFR++TGDNWNGIMKDTLR       +C       P+I+PIYFV FVL AQFVLVNVVVAVLMKHLE+S +   +++E
Sbjct:   49 GLKYCNYVFTSVFVLEALLKLLAFGIRRYFKDRWNQLDLAIVLLSIMGIILEEIEISASLPINPTIIRIMRVLRITRVLKLVKMATGMQALLAVVVQALPQVGNLGLLFLLLFFIYAALGVELFGGLTCEDY-PCEGLSRHATFENFGMALLTLFRVSTGDNWNGIMKDTLRECSSLDRQCISYL---PVISPIYFVTFVLTAQFVLVNVVVAVLMKHLEDSAEDAHEEEE 275          

HSP 2 Score: 73.559 bits (179), Expect = 5.274e-14
Identity = 63/226 (27.88%), Postives = 112/226 (49.56%), Query Frame = 2
Query: 4517 EFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFG--ILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG---KFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGL-DAVGVNQQPQENYNEWYLLYFISFLLLVGF 5176
            E L   NYVFT +F +E  +K++A G+      Y +  WN +D  +V++S+  I++  I   +S      I+R+ R+LR  R L+++  A G++ ++  ++ +L  +GN+ L+    F I+   GV+LF G   + Y C G                     ++   F+N G AL++LF +S+ D W  IM   L +   +++Q          +YF++F+L   F
Sbjct:   48 EGLKYCNYVFTSVFVLEALLKLLAFGI----RRYFKDRWNQLDLAIVLLSIMGIILEEIEISASLPINPTIIRIMRVLRITRVLKLVKMATGMQALLAVVVQALPQVGNLGLLFLLLFFIYAALGVELFGGLTCEDYPCEG--------------------LSRHATFENFGMALLTLFRVSTGDNWNGIMKDTLRECSSLDRQCISYLPVISPIYFVTFVLTAQF 249          

HSP 3 Score: 62.3882 bits (150), Expect = 2.958e-10
Identity = 49/178 (27.53%), Postives = 94/178 (52.81%), Query Frame = 2
Query: 2642 LTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSS 3148
            L   L+Y N +F  +F++E LLK+LA G+  Y  + +N  D  IV+L ++ +  E            + + ++R  R+ R+LKLV+    ++  L V+++ +  V     L +L  FI++ LG+ LFG   C+    +       F++   A++T+F++ T ++WN ++   + + SS
Sbjct:   46 LNEGLKYCNYVFTSVFVLEALLKLLAFGIRRYFKDRWNQLDLAIVLLSIMGIILEEIEISASLPINPTIIRIMRVLRITRVLKLVKMATGMQALLAVVVQALPQVGNLGLLFLLLFFIYAALGVELFGGLTCEDYPCEGLSRHATFENFGMALLTLFRVSTGDNWNGIMKDTLRECSS 223          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009098.1 (pep scaffold:Pmarinus_7.0:GL478807:14086:32911:1 gene:ENSPMAG00000008235.1 transcript:ENSPMAT00000009098.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.43 bits (485), Expect = 8.637e-56
Identity = 122/183 (66.67%), Postives = 143/183 (78.14%), Query Frame = 2
Query: 2546 IVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXX-DRKNFDSLLWAIVTVFQI 3091
            IV  +YF RGI++AILINT+SM IEYH QP  LTN LE SN++F  +F +EMLLKI A GL GYI N +N+FDG IVI+ + E+  + G  GLSVLRTFRLLR+LKLVRFMPALR QL++M +TMDNVATF  LL+LFIFIFSILGM LFGCKF    +      DRKNFDSLLWAIVTVFQ+
Sbjct:    1 IVNSKYFNRGIMVAILINTVSMAIEYHEQPEELTNILEISNIVFTSMFALEMLLKIFACGLFGYIRNQYNIFDGVIVIISVWEIVGQSGG-GLSVLRTFRLLRVLKLVRFMPALRRQLVLM-RTMDNVATFCMLLMLFIFIFSILGMHLFGCKFSLKTDTGDTIPDRKNFDSLLWAIVTVFQV 181          

HSP 2 Score: 66.2402 bits (160), Expect = 3.450e-12
Identity = 43/128 (33.59%), Postives = 75/128 (58.59%), Query Frame = 2
Query: 4409 LMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLK 4792
            ++  K F+  ++  I +N +++A+E    P++      L I+N VFT +FA+EM +K+ A GL      Y+R+ +N+ DG++V+IS+ +     I+G S     +LR FRLLR L+ +R +   P L+
Sbjct:    1 IVNSKYFNRGIMVAILINTVSMAIEYHEQPEELTN--ILEISNIVFTSMFALEMLLKIFACGLF----GYIRNQYNIFDGVIVIISVWE-----IVGQSGGGLSVLRTFRLLRVLKLVRFM---PALR 114          

HSP 3 Score: 56.225 bits (134), Expect = 7.505e-9
Identity = 47/123 (38.21%), Postives = 74/123 (60.16%), Query Frame = 2
Query: 5363 LVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIR 5731
            +VNSKYF+  I   I +N ++MA+E++  P EL   L+  N +FTS+F +E L+K  A G   YI +++N  D +IVI+SV  IV +          ++++R FR+L   RVLKL++    +R
Sbjct:    1 IVNSKYFNRGIMVAILINTVSMAIEYHEQPEELTNILEISNIVFTSMFALEMLLKIFACGLFGYIRNQYNIFDGVIVIISVWEIVGQSGG------GLSVLRTFRLL---RVLKLVRFMPALR 114          

HSP 4 Score: 47.7506 bits (112), Expect = 6.324e-6
Identity = 27/71 (38.03%), Postives = 43/71 (60.56%), Query Frame = 2
Query:  749 FAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMR 961
            FA+E+++KI A GL G   Y    +N  D VIVI  + E +  +G   L+ +RT R+LR L+ +  +P++R
Sbjct:   48 FALEMLLKIFACGLFG---YIRNQYNIFDGVIVIISVWEIVGQSGG-GLSVLRTFRLLRVLKLVRFMPALR 114          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008004.1 (pep scaffold:Pmarinus_7.0:GL477228:88466:118438:1 gene:ENSPMAG00000007222.1 transcript:ENSPMAT00000008004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.045 bits (484), Expect = 1.205e-48
Identity = 166/534 (31.09%), Postives = 288/534 (53.93%), Query Frame = 2
Query: 4427 FDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPD-----VAHVKNFSECNN--DKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLL--IHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTG-LSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNS 5998
            F+ +VLF + ++  TL ++       ++  + L   +  +   F++EM +K+I  GL    H Y  S W ++D  LV++S  + +   +    S     LR  R LR LRPLR ISR  G++LVV  L++S+  I N++L+C  F+++FGI GVQLF GKF+ C   +        V N + C +   +   W N   N+DN+  A ++L  +++ +GW++ M    D+ GV+QQP  N N +  ++FI F+++  FF+LN+F+GVV++NF+   + +          ++      ++    +P      P  R+L   + LV+ + F+     +I LN++ +A E Y          K +N +FT +F++EA +K +      Y    W+  D  +V +S++ IV+E M ++ +  +  I+RVFRV+R+ R+L+L++  +GIR L+ T++ +LP + N+GLL  L+ F++  LGV +F  L      P +G ++   +FE F  +   LFR+ T   WN +M   L  K  N+
Sbjct: 1023 FNGLVLFMVIMSSFTLTLDDKYNSSNAQLMQVLRYMDIFYMAFFSMEMFLKMIGLGL----HKYFTSFWTLLDCFLVLVSWLNQLASAVPALKS-----LRSLRTLRALRPLRAISRWKGMRLVVNALVTSIPSISNVMLMCLLFWMVFGIAGVQLFGGKFFRCIDAEGNRLPATEVANRTVCESLAAEGYLWVNAIINYDNILSAYLALLQVATLEGWIEQMADASDSTGVDQQPSYNANIYSQMFFIIFVIIGSFFILNLFIGVVIDNFNSVHKREGALMALLTEDQQKFYKTMRRLYRSKPSKSIPQPQNRVLRFFYLLVHRRLFEYISTAVISLNMVMLASEHYKQSESFTNITKIINLVFTGLFMLEAALKILG-NRIHYFRQPWDIFDFFVVCISLTEIVLETMASQ-VNFSPAILRVFRVVRLVRLLRLIRSVEGIRKLIYTLVISLPALINIGLLLLLIMFMYGVLGVSIFRDL------PYSGSITNMVNFETFANSMTLLFRLNTAGGWNDVMGSVLGTKTQNA 1539          

HSP 2 Score: 75.0998 bits (183), Expect = 2.415e-13
Identity = 44/133 (33.08%), Postives = 77/133 (57.89%), Query Frame = 2
Query: 2519 VRFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGAS---GLSVLRTFRLLRILKLVRFMPALRLQLIVM 2908
            V FR++++++V    F+  I I I+ NT+ M I+Y+N P   ++ L+  N +   +F+ E +LK+ A     Y   G+N+FD  +VI  +VE   +  ++    +S++RTFR+LR+ KL +    L L + VM
Sbjct:  555 VAFRQRLRTLVTSSVFETFITILIITNTVMMAIDYYNAP--YSSALDIGNTVLTTIFIAEAVLKLTALFPRVYFHLGWNIFDFCVVITSVVEWILDSMSNTNINISIIRTFRILRVFKLAKKWKTLNLLIRVM 685          

HSP 3 Score: 71.2478 bits (173), Expect = 3.534e-12
Identity = 74/223 (33.18%), Postives = 118/223 (52.91%), Query Frame = 2
Query: 5342 WRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNP-CTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEEC 6007
            +R  +  LV S  F+  I  +I  N + MA+++Y  P     AL   N + T++FI EA++K  A  P+ Y    WN  D  +VI SV   +++ M N    IN++IIR FR+L   RV KL K  K +  L+  +  A+ ++ NL ++F L+ +IFA +G++L GR    + N   +G     +F +F  +FL +FR+  G+ W   + + L   C N   C
Sbjct:  557 FRQRLRTLVTSSVFETFITILIITNTVMMAIDYYNAP--YSSALDIGNTVLTTIFIAEAVLKLTALFPRVYFHLGWNIFDFCVVITSVVEWILDSMSNT--NINISIIRTFRIL---RVFKLAKKWKTLNLLIRVMKSAIGEMRNLTVIFALVIYIFAVIGMQLIGRDYYHNRNKFSSGQVPRWNFLDFYSSFLMVFRVLCGE-WIEPLYECL--VCSNIYYC 769          

HSP 4 Score: 67.781 bits (164), Expect = 3.631e-11
Identity = 64/253 (25.30%), Postives = 108/253 (42.69%), Query Frame = 2
Query: 4538 YVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG----KFYYCSGPDVA---------HVKNFSE-----------CNNDKRNTWKNQQY---------------NFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFF 5179
            Y+FT I+  E  IK +A+G +   +SYLR+ WN +D            IV+I+ + +  F  L     LR  R L++I+  P LK +V  +  S   + N++L+     II  +FG+Q+F+G    K  +   P  +         +V+N S            C N    +     Y               +FDN G A+M+ F + + D W       L A G          ++++ +FI  ++L G++
Sbjct:    1 YIFTAIYTGEFLIKTLARGFVFHPYSYLRNAWNWLD-----------FIVIILAYMTIAFPFLPGLSALRAFRALKMIAILPALKTIVGAIFKSAGLLLNVMLLMIFALIIISLFGLQIFRGVLRQKCVFLPNPGTSSLSDAEWSNYVQNKSNWLITDDIEIMVCGNGTGTSHCPANYTCLPDIGENPNHGATSFDNFGWAMMTSFQIITIDYWENCYNMVLRASG----------QYFIGFFIVVIMLGGYY 232          

HSP 5 Score: 66.6254 bits (161), Expect = 8.856e-11
Identity = 68/271 (25.09%), Postives = 123/271 (45.39%), Query Frame = 2
Query:  758 ELMIKICAMGLL-GPSGYFSESWNRLD-MVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHK--DFICSPDNFNGLVKCSDIPPSVIWLPSG--EARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFF 1552
            E +IK  A G +  P  Y   +WN LD +VI++A +    P      L  +  +R  R L+ I  +P+++ +V  +  +  +L NV+LL  F   I  + G+Q+++G+LR +C    N     PG            T+ LS  +  +++ +  N               WL +   E  VC +     + + P N +C+              NP +GA +FDN G+A +  FQ+I+++ W +    V  A   +   +F+ +I++G ++
Sbjct:   10 EFLIKTLARGFVFHPYSYLRNAWNWLDFIVIILAYMTIAFPF-----LPGLSALRAFRALKMIAILPALKTIVGAIFKSAGLLLNVMLLMIFALIIISLFGLQIFRGVLRQKCVFLPN-----PG------------TSSLSDAEWSNYVQNKSN---------------WLITDDIEIMVCGNGT--GTSHCPANYTCL---------PDIGENPNHGATSFDNFGWAMMTSFQIITIDYWENCYNMVLRASGQYFIGFFIVVIMLGGYY 232          

HSP 6 Score: 61.2326 bits (147), Expect = 3.737e-9
Identity = 92/381 (24.15%), Postives = 167/381 (43.83%), Query Frame = 2
Query: 4124 NSQPSLKTSMFLPMVFI-----DSSFVSKLPSNLTMGN----EKCADEDSSLLNQDQDDHNENEEKILCNYFWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            + QPS   +++  M FI      S F+  L   + + N     K      +LL +DQ    +              + + +R+    S  +  P NR       L+ +++F+ I    I+LN + LA E     Q         I N VFT +F +E  +K++       +  Y R  W++ D  +V ISL +I++  +    +    ILRVFR++R +R LR+I    G++ ++ TL+ SL  + NI L+      ++G+ GV +F+   Y  S  ++                      NF+    ++  LF L++  GW  +M + L     N           + YF +F++     ++NM+V +++ENF++ +E +
Sbjct: 1246 DQQPSYNANIYSQMFFIIFVIIGSFFILNLFIGVVIDNFNSVHKREGALMALLTEDQQKFYKT-------------MRRLYRSKPSKS--IPQPQNRVLRFFYLLVHRRLFEYISTAVISLNMVMLASEH--YKQSESFTNITKIINLVFTGLFMLEAALKILGN-----RIHYFRQPWDIFDFFVVCISLTEIVLETMASQVNFSPAILRVFRVVRLVRLLRLIRSVEGIRKLIYTLVISLPALINIGLLLLLIMFMYGVLGVSIFRDLPYSGSITNMV---------------------NFETFANSMTLLFRLNTAGGWNDVMGSVLGTKTQNAI-------LVIAYFTTFVIFSNIIIINMYVAIILENFNEAQEQE 1576          

HSP 7 Score: 58.9214 bits (141), Expect = 2.095e-8
Identity = 51/170 (30.00%), Postives = 91/170 (53.53%), Query Frame = 2
Query:  569 HHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPST--GEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            H  R    +      F  L + ++I++  TL +      ++ + +  ++L   D     FF++E+ +K+  +GL     YF+  W  LD  +V+   +  + S      SL ++RT+R LRPLRAI+R   MR++V  L+ ++P + NV+L+C   + +FGI GVQ++ G
Sbjct: 1008 HAVRRMVFRLCHTTGFNGLVLFMVIMSSFTLTLDDKYNSSNAQLM--QVLRYMDIFYMAFFSMEMFLKMIGLGL---HKYFTSFWTLLDCFLVLVSWLNQLASAVPALKSLRSLRTLRALRPLRAISRWKGMRLVVNALVTSIPSISNVMLMCLLFWMVFGIAGVQLFGG 1172          

HSP 8 Score: 58.151 bits (139), Expect = 2.860e-8
Identity = 34/108 (31.48%), Postives = 56/108 (51.85%), Query Frame = 2
Query: 1364 CEARANNPYY---GAINFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQ 1648
            CE+ A   Y      IN+DNI  A++A+ QV ++E W++ M    D+           + +   +F+  +IIGSFF++NL + V+   F+   KRE   M +  + QQ
Sbjct: 1196 CESLAAEGYLWVNAIINYDNILSAYLALLQVATLEGWIEQMADASDSTGVDQQPSYNANIYSQMFFIIFVIIGSFFILNLFIGVVIDNFNSVHKREGALMALLTEDQQ 1303          

HSP 9 Score: 53.9138 bits (128), Expect = 5.952e-7
Identity = 65/247 (26.32%), Postives = 124/247 (50.20%), Query Frame = 2
Query: 2546 IVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSV-------LRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAAL---YFVALMTFGNYVLFNLLVAILVEGFSTERVDE 3256
            +V  R F+      I +N + +  E++ Q    TN  +  N++F GLF++E  LKIL    + Y    +++FD  +V + L E+  E  AS ++         R  RL+R+L+L+R +  +R  +  ++ ++  +     LL+L +F++ +LG+S+    F          +  NF++   ++  +F++ T   WN V+ S +   +  A L   YF   + F N ++ N+ VAI++E F+  +  E
Sbjct: 1335 LVHRRLFEYISTAVISLNMVMLASEHYKQSESFTNITKIINLVFTGLFMLEAALKILGNR-IHYFRQPWDIFDFFVVCISLTEIVLETMASQVNFSPAILRVFRVVRLVRLLRLIRSVEGIRKLIYTLVISLPALINIGLLLLLIMFMYGVLGVSI----FRDLPYSGSITNMVNFETFANSMTLLFRLNTAGGWNDVMGSVLGTKTQNAILVIAYFTTFVIFSNIIIINMYVAIILENFNEAQEQE 1576          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Yeast
Match: CCH1 (Voltage-gated high-affinity calcium channel; involved in calcium influx in response to some environmental stresses as well as exposure to mating pheromones; interacts and partially co-localizes with Mid1p; however, evidence suggests CCH1 is not required for Mid1p function [Source:SGD;Acc:S000003449])

HSP 1 Score: 72.0182 bits (175), Expect = 1.455e-12
Identity = 96/451 (21.29%), Postives = 181/451 (40.13%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLME---------KKVFDN-----------------IVLFFIALNCITLAMERPSIPQKSREREFLTITNY------VFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQ-TLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNND-------KRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSK---YFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIF-TSVFIIEALIKTIAYGPKRYIIDRWNQL 5578
            S +  SP +RFR  CQ L+           + F++                 + +F  AL  I L +    +    R    +   N+       F   F++E  +K +A G +   ++YLR+ WN +D   V+IS    M + +I +      + R+F+ L  LR LR ++ +   +      +   L  I    LI  +    F ++G+ +FKG+   C+   +     ++E +N            ++    + D+   A  SL+ + S +GWV ++   +++ G+        +    L+ + F  L   F+LN+FV  +V N  + R            A    +    + K    P        R   + L   K   Y+   +  ++ L++I +    Y  P  L +  + + ++F TSVF+I+  +     GP+ Y   +WN +
Sbjct: 1155 SYYFFSPQHRFRRFCQRLVPPSTGKRTDGSRFFEDSTDLYNKRSYFHHIERDVFVFIFALATILLIVCSCYVTPLYRMHHKMGTWNWSSALDCAFIGAFSIEFIVKTVADGFIYSPNAYLRNPWNFID-FCVLIS----MWINLIAYLKNNGNLSRIFKGLTALRALRCLTISNTARQTFNLVMFDGLNKIFEAGLISLSLLFPFTVWGLSIFKGRLGTCNDGSLGRADCYNEYSNSVFQWDIMSPRVYQQPYLHLDSFASAFSSLYQIISLEGWVDLLENMMNSSGIGTPATVMGSAGNALFLVLFNFLSMVFILNLFVSFIVNN--QARTTGSAYFTIEEKAWLESQKLLSQAKPKAIPNLIELSRVRQFFYQLAVEKKNFYYASFLQVVLYLHIIMLLSRSY-NPGNL-IGYQGVYFMFSTSVFLIQEALHMCGEGPRLYFRQKWNSI 1596          

HSP 2 Score: 54.299 bits (129), Expect = 3.120e-7
Identity = 30/90 (33.33%), Postives = 52/90 (57.78%), Query Frame = 2
Query: 1355 YSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQF----SETKKRE 1612
            YSKC + AN PY G I+FDNI  +   +F ++S  ++ D+MYY  D+       +F+  I + + +++NL + V+ + F     E KK++
Sbjct:  639 YSKCVSNAN-PYNGRISFDNIVNSMELVFVIMSANTFTDLMYYTMDSDEMAACLFFIVCIFVLTIWLLNLLIAVLVSSFEIANEEYKKKK 727          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO36844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI0])

HSP 1 Score: 558.91 bits (1439), Expect = 6.073e-165
Identity = 343/593 (57.84%), Postives = 429/593 (72.34%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYN-PCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLR-NKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEES 6130
            SL+V +PDNRFR   + L + K FD  VL FI LNC+ +A+E PS+   S ER  + I  YVF  IF +EM +KVIA GL +G  +YLRSGWNVMDG LVVIS  D+++       + I G+LRVFR LRTLRPLRVISRAPGLK+VV+TL+SSL+PIGNIVLI  TFFIIFGI GVQLFKGKF+YC+   V  V   +EC  +   +W N++YNFDNL +AL++LFV S+KDGWV IMY G+DAVG+++QP  N+  + ++YF+ FLLL GF VLNM VGVVVENF KCR   E E+K     K  +  + +++        + YP  R  IH +    YFDL IA +I LNV+ MA+E Y  P  L   LK  NY+FT+VFI+EA++K  A G KRYI DRWNQLD+LIVILS+ GI +EEM  + +PIN TIIRV RVLRIARVLKLLK A+GIR LLDTV QALPQVGNLG+LF L+FFIF+ALG+ELFG+++C      C G+  HA+F +FG+A LTLFRI+TGDNWNGI+KDT+  + C  + E   +C +   +APIYF +FVL  QFVL+NVVVAVLMKHLEE+
Sbjct:  910 SLYVFAPDNRFRMLNKELYQNKWFDRTVLLFILLNCVVMALEGPSVLPGSLERRVIDICMYVFLGIFTIEMMVKVIALGLWIGPDAYLRSGWNVMDGFLVVISWVDVIVTATTNGQNSILGVLRVFRALRTLRPLRVISRAPGLKIVVETLISSLKPIGNIVLIAATFFIIFGILGVQLFKGKFHYCTDATVP-VTTKTECLENG-GSWVNREYNFDNLAKALLTLFVFSTKDGWVNIMYDGIDAVGIDKQPIRNHARYNVIYFVGFLLLAGFVVLNMLVGVVVENFQKCRTLIEMEKKIDEEKKNKKEEKMRREIAEDEALSEHYPRPRKFIHAVCTHGYFDLGIAAVIALNVLCMALEHYQQPDGLTAFLKCANYVFTAVFILEAILKIFALGIKRYIKDRWNQLDMLIVILSIVGIALEEMTME-LPINPTIIRVMRVLRIARVLKLLKTAEGIRKLLDTVAQALPQVGNLGMLFLLMFFIFSALGIELFGKIDCEKPGITCQGMDEHANFRSFGIAMLTLFRISTGDNWNGILKDTISPDVCRVNPEI--DCSMLEHVAPIYFAVFVLATQFVLLNVVVAVLMKHLEEA 1497          

HSP 2 Score: 244.588 bits (623), Expect = 1.137e-64
Identity = 138/242 (57.02%), Postives = 176/242 (72.73%), Query Frame = 2
Query: 2519 VRFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXX-XXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFST 3241
             +FR    S V  ++F   I+ AI +NTL+MGIEY+ QP  +T+ LE  N IF  +F +EM++K++  G  GYI + FN+FDG IVI+ +VEL  +   SG+SVLR+FRLLR+ KLVRF+PALR QL+VM+ TMDNV TF ALL++F+F  SILGM+LFG K+      G  +  R NFD L WAIVTVFQ+LTQEDWN V+  GM  TS WA LYF+ LMT GNY+LFNLLVAILVEGF++
Sbjct:  398 AKFRDGCASSVDSKWFMYVIMGAIFVNTLTMGIEYYGQPQKMTDVLEIFNYIFTAIFGIEMIMKLIGLGFYGYIKDAFNIFDGTIVIISVVELFGDDD-SGISVLRSFRLLRVFKLVRFLPALRRQLLVMIHTMDNVMTFLALLVIFMFTASILGMNLFGGKYRFPNDEGVMETSRANFDDLFWAIVTVFQVLTQEDWNIVMYDGMRATSKWAGLYFILLMTIGNYILFNLLVAILVEGFAS 638          

HSP 3 Score: 232.261 bits (591), Expect = 6.643e-61
Identity = 143/292 (48.97%), Postives = 186/292 (63.70%), Query Frame = 2
Query:  893 LTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSD--IPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQSTSTLGSSIE--PQSCYHEIIKLISRFCRHLLKTVIKR 1756
            +TA+R +RVLRPLRAINR+PS+RILV LLLDTLPMLGNVL +C  +F IFGIVGVQMWQG+LR+RC   L  +     LN+S +YQ   ++       D +CS    +G   C+   IP S     +   R C  +    S+       C NWNQYY+ C     NP Y A++FDNI  AWVAIFQVI++E W DIMYY+QDAH FW++ YFV LI+IGS+FM NLCLVVI TQF ETK+RE + M   R+K  ++++   S     + C+ EI+K I    RH  + + K+
Sbjct:    1 MTAVRAIRVLRPLRAINRVPSIRILVTLLLDTLPMLGNVLAMCSLIFSIFGIVGVQMWQGVLRSRCVAQLPGNLSANQLNISAFYQPGGSS-------DLVCSLPENSGDKHCTSAFIPAS-----TAHGRECGLTYEQYSNRSNYTNVCANWNQYYTLCADMGINPLYDAVSFDNILIAWVAIFQVITLEGWTDIMYYIQDAHGFWNFIYFVVLIVIGSYFMTNLCLVVITTQFQETKQRENDLMRQSRRKHTTSTSTIGSSRYGREGCWLEILKWIGHVYRHTKRRLGKK 280          

HSP 4 Score: 108.997 bits (271), Expect = 2.293e-23
Identity = 74/278 (26.62%), Postives = 139/278 (50.00%), Query Frame = 2
Query: 4385 RFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENF 5218
            +FR+ C + ++ K F  +++  I +N +T+ +E    PQK  +   L I NY+FT IF +EM +K+I  G     + Y++  +N+ DG +V+IS     +V + G       +LR FRLLR  + +R +   P L+  +  ++ ++  +   + +   F     I G+ LF GK+ +                ND+    +  + NFD+L  A++++F + +++ W  +MY G+ A           ++W  LYFI  + +  + + N+ V ++VE F
Sbjct:  399 KFRDGCASSVDSKWFMYVIMGAIFVNTLTMGIEYYGQPQKMTD--VLEIFNYIFTAIFGIEMIMKLIGLGF----YGYIKDAFNIFDGTIVIIS-----VVELFGDDDSGISVLRSFRLLRVFKLVRFL---PALRRQLLVMIHTMDNVMTFLALLVIFMFTASILGMNLFGGKYRF---------------PNDE-GVMETSRANFDDLFWAIVTVFQVLTQEDWNIVMYDGMRAT----------SKWAGLYFILLMTIGNYILFNLLVAILVEGF 636          

HSP 5 Score: 94.3597 bits (233), Expect = 6.062e-19
Identity = 78/283 (27.56%), Postives = 138/283 (48.76%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNM-----IFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVELAQEGGASG----LSVLRTFRLLRILKLVRFM---PALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRK---------------NFDSLLWAIVTVFQILTQEDWNAVLISGMSQT----------SSWAALYFVALMTFGNYVLFNLLVAILVEGFSTER 3247
            RFR   K +  +++F R +L+ IL+N + M +E    P +L  +LE   +     +F G+F +EM++K++A GL      Y+ +G+NV DG +V++  V++      +G    L VLR FR LR L+ +R +   P L++ +  ++ ++  +     +   F  IF ILG+ LF  KF    +       K               NFD+L  A++T+F   T++ W  ++  G+             + +  +YFV  +    +V+ N+LV ++VE F   R
Sbjct:  919 RFRMLNKELYQNKWFDRTVLLFILLNCVVMALE---GPSVLPGSLERRVIDICMYVFLGIFTIEMMVKVIALGLWIGPDAYLRSGWNVMDGFLVVISWVDVIVTATTNGQNSILGVLRVFRALRTLRPLRVISRAPGLKIVVETLISSLKPIGNIVLIAATFFIIFGILGVQLFKGKFHYCTDATVPVTTKTECLENGGSWVNREYNFDNLAKALLTLFVFSTKDGWVNIMYDGIDAVGIDKQPIRNHARYNVIYFVGFLLLAGFVVLNMLVGVVVENFQKCR 1198          

HSP 6 Score: 92.0485 bits (227), Expect = 3.180e-18
Identity = 70/209 (33.49%), Postives = 111/209 (53.11%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG-------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXX--XXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVL 3121
            R RK + ++  H YF  GI   I +N L M +E++ QP  LT  L+ +N +F  +F++E +LKI A G+  YI + +N  D  IVIL +V +A E          + + V+R  R+ R+LKL++    +R  L  + + +  V     L +L  FIFS LG+ LFG           +   +  NF S   A++T+F+I T ++WN +L
Sbjct: 1235 RPRKFIHAVCTHGYFDLGIAAVIALNVLCMALEHYQQPDGLTAFLKCANYVFTAVFILEAILKIFALGIKRYIKDRWNQLDMLIVILSIVGIALEEMTMELPINPTIIRVMRVLRIARVLKLLKTAEGIRKLLDTVAQALPQVGNLGMLFLLMFFIFSALGIELFGKIDCEKPGITCQGMDEHANFRSFGIAMLTLFRISTGDNWNGIL 1443          

HSP 7 Score: 82.0333 bits (201), Expect = 3.230e-15
Identity = 65/205 (31.71%), Postives = 105/205 (51.22%), Query Frame = 2
Query: 5366 VNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLR 5980
            V+SK+F   I G I +N +TM +E+Y  P ++   L+  NYIFT++F IE ++K I  G   YI D +N  D  IVI+SV  +  ++            I V R  R+ RV KL++    +R  L  +I  +  V     L  +  F  + LG+ LFG       +     +  A+F++   A +T+F++ T ++WN +M D +R
Sbjct:  408 VDSKWFMYVIMGAIFVNTLTMGIEYYGQPQKMTDVLEIFNYIFTAIFGIEMIMKLIGLGFYGYIKDAFNIFDGTIVIISVVELFGDDDSG---------ISVLRSFRLLRVFKLVRFLPALRRQLLVMIHTMDNVMTFLALLVIFMFTASILGMNLFGGKYRFPNDEGVMETSRANFDDLFWAIVTVFQVLTQEDWNIVMYDGMR 603          

HSP 8 Score: 75.8702 bits (185), Expect = 2.650e-13
Identity = 53/165 (32.12%), Postives = 94/165 (56.97%), Query Frame = 2
Query:  611 WFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMF---FAVELMIKICAMGL-LGPSGYFSESWNRLDMVIVIAGLIECI---PSTGEMSLTAI----RTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            WF++  +  I++NC+ + +  P         R       D C+++F   F +E+M+K+ A+GL +GP  Y    WN +D  +V+   ++ I    + G+ S+  +    R +R LRPLR I+R P ++I+V  L+ +L  +GN++L+    F IFGI+GVQ+++G
Sbjct:  932 WFDRTVLLFILLNCVVMALEGPSVLPGSLERRV-----IDICMYVFLGIFTIEMMVKVIALGLWIGPDAYLRSGWNVMDGFLVVISWVDVIVTATTNGQNSILGVLRVFRALRTLRPLRVISRAPGLKIVVETLISSLKPIGNIVLIAATFFIIFGILGVQLFKG 1091          

HSP 9 Score: 52.7582 bits (125), Expect = 2.436e-6
Identity = 31/128 (24.22%), Postives = 62/128 (48.44%), Query Frame = 2
Query:  578 RDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMR 961
            RD C   +   WF  + +  I VN +T+G+    E          +L  F++     F +E+++K+  +G     GY  +++N  D  IVI  ++E      +  ++ +R+ R+LR  + +  +P++R
Sbjct:  401 RDGCASSVDSKWFMYVIMGAIFVNTLTMGI----EYYGQPQKMTDVLEIFNYIFTAIFGIEMIMKLIGLGFY---GYIKDAFNIFDGTIVIISVVELF-GDDDSGISVLRSFRLLRVFKLVRFLPALR 520          

HSP 10 Score: 51.9878 bits (123), Expect = 3.901e-6
Identity = 23/64 (35.94%), Postives = 39/64 (60.94%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFS 1594
            NFD++ +A V +FQV++ E W  +MY    A S W   YF+ L+ IG++ + NL + ++   F+
Sbjct:  574 NFDDLFWAIVTVFQVLTQEDWNIVMYDGMRATSKWAGLYFILLMTIGNYILFNLLVAILVEGFA 637          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO35497 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLD1])

HSP 1 Score: 463.381 bits (1191), Expect = 3.650e-145
Identity = 292/528 (55.30%), Postives = 377/528 (71.40%), Query Frame = 2
Query: 4385 RFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMK 5968
            RFR   + +   + FD ++L FI  +C  LA+E P I ++  +R+ + I+  VFT+IF +EM IK++A GL++G  +YLR GW+V+DG LV++S  DI++      S  + G LRVFR LRTLRPLRVI RAPGLKLVVQTLL SL+PIGN VLI   FF++FGI GVQLFKGKFYYC G   +HV +  EC N  R  W N++YNFD+L QAL+SLFV+S+KDGWV+IM+ G+DAV V+ QP  NY EW L+YFI FLLL GF VLNM VGVVVENF +CRE           A+  R+ +K + +M    Y++ Y   RL IH +   + +D+ IA II +NVI M++E Y MP   +V +++ NY FTSVF+IE ++K IA G  RY  DRWN +D+ IV+LSV+GIV+E +       N T+IR  RVLRI RVLKL+K+AKG+R+LLDT+ +ALPQV NLGLLFFLLFFI++ LG++LFG LECS   PC G +RHAHF +FG A LTLFRIATGDNWNGI+K
Sbjct:    7 RFRQRMRAVCSHRAFDYVILVFIIFSCAVLAIEAPDIAEQGLKRQIIDISMLVFTIIFTIEMLIKLVAMGLVLGPGTYLRDGWDVLDGFLVMVSWIDIIVTYTSHVSPEVLGTLRVFRALRTLRPLRVIRRAPGLKLVVQTLLYSLKPIGNTVLIAAIFFVMFGILGVQLFKGKFYYCEGD--SHVISKQECANSTRGQWVNRRYNFDDLLQALISLFVVSTKDGWVEIMHHGIDAVDVDVQPIVNYAEWRLVYFIPFLLLGGFLVLNMIVGVVVENFQRCRERM----DEEEQARPHRKGKKARNQMQDSLYYESYGPLRLKIHFICTHRNWDITIAAIICINVICMSLEHYKMP---QVFVETTNYFFTSVFVIEVVVKVIALGFVRYPKDRWNLIDLAIVLLSVTGIVLELLVKVDHLFNPTVIRTLRVLRITRVLKLVKLAKGVRSLLDTLFEALPQVPNLGLLFFLLFFIYSCLGIQLFGSLECSHDYPCQGFNRHAHFRDFGTAMLTLFRIATGDNWNGILK 525          

HSP 2 Score: 90.1225 bits (222), Expect = 4.489e-18
Identity = 80/311 (25.72%), Postives = 155/311 (49.84%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHN--QPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGL-LG---YISNGFNVFDGGIVILGLVELAQEGGA-------SGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXD---------------RKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQT----------SSWAALYFVALMTFGNYVLFNLLVAILVEGFS--TERVDEAKLAEKIHLEKHNEEKMANLMKHEAH 3334
            RFR++M+++ +HR F   IL+ I+ +   + IE  +  +  L    ++ S ++F  +F +EML+K++A GL LG   Y+ +G++V DG +V++  +++     +         L V R  R LR L+++R  P L+L +  +L ++  +     +  +F  +F ILG+ LF  KF   +                      R NFD LL A++++F + T++ W  ++  G+             + W  +YF+  +  G +++ N++V ++VE F    ER+DE + A      K    +M + + +E++
Sbjct:    7 RFRQRMRAVCSHRAFDYVILVFIIFSCAVLAIEAPDIAEQGLKRQIIDISMLVFTIIFTIEMLIKLVAMGLVLGPGTYLRDGWDVLDGFLVMVSWIDIIVTYTSHVSPEVLGTLRVFRALRTLRPLRVIRRAPGLKLVVQTLLYSLKPIGNTVLIAAIFFVMFGILGVQLFKGKFYYCEGDSHVISKQECANSTRGQWVNRRYNFDDLLQALISLFVVSTKDGWVEIMHHGIDAVDVDVQPIVNYAEWRLVYFIPFLLLGGFLVLNMIVGVVVENFQRCRERMDEEEQARPHRKGKKARNQMQDSLYYESY 317          

HSP 3 Score: 66.6254 bits (161), Expect = 9.902e-11
Identity = 61/221 (27.60%), Postives = 114/221 (51.58%), Query Frame = 2
Query: 4427 FDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFG--ILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTG 5083
            +D  +   I +N I +++E   +PQ      F+  TNY FT +F +E+ +KVIA G +     Y +  WN++D  +V++S+  I++ L++     +F   ++R  R+LR  R L+++  A G++ ++ TL  +L  + N+ L+    F I+   G+QLF                   EC++D      N+  +F + G A+++LF +++ D W  I+  G
Sbjct:  333 WDITIAAIICINVICMSLEHYKMPQV-----FVETTNYFFTSVFVIEVVVKVIALGFV----RYPKDRWNLIDLAIVLLSVTGIVLELLV-KVDHLFNPTVIRTLRVLRITRVLKLVKLAKGVRSLLDTLFEALPQVPNLGLLFFLLFFIYSCLGIQLFGSL----------------ECSHDYPCQGFNRHAHFRDFGTAMLTLFRIATGDNWNGILKVG 527          

HSP 4 Score: 65.4698 bits (158), Expect = 2.299e-10
Identity = 54/161 (33.54%), Postives = 91/161 (56.52%), Query Frame = 2
Query:  614 FEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGL-LGPSGYFSESWNRLDMVIVIAGLIECIPS-TGEMS------LTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            F+ + +  II +C  L +  P  D + + ++ +I+        + F +E++IK+ AMGL LGP  Y  + W+ LD  +V+   I+ I + T  +S      L   R +R LRPLR I R P ++++V  LL +L  +GN +L+    F +FGI+GVQ+++G
Sbjct:   21 FDYVILVFIIFSCAVLAIEAP--DIAEQGLKRQIIDISMLVFTIIFTIEMLIKLVAMGLVLGPGTYLRDGWDVLDGFLVMVSWIDIIVTYTSHVSPEVLGTLRVFRALRTLRPLRVIRRAPGLKLVVQTLLYSLKPIGNTVLIAAIFFVMFGILGVQLFKG 179          

HSP 5 Score: 54.6842 bits (130), Expect = 4.343e-7
Identity = 62/217 (28.57%), Postives = 108/217 (49.77%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILG--------LVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSS 3148
             R K+  I  HR +   I   I IN + M +E++  P +   T   +N  F  +F++E+++K++A G + Y  + +N+ D  IV+L         LV++      + +  LR  R+ R+LKLV+    +R  L  + + +  V     L  L  FI+S LG+ LFG   C      +  +R  +F     A++T+F+I T ++WN +L  G + T +
Sbjct:  320 LRLKIHFICTHRNWDITIAAIICINVICMSLEHYKMPQVFVET---TNYFFTSVFVIEVVVKVIALGFVRYPKDRWNLIDLAIVLLSVTGIVLELLVKVDHLFNPTVIRTLRVLRITRVLKLVKLAKGVRSLLDTLFEALPQVPNLGLLFFLLFFIYSCLGIQLFGSLECSHDYPCQGFNRHAHFRDFGTAMLTLFRIATGDNWNGILKVGPTNTVT 533          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO35498 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLD2])

HSP 1 Score: 283.493 bits (724), Expect = 9.290e-81
Identity = 175/340 (51.47%), Postives = 228/340 (67.06%), Query Frame = 2
Query:  611 WFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKC-SDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVS-CVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERM 1624
            WFE++S+ +I+VNCITL MY P  D  C+ +RC +L  F+  IF FF +E+++K+ AMG+ G  GY  ++WN+LD VI++ G+IE     G   LT IR  RVLRPLRAIN++PS+RILV LLLDTLPMLGNVLLL F VFF+FGI+GVQ+WQG LRNRC+   N +      N S +Y+     + + P  DF+CS     G+  C SDIP S +       R C    LP  +N+ +N S C +WN  Y  C     NP++G I+FDNI  AW+ IFQVI++E W D+MY VQD HSFW+W YF+ LI+IG+FF++NLCLVVI  QF ETK RE E M
Sbjct:    4 WFERISMVIILVNCITLAMYDPL-DKRCEKVRCNVLEKFEFFIFGFFLLEMVVKMVAMGVFGSHGYLQDTWNKLDFVIIVMGVIE-KSLQGSDYLTIIRAFRVLRPLRAINKVPSIRILVTLLLDTLPMLGNVLLLSFLVFFVFGIIGVQLWQGKLRNRCFASTNDTALLLSFNQSVFYK----PSFIQP--DFVCSGPTNTGMTSCLSDIPHSYL-----HGRQCT---LP-PENLTSNSSNCADWNSLYRDCREDGPNPFWGTISFDNIAIAWMVIFQVITLEGWSDVMYLVQDTHSFWNWIYFIILIVIGAFFLVNLCLVVITMQFQETKAREIELM 326          

HSP 2 Score: 209.534 bits (532), Expect = 6.146e-56
Identity = 133/269 (49.44%), Postives = 177/269 (65.80%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXD-RKNFDSLLWAIVTVFQ----------------------ILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEA 3259
            RFR   + +   R+F R I+IAIL+N + MG+E+HNQP  LT TLE +N++F  +F++EM++ +++ G++GY+S   N+FDG +V+L + EL  E G + LSV R+ RLLRI KLVR    +R QL+V+++TM +V TFF LL LF+F F+ILGM+LFG +F            R NFDS LWA+VTVFQ                      ILTQE+WN V+  GM  TS WAALYF+ALMT G YVLFNLLVAILVEGF++  V  A
Sbjct:  471 RFRAFCRRMAESRHFSRLIMIAILLNMICMGLEHHNQPQALTVTLEKTNIVFVTIFVLEMIINVISFGIMGYLSQLQNIFDGFVVVLSVTELLLENGYARLSVFRSIRLLRIFKLVR---PVRYQLLVVIRTMTSVVTFFGLLFLFMFAFAILGMNLFGGEFYFPNAENISVPARTNFDSFLWAMVTVFQVRRGSCHGDDVPYEKKIIAMVTILTQENWNQVMFKGMRATSYWAALYFIALMTVGYYVLFNLLVAILVEGFTSSGVGIA 736          

HSP 3 Score: 92.4337 bits (228), Expect = 1.432e-18
Identity = 88/337 (26.11%), Postives = 148/337 (43.92%), Query Frame = 2
Query: 4427 FDNIVLFFIALNCITLAMERPSIPQKSRER-EFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKF-------------------------------YYCSGP----------DVAH---------------VKNFSECNN------DKRNTWKNQQY---NFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            F+ I +  I +NCITLAM  P   +  + R   L    +     F +EM +K++A G+  G H YL+  WN +D +++V+         +I  S +    L + R  R LRPLR I++ P ++++V  LL +L  +GN++L+    F +FGI GVQL++GK                                + CSGP          D+ H                 N S C +      D R    N  +   +FDN+  A M +F + + +GW  +MY            Q+ ++ W  +YFI  +++  FF++N+ + V+   F + +  +
Sbjct:    5 FERISMVIILVNCITLAMYDPLDKRCEKVRCNVLEKFEFFIFGFFLLEMVVKMVAMGVF-GSHGYLQDTWNKLDFVIIVMG--------VIEKSLQGSDYLTIIRAFRVLRPLRAINKVPSIRILVTLLLDTLPMLGNVLLLSFLVFFVFGIIGVQLWQGKLRNRCFASTNDTALLLSFNQSVFYKPSFIQPDFVCSGPTNTGMTSCLSDIPHSYLHGRQCTLPPENLTSNSSNCADWNSLYRDCREDGPNPFWGTISFDNIAIAWMVIFQVITLEGWSDVMYL----------VQDTHSFWNWIYFIILIVIGAFFLVNLCLVVITMQFQETKARE 322          

HSP 4 Score: 86.6557 bits (213), Expect = 8.055e-17
Identity = 79/293 (26.96%), Postives = 146/293 (49.83%), Query Frame = 2
Query: 4382 NRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSS-RIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNND------------KRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVL-NMFVGVVVENF 5218
            +RFR  C+ + E + F  +++  I LN I + +E  + PQ       L  TN VF  IF +EM I VI+ G++     YL    N+ DG +VV+S+ +++  L  G++   +F  +R+ R+ + +RP+R       L +V++T+ S    +     +   F   F I G+ LF G+FY+   P+  ++   +  N D            +R +       ++   + ++++  + +++ W Q+M+ G+ A           + W  LYFI+ L+ VG++VL N+ V ++VE F
Sbjct:  470 HRFRAFCRRMAESRHFSRLIMIAILLNMICMGLEHHNQPQALTVT--LEKTNIVFVTIFVLEMIINVISFGIM----GYLSQLQNIFDGFVVVLSVTELL--LENGYARLSVFRSIRLLRIFKLVRPVRY-----QLLVVIRTMTS----VVTFFGLLFLFMFAFAILGMNLFGGEFYF---PNAENISVPARTNFDSFLWAMVTVFQVRRGSCHGDDVPYE---KKIIAMVTILTQENWNQVMFKGMRAT----------SYWAALYFIA-LMTVGYYVLFNLLVAILVEGF 728          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO46991 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNU9])

HSP 1 Score: 253.832 bits (647), Expect = 1.828e-67
Identity = 194/567 (34.22%), Postives = 309/567 (54.50%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNND--------------KRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIH--GLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVI---QALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIM---KDTLRNKCD 5992
            SLF+ S  N FR  C  +     F N +L  I ++   LA E P +   S+  + L   +Y FT +F +E+TIK+IA G+++ K S+ RS +N++D L+V +S+  I +      SS    ++R+ R+LR LRPLR I+RA GLK VVQ +  +++ IGNI+L+   F  +F + GVQLFKG F+ C+  D   +    EC                 K   W+ Q +NF+++ QA+++LF + + +GW  I+ + +D+  V++ P  N   W  +Y++ +++++ FF++N+FVG V+  F    E +      +       + +  +  +   P  ++ P  RL  H   +V S+ F+  I   I  N I + M++Y  P      L   N  FTSVF++E ++K  A+ PK Y +DRWN  D ++V+ SV  I M E+ ++     M     FR+ R  R++KLL    GI+ LL T I   QALP VG   LL  + FFI+A +G+++FGR+     +P T ++R+ +F+ F  + + LFR ATG+NW  IM    DT   KCD
Sbjct:  812 SLFIFSNTNCFRVVCHRIATNSYFVNFILLLIIVSSCMLAAEDP-LNSNSKRNQVLNYFDYFFTAVFTIEITIKIIAYGVILHKGSFCRSAFNLLDFLVVAVSIVSIAL----RDSSSQISVVRILRVLRVLRPLRAINRAKGLKHVVQCVFVAVKTIGNIMLVTVLFNFLFAVIGVQLFKGTFFSCT--DAEKITK-RECQGQYIEFKGPGLTNPVVKDREWQPQTFNFNDVPQAMLTLFTVMTFEGWPGILESSMDSTDVDEGPFLNNRPWVAIYYVIYIIIIAFFMINIFVGFVIVTFQNEGEEE-----FKDCELDKNQRKCVEFALKARPTRRYIPTNRLQFHVWRVVTSQPFEYLIFAFITGNTILLMMQYYNEPKLYTRVLDGFNIGFTSVFLLECILKLFAFKPKNYFLDRWNLFDFVVVVGSVVDITMNEVSSE----QMFAFGFFRLFRALRLVKLLNQGSGIKTLLWTFIKSFQALPYVG---LLIIMTFFIYAVVGMQMFGRIAI---DPETQINRNNNFQTFPQSLMVLFRSATGENWQLIMLACTDTPNAKCD 1355          

HSP 2 Score: 146.747 bits (369), Expect = 7.262e-35
Identity = 100/318 (31.45%), Postives = 165/318 (51.89%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLME-------KKVFDNIVLFFIALNCITLAMERPSIPQK--SREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSE---CNNDKRN--------------TWKNQQY---NFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHK 5224
            +LF L+  N  R++  +L         +  FD ++L  I  NC  LA  +P +P++  S   E L +  +VF  IF +E  +K+IA G ++   +YLR+GWN++D ++VV+ LA I++ L    S  +    +  R  R LRPLR++S  P L++V+ +++ +L P+ +I L+     II+ I GV+LF GK +     +V     F E   C+ +                  W+   Y   NFDN+G A +++F   + +GW  +MY+  DA+G         N W  LYF++ ++   FFVLN+ +GV+   F K
Sbjct:   46 ALFCLTLGNPIRSTAISLFTVFFLDVFRTPFDVMILITIFANCAALAAFQP-LPEQDSSLINEELEVAEFVFLGIFTMESVLKIIAYGFVMHPGAYLRNGWNILDFVIVVVGLATIIVKLYTPDSFDV----KALRAFRVLRPLRLVSGVPSLQVVLNSIIKALIPLFHIALLVVFVVIIYAIIGVELFMGKLHSTCYDNVTGQPTFDEPHPCSTESEGYSCSNAGPGQVCLKKWEGPNYGITNFDNIGLACLTVFQCITLEGWTDVMYSINDAIG---------NSWPWLYFVTLIIWGSFFVLNLVLGVLSGEFAK 349          

HSP 3 Score: 138.658 bits (348), Expect = 2.272e-32
Identity = 96/250 (38.40%), Postives = 148/250 (59.20%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVEL----AQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQ----TSSWAA---LYFVALMTFGNYVLFNLLVAILVEGFS 3238
            R R+  +  V  ++F   +++ + +N+L++ +E++NQP  LT  L+ +N +F  LF +EM++K+   G  GY ++ FN FD  +VI  L+EL    A +    G+S+LR  RLLRI K+ R+  +L   +  +L +M ++     LL LF+ IFS+LGM +      KF  G     R NFDS   A+VTVFQILT EDWNAV+ +G+      T S +A   LYF+ L+  GNY+L N+ +AI V+  +
Sbjct:  446 RLRRSCRKAVKTQWFYWTVIVFVFLNSLTLALEHYNQPEFLTQFLDKANKLFLALFTLEMVVKMYCLGFHGYFASLFNRFDCLVVISSLLELGLTEAMDQRPIGISMLRCVRLLRIFKVTRYWSSLSNLVASLLNSMRSIMGLLLLLSLFMVIFSLLGMQI---FGGKFNLGDEDVPRSNFDSFWRALVTVFQILTGEDWNAVMYTGIQSWGGITESLSAIPILYFIFLVVVGNYILLNVFLAIAVDNLA 692          

HSP 4 Score: 130.568 bits (327), Expect = 5.652e-30
Identity = 100/337 (29.67%), Postives = 158/337 (46.88%), Query Frame = 2
Query:  614 FEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMG-LLGPSGYFSESWNRLDMVIVIAGLIECIP---STGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDA-HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKR 1609
            F+ + +  I  NC  L  ++P  +     I  + L   +      F +E ++KI A G ++ P  Y    WN LD VIV+ GL   I    +     + A+R  RVLRPLR ++ +PS+++++  ++  L  L ++ LL  FV  I+ I+GV+++ G L + CY ++      P  +               PH    CS ++                    E   C+++        P  V    W             P YG  NFDNIG A + +FQ I++E W D+MY + DA  + W W YFV+LII GSFF++NL L V++ +F++ K R
Sbjct:   76 FDVMILITIFANCAALAAFQPLPEQDSSLINEE-LEVAEFVFLGIFTMESVLKIIAYGFVMHPGAYLRNGWNILDFVIVVVGLATIIVKLYTPDSFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKALIPLFHIALLVVFVVIIYAIIGVELFMGKLHSTCYDNVTG---QPTFD--------------EPHP---CSTES--------------------EGYSCSNAG-------PGQVCLKKWE-----------GPNYGITNFDNIGLACLTVFQCITLEGWTDVMYSINDAIGNSWPWLYFVTLIIWGSFFVLNLVLGVLSGEFAKEKAR 353          

HSP 5 Score: 95.9005 bits (237), Expect = 2.145e-19
Identity = 84/279 (30.11%), Postives = 146/279 (52.33%), Query Frame = 2
Query: 4382 NRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVG-FFVLNMFVGVVVEN 5215
            +R R SC+  ++ + F   V+ F+ LN +TLA+E  + P+   +  FL   N +F  +F +EM +K+   G     H Y  S +N  D L+V+ SL ++ +   +        +LR  RLLR  +  R  S    L  +V +LL+S+R I  ++L+   F +IF + G+Q+F GKF            N  + +  + N        FD+  +AL+++F + + + W  +MYTG+ + G      E+ +   +LYFI FL++VG + +LN+F+ + V+N
Sbjct:  445 HRLRRSCRKAVKTQWFYWTVIVFVFLNSLTLALEHYNQPEFLTQ--FLDKANKLFLALFTLEMVVKMYCLGF----HGYFASLFNRFDCLVVISSLLELGLTEAMDQRPIGISMLRCVRLLRIFKVTRYWS---SLSNLVASLLNSMRSIMGLLLLLSLFMVIFSLLGMQIFGGKF------------NLGDEDVPRSN--------FDSFWRALVTVFQILTGEDWNAVMYTGIQSWG---GITESLSAIPILYFI-FLVVVGNYILLNVFLAIAVDN 690          

HSP 6 Score: 72.7886 bits (177), Expect = 2.194e-12
Identity = 75/289 (25.95%), Postives = 131/289 (45.33%), Query Frame = 2
Query: 4376 PDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGV----NQQPQEN----YNEWYLLYFISFLLLVGFFVLNMFVGVVVENF 5218
            P NR +     ++  + F+ ++  FI  N I L M+  + P+       L   N  FT +F +E  +K+ A        +Y    WN+ D ++VV S+ DI +  +       FG    FRL R LR ++++++  G+K ++ T + S + +  + L+    F I+ + G+Q+F G+      P+                T  N+  NF    Q+LM LF  ++ + W  IM    D        N  PQ+       ++   YF SF  +  F ++N+FV V+++NF
Sbjct: 1139 PTNRLQFHVWRVVTSQPFEYLIFAFITGNTILLMMQYYNEPKLYTR--VLDGFNIGFTSVFLLECILKLFA----FKPKNYFLDRWNLFDFVVVVGSVVDITMNEVSSEQMFAFGF---FRLFRALRLVKLLNQGSGIKTLLWTFIKSFQALPYVGLLIIMTFFIYAVVGMQMF-GRI--AIDPE----------------TQINRNNNFQTFPQSLMVLFRSATGENWQLIMLACTDTPNAKCDPNAYPQDTDGLCGTDFAYAYFCSFYAICSFLIINLFVAVIMDNF 1399          

HSP 7 Score: 71.2478 bits (173), Expect = 5.721e-12
Identity = 75/305 (24.59%), Postives = 123/305 (40.33%), Query Frame = 2
Query: 2564 FQRGILIAILINTLSMGIEYHNQPV------LLTNTLEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVEL------AQEGGASGLSVLRTFRLLRILKLV------------RFMPALRLQLIVMLKTM-------------------DNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR---KNFDSLLWAIVTVFQILTQEDWNAVLIS-GMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKH 3325
            F   ILI I  N  ++      QP+      L+   LE +  +F G+F +E +LKI+A G +     Y+ NG+N+ D  IV++GL  +              L   R  R LR++  V              +P   + L+V+   +                   DNV                 G S       +    K +       NFD++  A +TVFQ +T E W  V+ S   +  +SW  LYFV L+ +G++ + NL++ +L   F+ E+    K  E    +K  E+++ +   H
Sbjct:   76 FDVMILITIFANCAALA---AFQPLPEQDSSLINEELEVAEFVFLGIFTMESVLKIIAYGFVMHPGAYLRNGWNILDFVIVVVGLATIIVKLYTPDSFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKALIPLFHIALLVVFVVIIYAIIGVELFMGKLHSTCYDNVTGQPTFDEPHPCSTESEGYSCSNAGPGQVCLKKWEGPNYGITNFDNIGLACLTVFQCITLEGWTDVMYSINDAIGNSWPWLYFVTLIIWGSFFVLNLVLGVLSGEFAKEKARAQKSGE---FQKLREKQLVDDAYH 374          

HSP 8 Score: 68.1662 bits (165), Expect = 5.050e-11
Identity = 60/196 (30.61%), Postives = 101/196 (51.53%), Query Frame = 2
Query:  497 NTEKNKDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSES-WNRLDMVIVIAGLIECI--PSTGEMSLTAI-RTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            +TE     P P  PE   F  + T+  R  C +  +  +F    + +IIV+   L    P    S    R ++L  FD+     F +E+ IKI A G++   G F  S +N LD ++V   ++      S+ ++S+  I R +RVLRPLRAINR   ++ +V  +   +  +GN++L+     F+F ++GVQ+++G
Sbjct:  798 STEVMDHEPMP--PESSLFIFSNTNCFRVVCHRIATNSYFVNFILLLIIVSSCMLAAEDPLNSNSK---RNQVLNYFDYFFTAVFTIEITIKIIAYGVILHKGSFCRSAFNLLDFLVVAVSIVSIALRDSSSQISVVRILRVLRVLRPLRAINRAKGLKHVVQCVFVAVKTIGNIMLVTVLFNFLFAVIGVQLFKG 988          

HSP 9 Score: 65.4698 bits (158), Expect = 3.157e-10
Identity = 63/244 (25.82%), Postives = 125/244 (51.23%), Query Frame = 2
Query: 5327 KFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVI 6058
            +F+   R      V +++F   +   + LN +T+A+E Y  P  L   L   N +F ++F +E ++K    G   Y    +N+ D L+VI S+  + + E  ++  PI ++++R  R+LRI    K+ +    +  L+ +++ ++  +  L LL  L   IF+ LG+++FG      +N        ++F++F  A +T+F+I TG++WN +M   +++    +E    +    PI+  I+ V+
Sbjct:  442 RFHHRLRRSCRKAVKTQWFYWTVIVFVFLNSLTLALEHYNQPEFLTQFLDKANKLFLALFTLEMVVKMYCLGFHGYFASLFNRFDCLVVISSLLELGLTEAMDQR-PIGISMLRCVRLLRI---FKVTRYWSSLSNLVASLLNSMRSIMGLLLLLSLFMVIFSLLGMQIFG----GKFNLGDEDVPRSNFDSFWRALVTVFQILTGEDWNAVMYTGIQSWGGITE----SLSAIPILYFIFLVV 673          

HSP 10 Score: 60.077 bits (144), Expect = 1.698e-8
Identity = 61/261 (23.37%), Postives = 127/261 (48.66%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGAS----GLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLIS-------------------GMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGF 3235
            R +  +  +V  + F+  I   I  NT+ + ++Y+N+P L T  L+  N+ F  +FL+E +LK+ A     Y  + +N+FD  +V+  +V++     +S         R FR LR++KL+     ++  L   +K+   +     L+I+  FI++++GM +FG      +    + +  NF +   +++ +F+  T E+W  ++++                   G+  T  +A  YF +     ++++ NL VA++++ F
Sbjct: 1142 RLQFHVWRVVTSQPFEYLIFAFITGNTILLMMQYYNEPKLYTRVLDGFNIGFTSVFLLECILKLFAFKPKNYFLDRWNLFDFVVVVGSVVDITMNEVSSEQMFAFGFFRLFRALRLVKLLNQGSGIKTLLWTFIKSFQALPYVGLLIIMTFFIYAVVGMQMFGRIAIDPETQINRNN--NFQTFPQSLMVLFRSATGENWQLIMLACTDTPNAKCDPNAYPQDTDGLCGT-DFAYAYFCSFYAICSFLIINLFVAVIMDNF 1399          

HSP 11 Score: 55.8398 bits (133), Expect = 2.910e-7
Identity = 58/210 (27.62%), Postives = 105/210 (50.00%), Query Frame = 2
Query: 5456 ELEVALKSLNYIFTSVFIIEALIKTIAYG----PKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELF-GRLECSDYN------------PCTGLSRH-----------------------AHFENFGMAFLTLFRIATGDNWNGIM 5965
            ELEVA     ++F  +F +E+++K IAYG    P  Y+ + WN LD +IV++ ++ I+++     Y P +   ++  R  R+ R L+L+     ++ +L+++I+AL  + ++ LL   +  I+A +GVELF G+L  + Y+            PC+  S                          +F+N G+A LT+F+  T + W  +M
Sbjct:  108 ELEVA----EFVFLGIFTMESVLKIIAYGFVMHPGAYLRNGWNILDFVIVVVGLATIIVK----LYTPDSFD-VKALRAFRVLRPLRLVSGVPSLQVVLNSIIKALIPLFHIALLVVFVVIIYAIIGVELFMGKLHSTCYDNVTGQPTFDEPHPCSTESEGYSCSNAGPGQVCLKKWEGPNYGITNFDNIGLACLTVFQCITLEGWTDVM 308          

HSP 12 Score: 53.9138 bits (128), Expect = 1.018e-6
Identity = 34/121 (28.10%), Postives = 63/121 (52.07%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYH-NQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVR 2872
            FR     I  + YF   IL+ I++++  +  E   N        L Y +  F  +F +E+ +KI+A G++     +  + FN+ D  +V + +V +A    +S +SV+R  R+LR+L+ +R
Sbjct:  822 FRVVCHRIATNSYFVNFILLLIIVSSCMLAAEDPLNSNSKRNQVLNYFDYFFTAVFTIEITIKIIAYGVILHKGSFCRSAFNLLDFLVVAVSIVSIALRDSSSQISVVRILRVLRVLRPLR 942          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO35661 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKR1])

HSP 1 Score: 230.72 bits (587), Expect = 1.573e-60
Identity = 206/613 (33.61%), Postives = 341/613 (55.63%), Query Frame = 2
Query: 4391 RNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYC--SGPD---VAHVKNFSEC-NNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXX---------XXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKS-LNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNK--CD-NSEECQKNCCVSPIIAPIY---FVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIE 6163
            R   + L+E KVF+ I+LF IA + I+LA E   +  K   ++ L I N +F VIF VEM +K I  G      +Y  + WN++D ++V++S   IM+ L     +     +R  R LR  RPLR ISR  G+K+V+ +LL ++  IGN++L+C  F++IF I GVQ+F GKF  C   G +    + V N + C +N  R  W+N   NFD + Q  ++L  +++ +GW++IM   +DA  +++QP E  N    L+F+ F++L  FF LN+F+GV+++NF++ ++  E                         KK KK ++ P  KF       ++ +V S+ F++ I   I +N++ M ++ Y     L V  K  LN IFTSVFI+EA+++ IA   K Y ++ WN  D +IVI S+ GI++E ++   + IN +++RV RV R+ R+L+  + A+GIR LL +++ + P + N+G L FL+ FI+A +G+ +FG ++ ++      L+   +FE FG +F+ LFR+ T   WN I+   + ++  CD N        C +  +APIY   FV+ + +    +   V+      + E  K+   +++IE
Sbjct:  817 RYKVRRLVEHKVFEGIILFLIAASSISLAFEDVYLDSKPTLKQVLQILNILFAVIFTVEMLLKWIGLGF----KTYFTNPWNILDFVIVIVS---IMVSLATIFGNDQIAFIRSLRTLRAFRPLRAISRFEGMKVVITSLLHAIPGIGNVLLVCLMFWLIFSIMGVQIFGGKFGKCVDEGGEKCPASVVPNKTVCLSNGYR--WENSNINFDTVDQGFLALLQVATFEGWMEIMEDAVDATKIDEQPIEENNVSAYLFFVVFIILGTFFTLNLFIGVIIDNFNQLKQQMEAVGSMDVFLTSTQRNWMNALKSAATKKPKKRIRRPQNKFQGE----LYDMVQSRKFEVFIMLFITINMVVMMVQHYD---HLAVWSKQILNLIFTSVFILEAILRIIAL-RKGYFLNPWNVFDFVIVISSIIGIIVENLQTSLV-INPSLLRVVRVFRVGRLLRFFEAARGIRRLLFSLVISTPALFNIGALLFLIIFIYAIIGMSIFGHVKKTE-----ALNDVVNFETFGSSFVLLFRLMTSAGWNDILDPLMISEPDCDPNYRGLPSGNCGNKYMAPIYLGSFVVIIFLILINMYIAVILENYNQVMEQEKIGITNEDIE 1406          

HSP 2 Score: 103.605 bits (257), Expect = 9.863e-22
Identity = 95/345 (27.54%), Postives = 155/345 (44.93%), Query Frame = 2
Query:  638 IIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGL-LGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFS---ETKKRETERMLMERKKQQSTST 1660
            I+VNC+ L M  P E               ++     + +E+  KI A G  L    Y  + WN LD ++VI G +   P    +S   I T RV R LR I+ +  ++ +V  LL ++ ML +V++L  F   IF ++G+Q++ G LRN+C L +         NLS  Y+   + +                          S+ +L   E  +C ++    S   PTN +C+              NP +G  +FD+ G+A +  FQ+I+++ W ++   V      W   YF  +I  G FF++NL L V+A  +    +  K ETE    ERK+Q+  ++
Sbjct:   60 ILVNCVFLAMTNPPEQP-------------EYVFAAIYTIEMFCKIIAKGFALHRYAYLRDKWNWLDFIVVILGNVTISPDVANLS--GIPTFRVFRALRTISAVKGLKAMVNTLLVSMKMLWDVMVLTLFFICIFALIGMQLFIGELRNKCALPVPE-------NLSVPYRTYASNS--------------------------SIWYLEDNEPILCGNTT--GSRTCPTNYTCL---------PHAGGNPNFGYTSFDHFGWALLTGFQLITLDFWENVYNNVIYTMGPWYVVYFAVVIFFGPFFLVNLVLAVVAASYENEVKASKMETEE---ERKEQKRVAS 342          

HSP 3 Score: 102.449 bits (254), Expect = 2.215e-21
Identity = 72/215 (33.49%), Postives = 114/215 (53.02%), Query Frame = 2
Query: 2576 ILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVE-----LAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFN 3205
            I++ IL+NTL M IE+      L   +  SN +F  +FL+EM+LK++A G LGYI   +N+FDG +VI+ +V+        + G +G+SVLRTFRLLR+LKL +    +   L  + K++  +     +L + ++IF+++GM L                R NF     + + +F++L  E W   L   M  T   A L FV     GN+++ N
Sbjct:  509 IIVCILLNTLVMSIEHPRLEDPLLTVVNISNEVFTFIFLLEMILKLIALGFLGYIRVAWNIFDGIVVIISIVDFIVNKFVPDAGGTGISVLRTFRLLRVLKLAKSWSTMNSLLATIGKSLGALGNLTVILAIIVYIFAVMGMQL-LGNSYTPDKFGGSIPRWNFKDFPHSFMMIFRVLCGE-WIEPLWDCMLATGPVAMLLFVPAFILGNFIILN 721          

HSP 4 Score: 89.3521 bits (220), Expect = 1.996e-17
Identity = 88/338 (26.04%), Postives = 151/338 (44.67%), Query Frame = 2
Query: 4328 SKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNI------VLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKF-----------------YYCSGPDVAHVKNFSE--CNNDKRNTWKNQQY---------------NFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            ++ +R +   SL++  P+N  R     L+  +    +      VL  I +NC+ LAM  P  P++           YVF  I+ +EM  K+IAKG  + +++YLR  WN +D   +V+ L ++ I   + + S I    RVFR LRT      IS   GLK +V TLL S++ + +++++   F  IF + G+QLF G+                   Y S   + ++++     C N   +      Y               +FD+ G AL++ F L + D W  +    +  +G           WY++YF   +    FF++N+ + VV  ++ 
Sbjct:   13 TQVYRFNRSKSLYLFGPENPIRQFSLKLITNQYPLQLHNRHMFVLLTILVNCVFLAMTNP--PEQPE---------YVFAAIYTIEMFCKIIAKGFALHRYAYLRDKWNWLD--FIVVILGNVTISPDVANLSGI-PTFRVFRALRT------ISAVKGLKAMVNTLLVSMKMLWDVMVLTLFFICIFALIGMQLFIGELRNKCALPVPENLSVPYRTYASNSSIWYLEDNEPILCGNTTGSRTCPTNYTCLPHAGGNPNFGYTSFDHFGWALLTGFQLITLDFWENVYNNVIYTMG----------PWYVVYFAVVIFFGPFFLVNLVLAVVAASYE 320          

HSP 5 Score: 70.4774 bits (171), Expect = 1.127e-11
Identity = 49/146 (33.56%), Postives = 79/146 (54.11%), Query Frame = 2
Query: 4421 KVFDNIVLFFIALNCITLAMERPSIPQKSREREFLT---ITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRI-FGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVL 4846
            KV +  ++  I LN + +++E P +     E   LT   I+N VFT IF +EM +K+IA G L     Y+R  WN+ DG++V+IS+ D ++   +  +      +LR FRLLR L+  +  S    L   + T+  SL  +GN+ +
Sbjct:  503 KVMEIFIIVCILLNTLVMSIEHPRL-----EDPLLTVVNISNEVFTFIFLLEMILKLIALGFL----GYIRVAWNIFDGIVVIISIVDFIVNKFVPDAGGTGISVLRTFRLLRVLKLAKSWSTMNSL---LATIGKSLGALGNLTV 636          

HSP 6 Score: 66.2402 bits (160), Expect = 2.218e-10
Identity = 60/196 (30.61%), Postives = 104/196 (53.06%), Query Frame = 2
Query: 5369 NSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIP-INMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNP--CTGLSRHAHFENFGMAFLTLFRIATGD 5947
            N K  ++ I   I LN + M++E   +   L   +   N +FT +F++E ++K IA G   YI   WN  D     + V   +++ + NK++P    T I V R  R+ RVLKL K    + +LL T+ ++L  +GNL ++  ++ +IFA +G++L G    + Y P    G     +F++F  +F+ +FR+  G+
Sbjct:  501 NGKVMEIFIIVCILLNTLVMSIEHPRLEDPLLTVVNISNEVFTFIFLLEMILKLIALGFLGYIRVAWNIFD----GIVVIISIVDFIVNKFVPDAGGTGISVLRTFRLLRVLKLAKSWSTMNSLLATIGKSLGALGNLTVILAIIVYIFAVMGMQLLG----NSYTPDKFGGSIPRWNFKDFPHSFMMIFRVLCGE 688          

HSP 7 Score: 60.4622 bits (145), Expect = 1.056e-8
Identity = 39/118 (33.05%), Postives = 65/118 (55.08%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIE--YHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILG-LVELAQEGGASGLSVLRTFRLLRILKLVR 2872
            R K++ +V H+ F+  IL  I  +++S+  E  Y +    L   L+  N++F  +F VEMLLK +  G   Y +N +N+ D  IVI+  +V LA   G   ++ +R+ R LR  + +R
Sbjct:  817 RYKVRRLVEHKVFEGIILFLIAASSISLAFEDVYLDSKPTLKQVLQILNILFAVIFTVEMLLKWIGLGFKTYFTNPWNILDFVIVIVSIMVSLATIFGNDQIAFIRSLRTLRAFRPLR 934          

HSP 8 Score: 58.5362 bits (140), Expect = 4.232e-8
Identity = 51/157 (32.48%), Postives = 87/157 (55.41%), Query Frame = 2
Query:  614 FEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGL---IECIPSTGEMS-LTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            FE + + +I  + I+L       D+  K    ++L   +    + F VE+++K   +G      YF+  WN LD VIVI  +   +  I    +++ + ++RT+R  RPLRAI+R   M++++  LL  +P +GNVLL+C   + IF I+GVQ++ G
Sbjct:  829 FEGIILFLIAASSISLAFEDVYLDS--KPTLKQVLQILNILFAVIFTVEMLLKWIGLGF---KTYFTNPWNILDFVIVIVSIMVSLATIFGNDQIAFIRSLRTLRAFRPLRAISRFEGMKVVITSLLHAIPGIGNVLLVCLMFWLIFSIMGVQIFGG 980          

HSP 9 Score: 53.9138 bits (128), Expect = 1.155e-6
Identity = 69/305 (22.62%), Postives = 136/305 (44.59%), Query Frame = 2
Query: 4376 PDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMER-PSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMD-----GLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQ---------PQENYNEWYL--LYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            P N+F+    ++++ + F+  ++ FI +N + + ++    +   S++     I N +FT +F +E  +++IA      +  Y  + WNV D       ++ I + ++   L+I  S       RV R+ R  R LR    A G++ ++ +L+ S   + NI              G  LF   F Y        +   S   + K+    N   NF+  G + + LF L +  GW  I    LD + +++          P  N    Y+  +Y  SF++++   ++NM++ V++EN+++  E +
Sbjct: 1132 PQNKFQGELYDMVQSRKFEVFIMLFITINMVVMMVQHYDHLAVWSKQ-----ILNLIFTSVFILEAILRIIAL-----RKGYFLNPWNVFDFVIVISSIIGIIVENLQTSLVINPSLL-----RVVRVFRVGRLLRFFEAARGIRRLLFSLVISTPALFNI--------------GALLFLIIFIYA-------IIGMSIFGHVKKTEALNDVVNFETFGSSFVLLFRLMTSAGWNDI----LDPLMISEPDCDPNYRGLPSGNCGNKYMAPIYLGSFVVIIFLILINMYIAVILENYNQVMEQE 1396          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Medaka
Match: cacna1ha (voltage-dependent T-type calcium channel subunit alpha-1H [Source:NCBI gene;Acc:101161560])

HSP 1 Score: 609.372 bits (1570), Expect = 2.481e-179
Identity = 391/632 (61.87%), Postives = 483/632 (76.42%), Query Frame = 2
Query: 4313 WCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNK-YIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQ---KNC-CVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEE 6193
            WC       + H   SL++  P++ FR+ CQ ++  K+FD++VLFFI LNCIT+AMERP I   S ER FL+ +NY+FTVIF +EM IKV+A G   GK  YL+  WN++DGLLV +SL D+++ +     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL++SLRPIGNIVLICCTFFI+FGI GVQLFKGKFY C G D  +V N S+C       W N++YNFDNL +ALMSLFVLS KDGWV IMY GLDAVGV+QQP  N+N W L+YFISFLL+V FFVLNMFVGVVVENFHKCR++QE+EE   R  KR + ++KK+++ MQ PY+  Y   RL IH L  + Y DL I  I+G+N++TM++E Y     L+ ALK  NY+FT +F +EAL+K +A+G  R+  D+WNQLDV IV LS+ GIV+EE+  K  +PIN TIIR+ RVLRIARVLKLLKMAKG+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG+L+C+D NPC GLSRHA FENFGMAFLTLFR++TGDNW+GIMKDTLR       ECQ   +NC      ++P YFV FVL+AQFVLVNVVVAVLMKHLEES+K   +D E++ E+  E++ E
Sbjct: 1084 WC-------KEHEDCSLYLFDPESWFRSCCQRVISHKLFDHVVLFFIFLNCITIAMERPDIKPHSLERLFLSASNYIFTVIFLIEMAIKVVALGFCFGKQCYLQCSWNILDGLLVFVSLLDVLVSIAYVGENKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCTFFIVFGILGVQLFKGKFYICEGFDTRNVTNKSDCLQANYR-WTNRKYNFDNLFKALMSLFVLSCKDGWVNIMYDGLDAVGVDQQPVRNHNPWMLIYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQEEEEARLREDKRQKMIDKKRRRAMQRPYYADYSPVRLYIHRLCTNHYLDLFITLIVGINILTMSVEHYNQQQYLKEALKDCNYVFTFIFFVEALLKLVAFGIHRFFKDKWNQLDVAIVALSILGIVLEELNMKGALPINPTIIRIMRVLRIARVLKLLKMAKGMRALLDTVMQALPQVGNLGLLFMLLFFIYAALGVELFGKLKCTDINPCEGLSRHATFENFGMAFLTLFRVSTGDNWSGIMKDTLR-------ECQPDDRNCFAYLAWVSPFYFVTFVLIAQFVLVNVVVAVLMKHLEESNKEAKEDAEMDAEIALEMERE 1700          

HSP 2 Score: 347.051 bits (889), Expect = 1.860e-95
Identity = 208/393 (52.93%), Postives = 268/393 (68.19%), Query Frame = 2
Query:  629 IAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNV---------SCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
            + VI++NC+TLGM++PCED  C + RCK+L   D CIF FFAVE++IK+ A G+ G   Y ++ WN+LD VIV+AG++E        SL+AIRTVRVLRPLRAINR+PSMRILV LLLDTLPMLGNVL LCFFVFFIFGIVGVQ+W G+LRNRC+L  ++   +   +L  YY       +      FICS    NG++ C D+PPS     + +   C+ +A   S  +  +           CVNWNQYY+ C A   NP+ GA+NFDNIG+A +AIFQVI++E WVDIMY+V DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE   M  +R +  S+ ST  S  EP SCY EI++ IS   R L + + + Y R+  K
Sbjct:    1 MMVILLNCVTLGMFQPCEDVDCLSERCKVLQVLDDCIFAFFAVEMVIKMMAFGVFGSKCYLADRWNQLDFVIVMAGMLEYSLDGQNASLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLFLCFFVFFIFGIVGVQLWAGLLRNRCFLGEDTKVLY-NQSLKPYY-----VDEEGEDNPFICSTPRENGMLHCYDVPPS-----TEDGVECSLTASQQSSVLIGSFDSVAGASVNGCVNWNQYYNVCHAGEFNPHKGAVNFDNIGYASIAIFQVITLEGWVDIMYFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRENALMREQRARYMSSDSTFSSYTEPGSCYEEILRYISHLYRKLRRRLQRIYYRWHSK 382          

HSP 3 Score: 188.734 bits (478), Expect = 4.132e-47
Identity = 114/189 (60.32%), Postives = 142/189 (75.13%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXX-XXXXXXXXXXXXXDRKNFDSLLWAIVTVFQ 3088
            FR+ +++IV  +YF + I+ AILINT SMGIEYH QP  LT  LE +N +F  +F++EM   +LA GL GYI N +N+FD  +VI+ + E++ +    GLSVLRTFRLLR+LKLVRFMPALR QL+V++KTMDNVATF  LL+LFIF FSILGM LFG     + +NG    DRKNFDSLLWAIVTVFQ
Sbjct:  644 FRETLRTIVESKYFNQAIMTAILINTFSMGIEYHEQPEYLTQVLEITNFVFTSIFVLEMGFMLLAFGLWGYIKNPYNIFDSVVVIISVWEISAQADG-GLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFTFSILGMHLFGCKFGLRLENGDTIPDRKNFDSLLWAIVTVFQ 831          

HSP 4 Score: 78.9518 bits (193), Expect = 8.571e-14
Identity = 85/354 (24.01%), Postives = 167/354 (47.18%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIV---ILGLV--ELAQEGG----ASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQT-----SSWAALYFVALMTFGNYVLFNLLVAIL---------VEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNN----KNIAIIRKGSLNQKQVM--PIITHTDATPMPSPRASP 3499
            R  +  +  + Y    I + + IN L+M +E++NQ   L   L+  N +F  +F VE LLK++A G+  +  + +N  D  IV   ILG+V  EL  +G      + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C   N      R   F++   A +T+F++ T ++W+ ++   + +      + +A L +V+   F  +VL    V +          +E  + E  ++A++  +I LE   E+        +AH++  +++ S  +  + +       + ++++R  SL     M  P+   +   P+    A+P
Sbjct: 1420 RLYIHRLCTNHYLDLFITLIVGINILTMSVEHYNQQQYLKEALKDCNYVFTFIFFVEALLKLVAFGIHRFFKDKWNQLDVAIVALSILGIVLEELNMKGALPINPTIIRIMRVLRIARVLKLLKMAKGMRALLDTVMQALPQVGNLGLLFMLLFFIYAALGVELFGKLKCTDINPCEGLSRHATFENFGMAFLTLFRVSTGDNWSGIMKDTLRECQPDDRNCFAYLAWVSPFYFVTFVLIAQFVLVNVVVAVLMKHLEESNKEAKEDAEMDAEIALEMEREK--------DAHQSPGSSECSMEDKDQCVGEKLLSAETMSVLRMHSLPDDSYMFRPVRPASAPCPLEEVEANP 1765          

HSP 5 Score: 71.2478 bits (173), Expect = 1.902e-11
Identity = 46/134 (34.33%), Postives = 72/134 (53.73%), Query Frame = 2
Query: 4442 LFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGN 4837
            +  I LNC+TL M +P   +   S   + L + +      FAVEM IK++A G+  G   YL   WN +D    VI +A ++   + G ++ +  I    R +R LRPLR I+R P ++++V  LL +L  +GN
Sbjct:    1 MMVILLNCVTLGMFQPCEDVDCLSERCKVLQVLDDCIFAFFAVEMVIKMMAFGVF-GSKCYLADRWNQLD---FVIVMAGMLEYSLDGQNASLSAI----RTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGN 126          

HSP 6 Score: 69.707 bits (169), Expect = 4.713e-11
Identity = 50/174 (28.74%), Postives = 91/174 (52.30%), Query Frame = 2
Query: 4388 FRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKF 4909
            FR + + ++E K F+  ++  I +N  ++ +E    P+   +   L ITN+VFT IF +EM   ++A GL      Y+++ +N+ D ++V+IS+ +I        S++  G L V R  R LR L+++   P L+  +  L+ ++  +    ++   F   F I G+ LF  KF
Sbjct:  644 FRETLRTIVESKYFNQAIMTAILINTFSMGIEYHEQPEYLTQ--VLEITNFVFTSIFVLEMGFMLLAFGLW----GYIKNPYNIFDSVVVIISVWEI--------SAQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFTFSILGMHLFGCKF 803          

HSP 7 Score: 68.9366 bits (167), Expect = 8.486e-11
Identity = 73/235 (31.06%), Postives = 120/235 (51.06%), Query Frame = 2
Query: 5324 WKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFG-----RLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQK 6013
            WK   ++R  +  +V SKYF+ AI   I +N  +M +E++  P  L   L+  N++FTS+F++E     +A+G   YI + +N  D ++VI+SV  I  +          ++++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  F F+ LG+ LFG     RLE  D  P        +F++   A +T+F+   GD       D    K DNS+E +K
Sbjct:  641 WK---NFRETLRTIVESKYFNQAIMTAILINTFSMGIEYHEQPEYLTQVLEITNFVFTSIFVLEMGFMLLAFGLWGYIKNPYNIFDSVVVIISVWEISAQADG------GLSVLRTFRLL---RVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFTFSILGMHLFGCKFGLRLENGDTIP-----DRKNFDSLLWAIVTVFQ---GDANRSESDD--EKKSDNSDEDEK 853          

HSP 8 Score: 58.5362 bits (140), Expect = 1.214e-7
Identity = 51/173 (29.48%), Postives = 90/173 (52.02%), Query Frame = 2
Query:  578 RDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGL-LGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            R  C + IS   F+ + +  I +NCIT+ M +P  D    ++    L   ++   + F +E+ IK+ A+G   G   Y   SWN LD ++V   L++ + S   +    I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F +FGI+GVQ+++G
Sbjct: 1103 RSCCQRVISHKLFDHVVLFFIFLNCITIAMERP--DIKPHSLERLFLSASNYIFTVIFLIEMAIKVVALGFCFGKQCYLQCSWNILDGLLVFVSLLDVLVSIAYVGENKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCTFFIVFGILGVQLFKG 1273          

HSP 9 Score: 53.5286 bits (127), Expect = 4.100e-6
Identity = 31/94 (32.98%), Postives = 52/94 (55.32%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETK--KRETERMLMERKKQQ 1648
            NFDN+  A +++F +   + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + +  + E E  L E K+Q+
Sbjct: 1305 NFDNLFKALMSLFVLSCKDGWVNIMYDGLDAVGVDQQPVRNHNPWMLIYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQEEEEARLREDKRQK 1398          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Medaka
Match: cacna1ha (voltage-dependent T-type calcium channel subunit alpha-1H [Source:NCBI gene;Acc:101161560])

HSP 1 Score: 608.601 bits (1568), Expect = 8.768e-179
Identity = 391/632 (61.87%), Postives = 483/632 (76.42%), Query Frame = 2
Query: 4313 WCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNK-YIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQ---KNC-CVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEE 6193
            WC       + H   SL++  P++ FR+ CQ ++  K+FD++VLFFI LNCIT+AMERP I   S ER FL+ +NY+FTVIF +EM IKV+A G   GK  YL+  WN++DGLLV +SL D+++ +     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL++SLRPIGNIVLICCTFFI+FGI GVQLFKGKFY C G D  +V N S+C       W N++YNFDNL +ALMSLFVLS KDGWV IMY GLDAVGV+QQP  N+N W L+YFISFLL+V FFVLNMFVGVVVENFHKCR++QE+EE   R  KR + ++KK+++ MQ PY+  Y   RL IH L  + Y DL I  I+G+N++TM++E Y     L+ ALK  NY+FT +F +EAL+K +A+G  R+  D+WNQLDV IV LS+ GIV+EE+  K  +PIN TIIR+ RVLRIARVLKLLKMAKG+RALLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG+L+C+D NPC GLSRHA FENFGMAFLTLFR++TGDNW+GIMKDTLR       ECQ   +NC      ++P YFV FVL+AQFVLVNVVVAVLMKHLEES+K   +D E++ E+  E++ E
Sbjct: 1136 WC-------KEHEDCSLYLFDPESWFRSCCQRVISHKLFDHVVLFFIFLNCITIAMERPDIKPHSLERLFLSASNYIFTVIFLIEMAIKVVALGFCFGKQCYLQCSWNILDGLLVFVSLLDVLVSIAYVGENKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCTFFIVFGILGVQLFKGKFYICEGFDTRNVTNKSDCLQANYR-WTNRKYNFDNLFKALMSLFVLSCKDGWVNIMYDGLDAVGVDQQPVRNHNPWMLIYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQEEEEARLREDKRQKMIDKKRRRAMQRPYYADYSPVRLYIHRLCTNHYLDLFITLIVGINILTMSVEHYNQQQYLKEALKDCNYVFTFIFFVEALLKLVAFGIHRFFKDKWNQLDVAIVALSILGIVLEELNMKGALPINPTIIRIMRVLRIARVLKLLKMAKGMRALLDTVMQALPQVGNLGLLFMLLFFIYAALGVELFGKLKCTDINPCEGLSRHATFENFGMAFLTLFRVSTGDNWSGIMKDTLR-------ECQPDDRNCFAYLAWVSPFYFVTFVLIAQFVLVNVVVAVLMKHLEESNKEAKEDAEMDAEIALEMERE 1752          

HSP 2 Score: 347.051 bits (889), Expect = 2.162e-95
Identity = 208/393 (52.93%), Postives = 268/393 (68.19%), Query Frame = 2
Query:  629 IAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNV---------SCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEK 1777
            + VI++NC+TLGM++PCED  C + RCK+L   D CIF FFAVE++IK+ A G+ G   Y ++ WN+LD VIV+AG++E        SL+AIRTVRVLRPLRAINR+PSMRILV LLLDTLPMLGNVL LCFFVFFIFGIVGVQ+W G+LRNRC+L  ++   +   +L  YY       +      FICS    NG++ C D+PPS     + +   C+ +A   S  +  +           CVNWNQYY+ C A   NP+ GA+NFDNIG+A +AIFQVI++E WVDIMY+V DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE   M  +R +  S+ ST  S  EP SCY EI++ IS   R L + + + Y R+  K
Sbjct:    1 MMVILLNCVTLGMFQPCEDVDCLSERCKVLQVLDDCIFAFFAVEMVIKMMAFGVFGSKCYLADRWNQLDFVIVMAGMLEYSLDGQNASLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLFLCFFVFFIFGIVGVQLWAGLLRNRCFLGEDTKVLY-NQSLKPYY-----VDEEGEDNPFICSTPRENGMLHCYDVPPS-----TEDGVECSLTASQQSSVLIGSFDSVAGASVNGCVNWNQYYNVCHAGEFNPHKGAVNFDNIGYASIAIFQVITLEGWVDIMYFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRENALMREQRARYMSSDSTFSSYTEPGSCYEEILRYISHLYRKLRRRLQRIYYRWHSK 382          

HSP 3 Score: 290.812 bits (743), Expect = 2.976e-78
Identity = 195/398 (48.99%), Postives = 248/398 (62.31%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXX-XXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDREIFHQEMDSLSRKSQLMSNTDGESLGVPLVLQHDQRNLSRRGSDSSINHQPVGQQCRKTNCSPTRLHP 3715
            FR+ +++IV  +YF + I+ AILINT SMGIEYH QP  LT  LE +N +F  +F++EM   +LA GL GYI N +N+FD  +VI+ + E++ +    GLSVLRTFRLLR+LKLVRFMPALR QL+V++KTMDNVATF  LL+LFIF FSILGM LFG     + +NG    DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TS WAALYFVALMTFGNYVLFNLLVAILVEGF  E        +    E  +E+K  N     + ++++  + + IE    +    N  I   G+       PII  T ATPMP+P +S      I  +E+  L R+        G+      + Q +    SR GS +SI+     Q     + SP R  P
Sbjct:  644 FRETLRTIVESKYFNQAIMTAILINTFSMGIEYHEQPEYLTQVLEITNFVFTSIFVLEMGFMLLAFGLWGYIKNPYNIFDSVVVIISVWEISAQADG-GLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFTFSILGMHLFGCKFGLRLENGDTIPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAALYFVALMTFGNYVLFNLLVAILVEGFQAE-------GDANRSESDDEKKSDN-----SDEDEKLEQFTDIE----LEMTANGHIDACGT----TAPPIIMRTAATPMPTPTSS-LGPESILGEEL--LYREGTPKDGEVGQDFSNAGISQME----SRTGSSTSIDPSAFDQHSLSFS-SPGRRSP 1012          

HSP 4 Score: 94.7449 bits (234), Expect = 1.514e-18
Identity = 70/278 (25.18%), Postives = 136/278 (48.92%), Query Frame = 2
Query: 4388 FRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            FR + + ++E K F+  ++  I +N  ++ +E    P+   +   L ITN+VFT IF +EM   ++A GL      Y+++ +N+ D ++V+IS+ +I        S++  G L V R  R LR L+++   P L+  +  L+ ++  +    ++   F   F I G+ LF  KF          ++N     + K         NFD+L  A++++F + +++ W  ++Y G+ +           + W  LYF++ +    + + N+ V ++VE F 
Sbjct:  644 FRETLRTIVESKYFNQAIMTAILINTFSMGIEYHEQPEYLTQ--VLEITNFVFTSIFVLEMGFMLLAFGLW----GYIKNPYNIFDSVVVIISVWEI--------SAQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFTFSILGMHLFGCKFGL-------RLENGDTIPDRK---------NFDSLLWAIVTVFQILTQEDWNVVLYNGMAST----------SPWAALYFVALMTFGNYVLFNLLVAILVEGFQ 881          

HSP 5 Score: 78.5666 bits (192), Expect = 1.089e-13
Identity = 85/354 (24.01%), Postives = 167/354 (47.18%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIV---ILGLV--ELAQEGG----ASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQT-----SSWAALYFVALMTFGNYVLFNLLVAIL---------VEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNN----KNIAIIRKGSLNQKQVM--PIITHTDATPMPSPRASP 3499
            R  +  +  + Y    I + + IN L+M +E++NQ   L   L+  N +F  +F VE LLK++A G+  +  + +N  D  IV   ILG+V  EL  +G      + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C   N      R   F++   A +T+F++ T ++W+ ++   + +      + +A L +V+   F  +VL    V +          +E  + E  ++A++  +I LE   E+        +AH++  +++ S  +  + +       + ++++R  SL     M  P+   +   P+    A+P
Sbjct: 1472 RLYIHRLCTNHYLDLFITLIVGINILTMSVEHYNQQQYLKEALKDCNYVFTFIFFVEALLKLVAFGIHRFFKDKWNQLDVAIVALSILGIVLEELNMKGALPINPTIIRIMRVLRIARVLKLLKMAKGMRALLDTVMQALPQVGNLGLLFMLLFFIYAALGVELFGKLKCTDINPCEGLSRHATFENFGMAFLTLFRVSTGDNWSGIMKDTLRECQPDDRNCFAYLAWVSPFYFVTFVLIAQFVLVNVVVAVLMKHLEESNKEAKEDAEMDAEIALEMEREK--------DAHQSPGSSECSMEDKDQCVGEKLLSAETMSVLRMHSLPDDSYMFRPVRPASAPCPLEEVEANP 1817          

HSP 6 Score: 76.2554 bits (186), Expect = 5.748e-13
Identity = 68/223 (30.49%), Postives = 119/223 (53.36%), Query Frame = 2
Query: 5324 WKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFG-----RLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            WK   ++R  +  +V SKYF+ AI   I +N  +M +E++  P  L   L+  N++FTS+F++E     +A+G   YI + +N  D ++VI+SV  I  +          ++++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  F F+ LG+ LFG     RLE  D  P        +F++   A +T+F+I T ++WN ++ + +
Sbjct:  641 WK---NFRETLRTIVESKYFNQAIMTAILINTFSMGIEYHEQPEYLTQVLEITNFVFTSIFVLEMGFMLLAFGLWGYIKNPYNIFDSVVVIISVWEISAQADG------GLSVLRTFRLL---RVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFTFSILGMHLFGCKFGLRLENGDTIP-----DRKNFDSLLWAIVTVFQILTQEDWNVVLYNGM 846          

HSP 7 Score: 71.2478 bits (173), Expect = 1.991e-11
Identity = 46/134 (34.33%), Postives = 72/134 (53.73%), Query Frame = 2
Query: 4442 LFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGN 4837
            +  I LNC+TL M +P   +   S   + L + +      FAVEM IK++A G+  G   YL   WN +D    VI +A ++   + G ++ +  I    R +R LRPLR I+R P ++++V  LL +L  +GN
Sbjct:    1 MMVILLNCVTLGMFQPCEDVDCLSERCKVLQVLDDCIFAFFAVEMVIKMMAFGVF-GSKCYLADRWNQLD---FVIVMAGMLEYSLDGQNASLSAI----RTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGN 126          

HSP 8 Score: 58.5362 bits (140), Expect = 1.228e-7
Identity = 51/173 (29.48%), Postives = 90/173 (52.02%), Query Frame = 2
Query:  578 RDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGL-LGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            R  C + IS   F+ + +  I +NCIT+ M +P  D    ++    L   ++   + F +E+ IK+ A+G   G   Y   SWN LD ++V   L++ + S   +    I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F +FGI+GVQ+++G
Sbjct: 1155 RSCCQRVISHKLFDHVVLFFIFLNCITIAMERP--DIKPHSLERLFLSASNYIFTVIFLIEMAIKVVALGFCFGKQCYLQCSWNILDGLLVFVSLLDVLVSIAYVGENKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCTFFIVFGILGVQLFKG 1325          

HSP 9 Score: 53.5286 bits (127), Expect = 4.662e-6
Identity = 31/94 (32.98%), Postives = 52/94 (55.32%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETK--KRETERMLMERKKQQ 1648
            NFDN+  A +++F +   + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F + +  + E E  L E K+Q+
Sbjct: 1357 NFDNLFKALMSLFVLSCKDGWVNIMYDGLDAVGVDQQPVRNHNPWMLIYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQEEEEARLREDKRQK 1450          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Medaka
Match: cacna1hb (calcium voltage-gated channel subunit alpha1 H [Source:NCBI gene;Acc:101160713])

HSP 1 Score: 598.971 bits (1543), Expect = 1.578e-175
Identity = 385/598 (64.38%), Postives = 470/598 (78.60%), Query Frame = 2
Query: 4358 SLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMK-NKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQ--KNCCVS--PIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHK 6136
            SL++ +PDNRFR  C  ++  K+FD+IVL FI LNCIT+A+ERP I  +S ER FL+++NY+FTVIF  EM IKV+A GL  G+  YL+S WN++DG+LV +SL DI++ +     +RI GILRV RLLRTLRPLRVISRAPGLKLVV+TL++SLRPIGNIVLICC FFI+FGI GVQLFKGKF++C G  V ++ N +EC     + W  ++YNFDNLGQALMSLFVLS KDGWV IMY GLDAVGV+QQP  N N W LL+FISFLL+V FFVLNMFVGVVVENFHKCR+ QE+EE   R  KR +RLEK++++ ++ PY+  Y   R  IH L  S Y DL I  II  N++TM+ME Y  P  LE  LK  NY+FT VF+IEA++K IA+G +R+  +RWNQLD+ IV+LS+ GI +EE+  +  +PIN TIIR+ RVLRI RVLKLLKMA G+R+LLDTV+QALPQVGNLGLLF LLFFI+AALGVELFG+LECS+ NPC GLSRHA F+NFGMAFLTLFR++TGDNWNGIMKDTLR       EC+  +  C+S  P+I+P+YFV FVL AQFVLVNVVVAVLMKHLEES+K
Sbjct: 1128 SLYLFAPDNRFRLWCLRVIGHKMFDHIVLLFIFLNCITIALERPDISPRSMERVFLSVSNYIFTVIFVGEMMIKVVAMGLYFGEGVYLQSSWNILDGVLVFVSLVDILVSIASSGGNRILGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCAFFIVFGILGVQLFKGKFFHCEGLHVRNITNRTECLQAG-HRWVRRKYNFDNLGQALMSLFVLSCKDGWVSIMYDGLDAVGVDQQPIRNNNPWMLLFFISFLLIVSFFVLNMFVGVVVENFHKCRQQQEEEEARIREEKRQKRLEKRRRRALEKPYYADYSPLRRSIHTLCTSHYLDLFITVIIFTNLLTMSMEHYNQPQYLEEILKYCNYVFTLVFVIEAILKLIAFGLRRFFKERWNQLDLAIVLLSIMGIALEEIDLSASLPINPTIIRIMRVLRITRVLKLLKMATGMRSLLDTVMQALPQVGNLGLLFMLLFFIYAALGVELFGKLECSEENPCEGLSRHATFDNFGMAFLTLFRVSTGDNWNGIMKDTLR-------ECRPHERHCLSYLPLISPVYFVTFVLTAQFVLVNVVVAVLMKHLEESNK 1717          

HSP 2 Score: 385.185 bits (988), Expect = 3.487e-107
Identity = 221/423 (52.25%), Postives = 284/423 (67.14%), Query Frame = 2
Query:  518 LPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCN---DSALPNSD-NMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLME---RKKQQSTSTLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYER 1765
            LPYP     V   L QT  PR WCL+ +  PWFE++SI  I++NC+TLGM++PC  T        +L   D  IF FFA E+++K+ A+G++G  GY  ++WNRLD  IVI G++E       +SL+AIRTVRVLRPLRAINR+PSMRILV LLLDTLPMLGNVL LCFFVFFIFGIVGVQ+W G+LRNRC++  +   R+    L+ YY+ + T         FICS    NG+++CSD+P   +    G    CN   D A   +      + SCVNW Q+Y++C A   NP+ GAINFDNIG+AW+AIFQVI++E WVDIMYYV DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE   M  E   R+  QS STL S  +P SCY EII+ ++   R   + + + Y +
Sbjct:   58 LPYPSLAPVVLLALTQTSPPRSWCLRAVCHPWFERVSILAILLNCVTLGMFQPCGHTP------SVLQALDDGIFAFFAGEMVVKMVALGVIGQKGYLGDTWNRLDFFIVIVGMLEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLALCFFVFFIFGIVGVQLWAGLLRNRCFIEEDVKMRYNITFLNDYYKPDGTDDH-----PFICSTARENGMLRCSDVPRRRV----GRTH-CNLDADEAFSETGLKGDESESCVNWYQFYNQCRAGELNPHKGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFIFLIIVGSFFMINLCLVVIATQFSETKQREHALMKSEQRARQLHQSASTLASDSQPGSCYEEIIRYLAHLGRKAWRRISRCYSQ 464          

HSP 3 Score: 272.707 bits (696), Expect = 1.142e-72
Identity = 186/321 (57.94%), Postives = 220/321 (68.54%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXX-XXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLA--EKIHLEKHNEEKMANLMKHEAH-KNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATP 3475
             R K+K IV+ RYF RGI+IAILINTLSMGIEYH QP  LT+ LE SNM+F  LF +EMLLK+LA GL GYI N +N FD  IVI+ + E+  +    GLSVLRTFRLLR+LKLVRF+PALR QL+V++KTMDNVATF  LL+LFIFIFSILGM LFG     +  +G    DRKNFDSLLWA VTVFQILTQEDWNAVL +GM+ TS  AALYFVALMTFGNYVLFNLLVAILVEGF  E       A  +++ L  H+EEK+  L   E   +    + N  + P+  +       +             +ITHT ATP
Sbjct:  671 LRIKLKLIVSSRYFNRGIMIAILINTLSMGIEYHEQPQELTDILEISNMVFTSLFSLEMLLKLLALGLFGYIKNPYNGFDSIIVIISVWEIVGQA-EGGLSVLRTFRLLRVLKLVRFLPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFGLRQDSGDTLPDRKNFDSLLWATVTVFQILTQEDWNAVLYNGMASTSPLAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSEADDDRLSLCYHDEEKLKELYAAELKIQAMMLSPNGLLNPKASMPPPPPPPLP------------VITHTAATP 978          

HSP 4 Score: 83.5741 bits (205), Expect = 3.089e-15
Identity = 59/209 (28.23%), Postives = 109/209 (52.15%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEG---------GASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVL 3121
             R+ + ++    Y    I + I  N L+M +E++NQP  L   L+Y N +F  +F++E +LK++A GL  +    +N  D  IV+L ++ +A E            + + ++R  R+ R+LKL++    +R  L  +++ +  V     L +L  FI++ LG+ LFG   C  +N      R   FD+   A +T+F++ T ++WN ++
Sbjct: 1455 LRRSIHTLCTSHYLDLFITVIIFTNLLTMSMEHYNQPQYLEEILKYCNYVFTLVFVIEAILKLIAFGLRRFFKERWNQLDLAIVLLSIMGIALEEIDLSASLPINPTIIRIMRVLRITRVLKLLKMATGMRSLLDTVMQALPQVGNLGLLFMLLFFIYAALGVELFGKLECSEENPCEGLSRHATFDNFGMAFLTLFRVSTGDNWNGIM 1663          

HSP 5 Score: 75.0998 bits (183), Expect = 1.144e-12
Identity = 59/181 (32.60%), Postives = 96/181 (53.04%), Query Frame = 2
Query: 4361 LFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            L  L+  +  R+ C   +    F+ + +  I LNC+TL M +P     S     L   +      FA EM +K++A G+ +G+  YL   WN +D  +V++ + +  +    GH+  +  I    R +R LRPLR I+R P ++++V  LL +L  +GN++ +C   F IFGI GVQL+ G
Sbjct:   68 LLALTQTSPPRSWCLRAVCHPWFERVSILAILLNCVTLGMFQPCGHTPS----VLQALDDGIFAFFAGEMVVKMVALGV-IGQKGYLGDTWNRLDFFIVIVGMLEYSL---DGHNVSLSAI----RTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLALCFFVFFIFGIVGVQLWAG 236          

HSP 6 Score: 74.7146 bits (182), Expect = 1.642e-12
Identity = 73/301 (24.25%), Postives = 146/301 (48.50%), Query Frame = 2
Query: 4340 RAHYYDSLFVLSPDNRFRNSC--------QNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENF 5218
            R+  Y +  VL P  +    C        + ++  + F+  ++  I +N +++ +E    PQ+  +   L I+N VFT +F++EM +K++A GL      Y+++ +N  D ++V+IS+ +I     +G +     +LR FRLLR L+ +R +   P L+  +  L+ ++  +    ++   F  IF I G+ LF  KF                   D  +T  +++ NFD+L  A +++F + +++ W  ++Y G+ +           +    LYF++ +    + + N+ V ++VE F
Sbjct:  647 RSPCYGNAQVLEPRKKLWERCWAGLRIKLKLIVSSRYFNRGIMIAILINTLSMGIEYHEQPQELTD--ILEISNMVFTSLFSLEMLLKLLALGLF----GYIKNPYNGFDSIIVIISVWEI-----VGQAEGGLSVLRTFRLLRVLKLVRFL---PALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKF---------------GLRQDSGDTLPDRK-NFDSLLWATVTVFQILTQEDWNAVLYNGMAST----------SPLAALYFVALMTFGNYVLFNLLVAILVEGF 907          

HSP 7 Score: 68.9366 bits (167), Expect = 8.096e-11
Identity = 55/173 (31.79%), Postives = 93/173 (53.76%), Query Frame = 2
Query:  578 RDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGL-LGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLR-------AINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            R WCL+ I    F+ + +  I +NCIT+ + +P  D S +++    L   ++   + F  E+MIK+ AMGL  G   Y   SWN LD V+V   L++ + S        I  +  +  L         I+R P ++++V  L+ +L  +GN++L+C   F +FGI+GVQ+++G
Sbjct: 1139 RLWCLRVIGHKMFDHIVLLFIFLNCITIALERP--DISPRSMERVFLSVSNYIFTVIFVGEMMIKVVAMGLYFGEGVYLQSSWNILDGVLVFVSLVDILVSIASSGGNRILGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCAFFIVFGILGVQLFKG 1309          

HSP 8 Score: 68.9366 bits (167), Expect = 8.731e-11
Identity = 42/129 (32.56%), Postives = 80/129 (62.02%), Query Frame = 2
Query: 2549 VAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTL--EYSNMIFNGLFLVEMLLKILAEGLLG---YISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTM 2920
            V H +F+R  ++AIL+N +++G+    QP   T ++     + IF   F  EM++K++A G++G   Y+ + +N  D  IVI+G++E + +G    LS +RT R+LR L+ +  +P++R+ + ++L T+
Sbjct:   85 VCHPWFERVSILAILLNCVTLGM---FQPCGHTPSVLQALDDGIF-AFFAGEMVVKMVALGVIGQKGYLGDTWNRLDFFIVIVGMLEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTL 209          

HSP 9 Score: 60.077 bits (144), Expect = 4.596e-8
Identity = 67/284 (23.59%), Postives = 133/284 (46.83%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLE-----YSNMIFNGLFLVEMLLKILAEGL-LG---YISNGFNVFDGGIVILGLVEL----AQEGGASGLSVLRT---FRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGFSTER 3247
            RFR     ++ H+ F   +L+ I +N +++ +E   +P +   ++E      SN IF  +F+ EM++K++A GL  G   Y+ + +N+ DG +V + LV++    A  GG   L +LR     R LR L+++   P L+L +  ++ ++  +     +   F  +F ILG+ L                     C     +    + NFD+L  A++++F +  ++ W +++  G+               W  L+F++ +   ++ + N+ V ++VE F   R
Sbjct: 1137 RFRLWCLRVIGHKMFDHIVLLFIFLNCITIALE---RPDISPRSMERVFLSVSNYIFTVIFVGEMMIKVVAMGLYFGEGVYLQSSWNILDGVLVFVSLVDILVSIASSGGNRILGILRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCAFFIVFGILGVQLFKGKFFHCEGLHVRNITNRTECLQAGHRWVRRKYNFDNLGQALMSLFVLSCKDGWVSIMYDGLDAVGVDQQPIRNNNPWMLLFFISFLLIVSFFVLNMFVGVVVENFHKCR 1417          

HSP 10 Score: 57.3806 bits (137), Expect = 2.704e-7
Identity = 66/211 (31.28%), Postives = 117/211 (55.45%), Query Frame = 2
Query: 5345 RLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            R+ +  +V+S+YF+  I   I +N ++M +E++  P EL   L+  N +FTS+F +E L+K +A G   YI + +N  D +IVI+SV  IV +          ++++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  FIF+ LG+ LFG       +    L    +F++   A +T+F+I T ++WN ++ + +
Sbjct:  672 RIKLKLIVSSRYFNRGIMIAILINTLSMGIEYHEQPQELTDILEISNMVFTSLFSLEMLLKLLALGLFGYIKNPYNGFDSIIVIISVWEIVGQAEG------GLSVLRTFRLL---RVLKLVRFLPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFGLRQDSGDTLPDRKNFDSLLWATVTVFQILTQEDWNAVLYNGM 873          

HSP 11 Score: 52.7582 bits (125), Expect = 6.745e-6
Identity = 30/98 (30.61%), Postives = 57/98 (58.16%), Query Frame = 2
Query: 4949 FSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVG-FFVLNMFVGVVVENFHKCRENQ 5239
            +++C   + N  K    NFDN+G A +++F + + +GWV IMY  +DA          ++ +  +YFI FL++VG FF++N+ + V+   F + ++ +
Sbjct:  325 YNQCRAGELNPHKGA-INFDNIGYAWIAIFQVITLEGWVDIMYYVMDA----------HSFYNFIYFI-FLIIVGSFFMINLCLVVIATQFSETKQRE 410          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Medaka
Match: cacna1ha (voltage-dependent T-type calcium channel subunit alpha-1H [Source:NCBI gene;Acc:101161560])

HSP 1 Score: 539.65 bits (1389), Expect = 5.176e-157
Identity = 375/650 (57.69%), Postives = 462/650 (71.08%), Query Frame = 2
Query: 4232 ADEDSSLLNQDQDDHNENEEKILCNYFWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXX-------XXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNK-YIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRL-ECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQ---KNC-CVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMM 6142
            A +D SL    +DD +E+  K      WC       + H   SL++  P++ FR+ CQ ++  K+FD++VLFFI LNCIT+AMERP I   S ER FL+ +NY+FTVIF +EM IKV+A G   GK  YL+  WN++DGLLV +SL D+++ +     ++I G+LRV RLLRTLRPLRVISRAPGLKLVV+TL++SLRPIGNIVLICCTFFI+FGI GVQLFKGKFY C G D  +V N S+C       W N++YNFDNL +ALMSLFVLS KDGWV IMY GLDAVGV+QQP  N+N W L+YFISFLL+V FFVLNMFVGVVVENFHKCR++QE+EE         +   K+ R  E      MQ PY+  Y   RL IH L  + Y DL I  I+G+N++TM++E Y     L+ ALK  NY+FT +F +EAL+K +A+G  R+  D+WNQLDV IV LS+ GIV+EE+  K  +PIN TIIR+ RVLRIAR   L +M   I +          QVGNLGLLF LLFFI+AALGVELFG+L EC+D NPC GLSRHA FENFGMAFLTLFR++TGDNW+GIMKDTLR       ECQ   +NC      ++P YFV FVL+AQFVLVNVVVAVLMKHLEES+K++
Sbjct:  988 AKDDISL----EDDFDEDNLKPR----WC-------KEHEDCSLYLFDPESWFRSCCQRVISHKLFDHVVLFFIFLNCITIAMERPDIKPHSLERLFLSASNYIFTVIFLIEMAIKVVALGFCFGKQCYLQCSWNILDGLLVFVSLLDVLVSIAYVGENKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCTFFIVFGILGVQLFKGKFYICEGFDTRNVTNKSDCLQANYR-WTNRKYNFDNLFKALMSLFVLSCKDGWVNIMYDGLDAVGVDQQPVRNHNPWMLIYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQEEEEARLREDKRQKMIDKKRRSKENGGAGAMQRPYYADYSPVRLYIHRLCTNHYLDLFITLIVGINILTMSVEHYNQQQYLKEALKDCNYVFTFIFFVEALLKLVAFGIHRFFKDKWNQLDVAIVALSILGIVLEELNMKGALPINPTIIRIMRVLRIARGNFLDRMELNIASFCF-------QVGNLGLLFMLLFFIYAALGVELFGKLIECTDINPCEGLSRHATFENFGMAFLTLFRVSTGDNWSGIMKDTLR-------ECQPDDRNCFAYLAWVSPFYFVTFVLIAQFVLVNVVVAVLMKHLEESNKVL 1607          

HSP 2 Score: 371.703 bits (953), Expect = 3.478e-103
Identity = 222/431 (51.51%), Postives = 288/431 (66.82%), Query Frame = 2
Query:  512 KDLPYPDYPEKVFFFLNQTHHPRDWCLKFISWP----------WFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNV-SCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQST-STLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERF 1768
            ++ P+P    K FF L QT  PR WC++ +  P          W   +S+ VI++NC+TLGM++PCED  C + RCK+L   D CIF FFAVE++IK+ A G+ G   Y ++ WN+LD VIV+AG++E        SL+AIRTVRVLRPLRAINR+PSMRILV LLLDTLPMLGNVL LCFFVFFIFGIVGVQ+W G+LRNRC+L  ++    P       Y V++          FICS    NG++ C D+PPS     + +   C+ +A        ++V  CVNWNQYY+ C A   NP+ GA+NFDNIG+A +AIFQVI++E WVDIMY+V DAHSF+++ YF+ LII+GSFFMINLCLVVIATQFSETK+RE   M  +R +  S+ ST  S  EP SCY EI++ IS   R L + + + Y R+
Sbjct:   58 EEQPFPALAPKAFFCLKQTTRPRYWCIRIVCNPYPFTTLEKYLWRVYISMMVILLNCVTLGMFQPCEDVDCLSERCKVLQVLDDCIFAFFAVEMVIKMMAFGVFGSKCYLADRWNQLDFVIVMAGMLEYSLDGQNASLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLFLCFFVFFIFGIVGVQLWAGLLRNRCFLGEDTKSLKP-------YYVDEEGED----NPFICSTPRENGMLHCYDVPPS-----TEDGVECSLTA--------SHVNGCVNWNQYYNVCHAGEFNPHKGAVNFDNIGYASIAIFQVITLEGWVDIMYFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRENALMREQRARYMSSDSTFSSYTEPGSCYEEILRYISHLYRKLRRRLQRIYYRW 464          

HSP 3 Score: 284.648 bits (727), Expect = 2.086e-76
Identity = 186/358 (51.96%), Postives = 224/358 (62.57%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXX-XXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDREIFHQEMDSLSRKSQLMSNTDGESLGVP 3595
            FR+ +++IV  +YF + I+ AILINT SMGIEYH QP  LT  LE +N +F  +F++EM   +LA GL GYI N +N+FD  +VI+ + E++ +    GLSVLRTFRLLR+LKLVRFMPALR QL+V++KTMDNVATF  LL+LFIF FSILGM LFGCKF      G    DRKNFDSLLWAIVTVFQILTQEDWN VL +GM+ TS WAALYFVALMTFGNYVLFNLLVAILVEGF  E           H+   +             K  E T N  I+     +                   PII  T ATPMP+P +S      I  +E+  L R+    +  DGES   P
Sbjct:  573 FRETLRTIVESKYFNQAIMTAILINTFSMGIEYHEQPEYLTQVLEITNFVFTSIFVLEMGFMLLAFGLWGYIKNPYNIFDSVVVIISVWEISAQADG-GLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFTFSILGMHLFGCKFGLRLENGDTIPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAALYFVALMTFGNYVLFNLLVAILVEGFQAE-------VRMTHIFFSHFFFAF--------KALEMTANGHIDACGTTAP------------------PIIMRTAATPMPTPTSS-LGPESILGEEL--LYREG---TPKDGESFSSP 890          

HSP 4 Score: 95.5153 bits (236), Expect = 7.558e-19
Identity = 96/326 (29.45%), Postives = 152/326 (46.63%), Query Frame = 2
Query: 4436 IVLFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG---------------KFYY-----------CSGP---------DV--------------AHVKN-------FSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            I +  I LNC+TL M +P   +   S   + L + +      FAVEM IK++A G+  G   YL   WN +D    VI +A ++   + G ++ +  I    R +R LRPLR I+R P ++++V  LL +L  +GN++ +C   F IFGI GVQL+ G               K YY           CS P         DV              +HV         ++ C+  + N  K    NFDN+G A +++F + + +GWV IMY  +DA          YN    +YFI  +++  FF++N+ + V+   F + ++ +
Sbjct:  105 ISMMVILLNCVTLGMFQPCEDVDCLSERCKVLQVLDDCIFAFFAVEMVIKMMAFGVF-GSKCYLADRWNQLD---FVIVMAGMLEYSLDGQNASLSAI----RTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLFLCFFVFFIFGIVGVQLWAGLLRNRCFLGEDTKSLKPYYVDEEGEDNPFICSTPRENGMLHCYDVPPSTEDGVECSLTASHVNGCVNWNQYYNVCHAGEFNPHKG-AVNFDNIGYASIAIFQVITLEGWVDIMYFVMDA-------HSFYN---FIYFILLIIVGSFFMINLCLVVIATQFSETKQRE 411          

HSP 5 Score: 93.2041 bits (230), Expect = 3.376e-18
Identity = 70/278 (25.18%), Postives = 136/278 (48.92%), Query Frame = 2
Query: 4388 FRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFH 5221
            FR + + ++E K F+  ++  I +N  ++ +E    P+   +   L ITN+VFT IF +EM   ++A GL      Y+++ +N+ D ++V+IS+ +I        S++  G L V R  R LR L+++   P L+  +  L+ ++  +    ++   F   F I G+ LF  KF          ++N     + K         NFD+L  A++++F + +++ W  ++Y G+ +           + W  LYF++ +    + + N+ V ++VE F 
Sbjct:  573 FRETLRTIVESKYFNQAIMTAILINTFSMGIEYHEQPEYLTQ--VLEITNFVFTSIFVLEMGFMLLAFGLW----GYIKNPYNIFDSVVVIISVWEI--------SAQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFTFSILGMHLFGCKFGL-------RLENGDTIPDRK---------NFDSLLWAIVTVFQILTQEDWNVVLYNGMAST----------SPWAALYFVALMTFGNYVLFNLLVAILVEGFQ 810          

HSP 6 Score: 75.8702 bits (185), Expect = 7.734e-13
Identity = 68/223 (30.49%), Postives = 119/223 (53.36%), Query Frame = 2
Query: 5324 WKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFG-----RLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            WK   ++R  +  +V SKYF+ AI   I +N  +M +E++  P  L   L+  N++FTS+F++E     +A+G   YI + +N  D ++VI+SV  I  +          ++++R FR+L   RVLKL++    +R  L  +++ +  V    +L  L  F F+ LG+ LFG     RLE  D  P        +F++   A +T+F+I T ++WN ++ + +
Sbjct:  570 WK---NFRETLRTIVESKYFNQAIMTAILINTFSMGIEYHEQPEYLTQVLEITNFVFTSIFVLEMGFMLLAFGLWGYIKNPYNIFDSVVVIISVWEISAQADG------GLSVLRTFRLL---RVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFTFSILGMHLFGCKFGLRLENGDTIP-----DRKNFDSLLWAIVTVFQILTQEDWNVVLYNGM 775          

HSP 7 Score: 57.7658 bits (138), Expect = 2.251e-7
Identity = 38/118 (32.20%), Postives = 63/118 (53.39%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIV---ILGLV--ELAQEGGAS-GLSVLRTFRLLRILK 2863
            R  +  +  + Y    I + + IN L+M +E++NQ   L   L+  N +F  +F VE LLK++A G+  +  + +N  D  IV   ILG+V  EL  +G      +++R  R+LRI +
Sbjct: 1350 RLYIHRLCTNHYLDLFITLIVGINILTMSVEHYNQQQYLKEALKDCNYVFTFIFFVEALLKLVAFGIHRFFKDKWNQLDVAIVALSILGIVLEELNMKGALPINPTIIRIMRVLRIAR 1467          

HSP 8 Score: 57.7658 bits (138), Expect = 2.408e-7
Identity = 51/173 (29.48%), Postives = 90/173 (52.02%), Query Frame = 2
Query:  578 RDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGL-LGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRA-------INRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
            R  C + IS   F+ + +  I +NCIT+ M +P  D    ++    L   ++   + F +E+ IK+ A+G   G   Y   SWN LD ++V   L++ + S   +    I  V  +  L         I+R P ++++V  L+ +L  +GN++L+C   F +FGI+GVQ+++G
Sbjct: 1026 RSCCQRVISHKLFDHVVLFFIFLNCITIAMERP--DIKPHSLERLFLSASNYIFTVIFLIEMAIKVVALGFCFGKQCYLQCSWNILDGLLVFVSLLDVLVSIAYVGENKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLITSLRPIGNIVLICCTFFIVFGILGVQLFKG 1196          

HSP 9 Score: 53.5286 bits (127), Expect = 4.371e-6
Identity = 39/130 (30.00%), Postives = 63/130 (48.46%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQF---------SETKKRETERMLMERKKQQSTSTLGSSI--EPQSCYHEIIKL-ISRFC 1726
            NFDN+  A +++F +   + WV+IMY   DA          H+ W   YF+S ++I SFF++N+ + V+   F          E + RE +R  M  KK++S    G+     P    +  ++L I R C
Sbjct: 1228 NFDNLFKALMSLFVLSCKDGWVNIMYDGLDAVGVDQQPVRNHNPWMLIYFISFLLIVSFFVLNMFVGVVVENFHKCRQDQEEEEARLREDKRQKMIDKKRRSKENGGAGAMQRPYYADYSPVRLYIHRLC 1357          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000044375.1 (pep primary_assembly:ASM223467v1:8:13621989:13698083:-1 gene:ENSORLG00000025069.1 transcript:ENSORLT00000044375.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 307.375 bits (786), Expect = 1.737e-92
Identity = 183/352 (51.99%), Postives = 243/352 (69.03%), Query Frame = 2
Query:  518 LPYPDYPEKVFFFLNQTHHPRDWCL---KFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNL-SYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNV--SCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFM 1555
            +PYP+    VFF L QT  PR+W L    F+S  WFE++SI VI++NC+TLGMY+PCE+  C + RC+IL  FD  I++FFA+E++IK+ A+G+ G   Y  ++WNRLD  IV+AG++E       ++L+AIRTVRVLRPL+AINR+PSMRILV LLLDTLPMLGNVLLLCFFVFFIFGI+GVQ+W G+LRNRCY   N +    G+ L + YYQ  +        + FICS  + NG++ CSD+P           R+C    L   D +       C+NWNQYY++C     NP+ GAINFDNI +AW+ IFQVI++E WV+IMYYV DAHSF+++ YF+ LII+   F+
Sbjct:   53 VPYPELAPVVFFCLKQTTCPRNWFLLNPTFVS-TWFERISIMVILLNCVTLGMYQPCENIDCTSDRCQILQAFDAFIYIFFALEMVIKMVALGIFGRRCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCYPKENFTLPS-GMTLPTPYYQPEEND-----ERPFICSLASDNGIMSCSDVPTR-----REGGRIC---CLDKEDALHRQALGLCINWNQYYTRCHTGNTNPHKGAINFDNIVYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVSIAFI 389          

HSP 2 Score: 75.8702 bits (185), Expect = 1.842e-13
Identity = 58/162 (35.80%), Postives = 91/162 (56.17%), Query Frame = 2
Query: 4427 FDNIVLFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGI-LRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            F+ I +  I LNC+TL M +P  +I   S   + L   +    + FA+EM IK++A G+  G+  YL   WN +D  +V+  + +        +S  +  I L   R +R LRPL+ I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQL+ G
Sbjct:   87 FERISIMVILLNCVTLGMYQPCENIDCTSDRCQILQAFDAFIYIFFALEMVIKMVALGIF-GRRCYLGDTWNRLDFFIVMAGMVE--------YSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAG 239          

HSP 3 Score: 55.8398 bits (133), Expect = 3.520e-7
Identity = 36/127 (28.35%), Postives = 74/127 (58.27%), Query Frame = 2
Query: 2561 YFQRGILIAILINTLSMGIEYHNQPVLLTN----TLEYSNMIFNGLFLVEMLLKILAEGLLG---YISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTM 2920
            +F+R  ++ IL+N +++G+    + +  T+     L+  +      F +EM++K++A G+ G   Y+ + +N  D  IV+ G+VE + +     LS +RT R+LR LK +  +P++R+ + ++L T+
Sbjct:   86 WFERISIMVILLNCVTLGMYQPCENIDCTSDRCQILQAFDAFIYIFFALEMVIKMVALGIFGRRCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTL 212          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000000986.1 (SMESG000000986.1)

HSP 1 Score: 4073.86 bits (10564), Expect = 0.000e+0
Identity = 2248/2256 (99.65%), Postives = 2251/2256 (99.78%), Query Frame = 2
Query:  665 MYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQSTSTLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEKHENLTYFTKRLVFMHXXXXXXXXXXXXXXXXXXXXQLVKDFKYKDIDRTKFKDTFQVDFQPQTLNNRNQSVPCKVLLNVSNRNLRPSDSQTTQCGITPAYVKLSMIRGXXXXXXXXXXXXXXXXXXXPMLIKVPSSQLKFITTTADISTSRSNQSFVLXXXXXXXXXXXXQAMLIKENVNDQSKELLSSNQQISANQLQRQLTCSKTKVLQFKNLNDAINHDKVDXXXXXXXXXXXXXXXXXXXXLGVRFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDREIFHQEMDSLSRKSQLMSNTDGESLGVPLVLQHDQRNLSRRGSDSSINHQPVGQQCRKTNCSPTRLHPNLTIPSSRTDGLSVIPAESNYSTASTFRSRSPSLQLYGLPITLNKFNSNSGQIIQHSGVLVRRSSIGQNSNCSALSNQNTAGSLTLSEKGDEIYSKCPTPNTEHNNKDTDAEXXXXXXXXXXXXXXXXXXXXXXIHNSQPSLKTSMFLPMVFIDSSFVSKLPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNYFWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRGNKEIKEQIIEPNNNNIVFEPKKIEIKCNRLSNSAAVKFNRNANSQDSADSGKTPPDNGSGGTLHILNLPASRKLHEQLSQSQPLLLVNLNPDSLKNLNQISNTNTQTKPVESSNRKVLLKNTSKKWSTMDDGFPVKRTKLVYHLATDLPLSSAVIPINAYSQKNKNYCDWNEDDCDEEIQKITAIRDQKPSNAETNRRKFVMQKSYSMQQNSSGNFLTIKPIINKQETPLKNFSIKDHVNSDEPNLQMRPKLSVNMENSAIQTNTTIPQIGLAENRRKVFAAGGGKKRSNTGASIDTQNIENEEIQIPTSDYEDNSTTNTSGLNIFLKPSSTIPSVMAGSIPRKRSNVIMSSLEVPNPHLKVGSVSPISIRSNNIPRVTPEASEEFIDQDSDF 7432
            MYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIVGVQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQSTSTLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEKHENLTYFTKRLVFMHKKNSVKGKRKRNKKDKSTSKQLVKDFKYKDIDRTKFKDTFQVDFQPQTLNNRNQSVPCKVLLNVSNRNLRPSDSQTTQCGITPAYVKLSMIRGLNGSSRSQSLSSDSMLSASPMLIKVPSSQLKFITTTADISTSRSNQSFVLRRSSWNSNYRRSQAMLIKENVNDQSKELLSSNQQISANQLQRQLTCSKTKVLQFKNLNDAINHDKVDESEENSDYESE EQSESKKSLGVRFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATFFALLILFIFIFSILGMSLFGCKFCKFKNGKRKCDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTK SSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDREIFHQEMDSLSRKSQLMSNTDGESLGVPLVLQHDQRNLSRRGSDSSINHQPVGQQCRKTNCSPTRLHPNLTIPSSRTDGLSVIPAESNYSTASTFRSRSPSLQLYGLPITLNKFNSNSGQIIQHSGVLVRRSSIGQNSNCSALSNQNTAGSLTLSEKGDEIYSKCPTPNTEH NKDTDAESSLICNSRRSSSNSSRFVSPESIHNSQPSLKTSMFLPMVFIDSSFVSKLPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNYFWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSS+IFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGIFGVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQEKEEKARRAAKRARRLEKKKKKMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDVLIVILSVSGIVMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFVLMAQFVLVNVVVAVLMKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRGNKEIKEQIIEPNNNNIV+EPKKIEIKCNRLSNSAAVKFNRNANSQDSADSGKTPPDNGSGGTLHILNLPASRKLHEQLSQSQPLLLVNLNPDSLKNLNQISNTNTQTKPVESSNRKVLLKNTSKKWSTMDDGFPVKRTKLVYHLATDLPLSSAVIPINAYSQKNKNYCDWNEDDCDEEI+KITAIRD KPSNAETNRRKFVMQKSYSMQQNSSGNFLTIKPIINKQETPLKNFSIKDHVNSDEPNLQMRPKLSVNMENSAIQTNTTIPQIGLAENRRKVFAAGGGKKRSNTG SIDTQNIENEEIQIPTSDYEDNSTTNTSGLNIFLKPSSTIPSVMAGSIPRKRSNVIMSSLEVPNPHLKVGSVSPISIRSNNIPRVTPEASEEFIDQDSDF
Sbjct:    1 MYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIVGVQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQSTSTLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEKHENLTYFTKRLVFMHKKNSVKGKRKRNKKDKSTSKQLVKDFKYKDIDRTKFKDTFQVDFQPQTLNNRNQSVPCKVLLNVSNRNLRPSDSQTTQCGITPAYVKLSMIRGLNGSSRSQSLSSDSMLSASPMLIKVPSSQLKFITTTADISTSRSNQSFVLRRSSWNSNYRRSQAMLIKENVNDQSKELLSSNQQISANQLQRQLTCSKTKVLQFKNLNDAINHDKVDESEENSDYESEEEQSESKKSLGVRFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATFFALLILFIFIFSILGMSLFGCKFCKFKNGKRKCDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKKSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDREIFHQEMDSLSRKSQLMSNTDGESLGVPLVLQHDQRNLSRRGSDSSINHQPVGQQCRKTNCSPTRLHPNLTIPSSRTDGLSVIPAESNYSTASTFRSRSPSLQLYGLPITLNKFNSNSGQIIQHSGVLVRRSSIGQNSNCSALSNQNTAGSLTLSEKGDEIYSKCPTPNTEHINKDTDAESSLICNSRRSSSNSSRFVSPESIHNSQPSLKTSMFLPMVFIDSSFVSKLPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNYFWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSKIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGIFGVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQEKEEKARRAAKRARRLEKKKKKMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDVLIVILSVSGIVMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFVLMAQFVLVNVVVAVLMKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRGNKEIKEQIIEPNNNNIVYEPKKIEIKCNRLSNSAAVKFNRNANSQDSADSGKTPPDNGSGGTLHILNLPASRKLHEQLSQSQPLLLVNLNPDSLKNLNQISNTNTQTKPVESSNRKVLLKNTSKKWSTMDDGFPVKRTKLVYHLATDLPLSSAVIPINAYSQKNKNYCDWNEDDCDEEIKKITAIRDPKPSNAETNRRKFVMQKSYSMQQNSSGNFLTIKPIINKQETPLKNFSIKDHVNSDEPNLQMRPKLSVNMENSAIQTNTTIPQIGLAENRRKVFAAGGGKKRSNTGTSIDTQNIENEEIQIPTSDYEDNSTTNTSGLNIFLKPSSTIPSVMAGSIPRKRSNVIMSSLEVPNPHLKVGSVSPISIRSNNIPRVTPEASEEFIDQDSDF 2256          

HSP 2 Score: 56.9954 bits (136), Expect = 2.387e-7
Identity = 63/183 (34.43%), Postives = 98/183 (53.55%), Query Frame = 2
Query:  548 FFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGL--IECIPSTGEMS-----LTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
             F L+  +  R+ C   +    F+ + +  I +NCITL M +P      K+   + L   ++   + FAVE+ IK+ A GLL G   Y    WN +D ++V+  L  I  +   G  S     L   R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQ+++G
Sbjct: 1233 LFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSKIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGIFGVQLFKG 1413          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000000986.1 (SMESG000000986.1)

HSP 1 Score: 2962.17 bits (7678), Expect = 0.000e+0
Identity = 1673/1677 (99.76%), Postives = 1674/1677 (99.82%), Query Frame = 2
Query:  665 MYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQSTSTLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEKHENLTYFTKRLVFMHXXXXXXXXXXXXXXXXXXXXQLVKDFKYKDIDRTKFKDTFQVDFQPQTLNNRNQSVPCKVLLNVSNRNLRPSDSQTTQCGITPAYVKLSMIRGXXXXXXXXXXXXXXXXXXXPMLIKVPSSQLKFITTTADISTSRSNQSFVLXXXXXXXXXXXXQAMLIKENVNDQSKELLSSNQQISANQLQRQLTCSKTKVLQFKNLNDAINHDKVDXXXXXXXXXXXXXXXXXXXXLGVRFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDREIFHQEMDSLSRKSQLMSNTDGESLGVPLVLQHDQRNLSRRGSDSSINHQPVGQQCRKTNCSPTRLHPNLTIPSSRTDGLSVIPAESNYSTASTFRSRSPSLQLYGLPITLNKFNSNSGQIIQHSGVLVRRSSIGQNSNCSALSNQNTAGSLTLSEKGDEIYSKCPTPNTEHNNKDTDAEXXXXXXXXXXXXXXXXXXXXXXIHNSQPSLKTSMFLPMVFIDSSFVSKLPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNYFWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIAR 5695
            MYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIVGVQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQSTSTLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEKHENLTYFTKRLVFMHKKNSVKGKRKRNKKDKSTSKQLVKDFKYKDIDRTKFKDTFQVDFQPQTLNNRNQSVPCKVLLNVSNRNLRPSDSQTTQCGITPAYVKLSMIRGLNGSSRSQSLSSDSMLSASPMLIKVPSSQLKFITTTADISTSRSNQSFVLRRSSWNSNYRRSQAMLIKENVNDQSKELLSSNQQISANQLQRQLTCSKTKVLQFKNLNDAINHDKVDESEENSDYESE EQSESKKSLGVRFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATFFALLILFIFIFSILGMSLFGCKFCKFKNGKRKCDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTK SSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDREIFHQEMDSLSRKSQLMSNTDGESLGVPLVLQHDQRNLSRRGSDSSINHQPVGQQCRKTNCSPTRLHPNLTIPSSRTDGLSVIPAESNYSTASTFRSRSPSLQLYGLPITLNKFNSNSGQIIQHSGVLVRRSSIGQNSNCSALSNQNTAGSLTLSEKGDEIYSKCPTPNTEH NKDTDAESSLICNSRRSSSNSSRFVSPESIHNSQPSLKTSMFLPMVFIDSSFVSKLPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNYFWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSS+IFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGIFGVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQEKEEKARRAAKRARRLEKKKKKMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDVLIVILSVSGIVMEEMKNKYIPINMTIIRVFRVLRIAR
Sbjct:    1 MYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIVGVQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQSTSTLGSSIEPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEKHENLTYFTKRLVFMHKKNSVKGKRKRNKKDKSTSKQLVKDFKYKDIDRTKFKDTFQVDFQPQTLNNRNQSVPCKVLLNVSNRNLRPSDSQTTQCGITPAYVKLSMIRGLNGSSRSQSLSSDSMLSASPMLIKVPSSQLKFITTTADISTSRSNQSFVLRRSSWNSNYRRSQAMLIKENVNDQSKELLSSNQQISANQLQRQLTCSKTKVLQFKNLNDAINHDKVDESEENSDYESEEEQSESKKSLGVRFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATFFALLILFIFIFSILGMSLFGCKFCKFKNGKRKCDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKKSSIEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDREIFHQEMDSLSRKSQLMSNTDGESLGVPLVLQHDQRNLSRRGSDSSINHQPVGQQCRKTNCSPTRLHPNLTIPSSRTDGLSVIPAESNYSTASTFRSRSPSLQLYGLPITLNKFNSNSGQIIQHSGVLVRRSSIGQNSNCSALSNQNTAGSLTLSEKGDEIYSKCPTPNTEHINKDTDAESSLICNSRRSSSNSSRFVSPESIHNSQPSLKTSMFLPMVFIDSSFVSKLPSNLTMGNEKCADEDSSLLNQDQDDHNENEEKILCNYFWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSKIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGIFGVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQEKEEKARRAAKRARRLEKKKKKMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDVLIVILSVSGIVMEEMKNKYIPINMTIIRVFRVLRIAR 1677          

HSP 2 Score: 72.4034 bits (176), Expect = 5.635e-12
Identity = 64/208 (30.77%), Postives = 109/208 (52.40%), Query Frame = 2
Query: 5342 WRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIM 5965
            +R  +  +V  +YF   I   I +N ++M +E++  PV L   L+  N IF  +F++E L+K +A G   YI + +N  D  IVIL      + E+  +     ++++R FR+LRI   LKL++    +R  L  +++ +  V     L  L  FIF+ LG+ LFG   C   N      R  +F++   A +T+F+I T ++WN ++
Sbjct:  621 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILG-----LVELAQEGGASGLSVLRTFRLLRI---LKLVRFMPALRLQLIVMLKTMDNVATFFALLILFIFIFSILGMSLFGCKFCKFKNGKRKCDR-KNFDSLLWAIVTVFQILTQEDWNAVL 819          

HSP 3 Score: 64.6994 bits (156), Expect = 1.082e-9
Identity = 74/230 (32.17%), Postives = 119/230 (51.74%), Query Frame = 2
Query: 5357 HGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPV---ELEVALKSLNYIFTSVFIIEALIKTIA----YGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELF-GRL---------------ECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
              L+  K FD  +   I LN IT+AME   +P    E E  L   NY+FT +F +E  IK IA     G   Y+   WN +D L+V++S++ I++  +      I   I+RVFR+LR  R L+++  A G++ ++ T++ +L  +GN+ L+    F IF   GV+LF G+                EC++    T  ++  +F+N G A ++LF +++ D W  IM   L
Sbjct: 1247 QNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREF-LTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSKI-FGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGIFGVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGL 1474          

HSP 4 Score: 64.3142 bits (155), Expect = 1.593e-9
Identity = 43/126 (34.13%), Postives = 70/126 (55.56%), Query Frame = 2
Query: 2525 FRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVIL---GLV--ELAQEGGASGLSVLRTFRLLRILK--LVRFMP 2881
            +R  +  +V  +YF   I   I +N ++M +E++  PV L   L+  N IF  +F++E L+K +A G   YI + +N  D  IVIL   G+V  E+  +     ++++R FR+LRI +    RFMP
Sbjct: 1560 WRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDVLIVILSVSGIVMEEMKNKYIPINMTIIRVFRVLRIARGEKFRFMP 1685          

HSP 5 Score: 55.8398 bits (133), Expect = 6.456e-7
Identity = 63/183 (34.43%), Postives = 98/183 (53.55%), Query Frame = 2
Query:  548 FFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLL-GPSGYFSESWNRLDMVIVIAGL--IECIPSTGEMS-----LTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQG 1072
             F L+  +  R+ C   +    F+ + +  I +NCITL M +P      K+   + L   ++   + FAVE+ IK+ A GLL G   Y    WN +D ++V+  L  I  +   G  S     L   R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQ+++G
Sbjct: 1233 LFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERP--SIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSKIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGIFGVQLFKG 1413          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000000986.1 (SMESG000000986.1)

HSP 1 Score: 1088.56 bits (2814), Expect = 0.000e+0
Identity = 569/573 (99.30%), Postives = 571/573 (99.65%), Query Frame = 2
Query: 5714 MAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRGNKEIKEQIIEPNNNNIVFEPKKIEIKCNRLSNSAAVKFNRNANSQDSADSGKTPPDNGSGGTLHILNLPASRKLHEQLSQSQPLLLVNLNPDSLKNLNQISNTNTQTKPVESSNRKVLLKNTSKKWSTMDDGFPVKRTKLVYHLATDLPLSSAVIPINAYSQKNKNYCDWNEDDCDEEIQKITAIRDQKPSNAETNRRKFVMQKSYSMQQNSSGNFLTIKPIINKQETPLKNFSIKDHVNSDEPNLQMRPKLSVNMENSAIQTNTTIPQIGLAENRRKVFAAGGGKKRSNTGASIDTQNIENEEIQIPTSDYEDNSTTNTSGLNIFLKPSSTIPSVMAGSIPRKRSNVIMSSLEVPNPHLKVGSVSPISIRSNNIPRVTPEASEEFIDQDSDF 7432
            MAKGIRALLDTVIQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFVLMAQFVLVNVVVAVLMKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRGNKEIKEQIIEPNNNNIV+EPKKIEIKCNRLSNSAAVKFNRNANSQDSADSGKTPPDNGSGGTLHILNLPASRKLHEQLSQSQPLLLVNLNPDSLKNLNQISNTNTQTKPVESSNRKVLLKNTSKKWSTMDDGFPVKRTKLVYHLATDLPLSSAVIPINAYSQKNKNYCDWNEDDCDEEI+KITAIRD KPSNAETNRRKFVMQKSYSMQQNSSGNFLTIKPIINKQETPLKNFSIKDHVNSDEPNLQMRPKLSVNMENSAIQTNTTIPQIGLAENRRKVFAAGGGKKRSNTG SIDTQNIENEEIQIPTSDYEDNSTTNTSGLNIFLKPSSTIPSVMAGSIPRKRSNVIMSSLEVPNPHLKVGSVSPISIRSNNIPRVTPEASEEFIDQDSDF
Sbjct:    1 MAKGIRALLDTVIQALPQVGNLGLLFFLLFFIFAALGVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFVLMAQFVLVNVVVAVLMKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRGNKEIKEQIIEPNNNNIVYEPKKIEIKCNRLSNSAAVKFNRNANSQDSADSGKTPPDNGSGGTLHILNLPASRKLHEQLSQSQPLLLVNLNPDSLKNLNQISNTNTQTKPVESSNRKVLLKNTSKKWSTMDDGFPVKRTKLVYHLATDLPLSSAVIPINAYSQKNKNYCDWNEDDCDEEIKKITAIRDPKPSNAETNRRKFVMQKSYSMQQNSSGNFLTIKPIINKQETPLKNFSIKDHVNSDEPNLQMRPKLSVNMENSAIQTNTTIPQIGLAENRRKVFAAGGGKKRSNTGTSIDTQNIENEEIQIPTSDYEDNSTTNTSGLNIFLKPSSTIPSVMAGSIPRKRSNVIMSSLEVPNPHLKVGSVSPISIRSNNIPRVTPEASEEFIDQDSDF 573          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000005760.1 (SMESG000005760.1)

HSP 1 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 519/766 (67.75%), Postives = 607/766 (79.24%), Query Frame = 2
Query: 4238 EDSSLLNQDQDDHNENEEKILCNYFWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRGNKEIKEQIIEPNNNNIVFEPKKIEIKCNRLSNSAAVKFNRNANSQDSADSGKTPPDNGSGGTLHILNLPASRKLHEQLSQSQPLLLVNLNPDSL 6535
            ++SS +N  +D   E+ E ++C    C      F   YY SL+V S DN+FR  CQ++++KK FD +VLFFI LNCITLAMERPSIP  S+ER FLT+TNY+FT+IF  EM IKV++KGLL+G  +YL+SGWN+MDG LV ISL D+ I +++GHS+RIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGI GVQLFKGKFYYC GP +  VK  ++C    +N WKNQ+YNFDNLGQALM+LFVLSSKDGWVQIMYTG+DAVGVN QPQEN+NEW L+YFISFLLLV FFVLNMFVGVVVENFHKC+ENQEKEEKARRAAKRARRLEKK+K +  P YW+ Y  WR  I+ +V SKYFDLAIAG+IGLNVITMA EF+MMP  L+ ALK  NY FTS F++EAL+K +A G  RYI D+WNQLD++IVILS++G+V++E+++ ++PIN TI+RV RVLRIARVLKLLKMA GIRALLDTVIQALPQVGNLGLLFFLLF+IFAALGVELFGRLECSD NPC GL RHAHFENFGMAFLTLFRIATGDNWNGIMKDTLR KC +SE+CQ+NCCVS IIAPIYFVIFVLMAQFVLVNVVVAVLMKHLEESHKMMCDD E+E+EVQR++DEE KE  RE    D E  EN     + +  I+ NNN   F  KK   + N ++ +   K      S     S      N S   +H++N+ +     + LS+S P L VNL+  S 
Sbjct: 1099 QNSSRMNNVEDPDEEDMEAMICLSKCCPQPKGIFAKRYYHSLYVFSVDNQFRQKCQHIVDKKSFDYLVLFFITLNCITLAMERPSIPPHSKERLFLTVTNYIFTIIFTGEMIIKVLSKGLLIGDQAYLKSGWNIMDGFLVFISLLDLFITILLGHSNRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGKFYYCDGPHLQAVKTKNDCLKYSQNEWKNQKYNFDNLGQALMALFVLSSKDGWVQIMYTGIDAVGVNIQPQENHNEWALIYFISFLLLVAFFVLNMFVGVVVENFHKCQENQEKEEKARRAAKRARRLEKKRKHLRAPLYWENYSKWRRTINSVVTSKYFDLAIAGVIGLNVITMATEFHMMPQVLKTALKVFNYFFTSTFVLEALLKLVALGLARYISDKWNQLDMMIVILSIAGVVIDEVESNFMPINPTIMRVMRVLRIARVLKLLKMASGIRALLDTVIQALPQVGNLGLLFFLLFYIFAALGVELFGRLECSDINPCVGLGRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLREKCISSEDCQRNCCVSAIIAPIYFVIFVLMAQFVLVNVVVAVLMKHLEESHKMMCDDYELEREVQRDLDEEAKELAREKQLKDEENNEN----TLIDIEIDKNNN---FLDKK---ENNSINQNQIKKL-----SCGDCHSINAQLRNVSCQNVHLVNIYS-----KNLSRSHPHLFVNLDSASF 1844          

HSP 2 Score: 504.982 bits (1299), Expect = 6.882e-146
Identity = 261/388 (67.27%), Postives = 313/388 (80.67%), Query Frame = 2
Query:  629 IAVIIVNCITLGMYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGE-MSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQSTSTLGSSI---EPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEKH 1780
            + +I VNCITL MY+PC D +C+T +C+I+  FD+ IF FF  E++IKI AMG LG  GYF ++WNRLDM IVI G IE +PSTG  + LTAIRT+RVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGI+GVQMWQG+LRNRCYL+LN S+RHPGLNLS +YQ+N+T    +  KDFICS D  NG++KCSDIPPS++ L +   ++C   A P +DN+PT  SCVNWNQYY+ C+    NPY GAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDW YFV+LIIIGSFFMINLCLVVIA+QFSETK+RETERM +ER++  S++   SSI   EPQ+CY EIIKLI++    + + ++K Y +   +H
Sbjct:    1 MTIIAVNCITLSMYQPCGDQNCETSKCQIMQAFDYIIFAFFTCEMVIKIIAMGFLGDLGYFGDTWNRLDMFIVIVGSIEILPSTGNNIGLTAIRTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQMWQGVLRNRCYLNLNESFRHPGLNLSSFYQINRTLFLNAVDKDFICSTDKNNGILKCSDIPPSIMLLSNNSLQICKQPARPFTDNLPTKHSCVNWNQYYTDCQPGEKNPYEGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWIYFVALIIIGSFFMINLCLVVIASQFSETKRRETERMWIERRRFNSSNC--SSISKDEPQTCYLEIIKLITQIICKIYRRIVKLYNQMQIRH 386          

HSP 3 Score: 369.007 bits (946), Expect = 1.483e-102
Identity = 218/331 (65.86%), Postives = 264/331 (79.76%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVM----PIITHTDATPMPSPRASPFND 3508
            ++K+K++V    FQRGILIAILINTLSMGIEYH QPV LT TLE+SN++F+ LFL+EM+LK++ EG+LGYI NGFN+FDG IV+LG++EL Q+GG SGLS+LRTFRLLRILKLVRFMPALR QL VM++T+DNVATFFALLILFIFIFSILGMSLFGCKFC  +N KR CDRKNFDSLLW+IVTVFQILTQEDWN VL +GM++TSSWAALYF+ALMTFGNYVLFNLLVAILVEGFS+ER+DE KL        HN  +  +L K  A+  Q        E   +++N+     I+K    + Q +    P+I HT ATPMP+PR+SP+N+
Sbjct:  580 QQKIKTLVNDVKFQRGILIAILINTLSMGIEYHQQPVQLTQTLEFSNIVFSILFLIEMILKLIGEGILGYIKNGFNLFDGIIVVLGVIELCQQGGTSGLSILRTFRLLRILKLVRFMPALRQQLFVMIRTIDNVATFFALLILFIFIFSILGMSLFGCKFCTIENNKRTCDRKNFDSLLWSIVTVFQILTQEDWNTVLYNGMTRTSSWAALYFIALMTFGNYVLFNLLVAILVEGFSSERLDEQKLL-------HNYRQ--SLKKRRANNKQLRIMQHQSENLVLLTNS-----IQKDQTGENQKISSQPPVIIHTAATPMPTPRSSPYNE 896          

HSP 4 Score: 92.0485 bits (227), Expect = 7.091e-18
Identity = 89/333 (26.73%), Postives = 165/333 (49.55%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASG--------LSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQ--------------TSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTER---VDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQV 3442
            ++R+ + S+V  +YF   I   I +N ++M  E+H  P +L   L+  N  F   F++E LLK++A GL  YIS+ +N  D  IVIL +  +  +   S         + V+R  R+ R+LKL++    +R  L  +++ +  V     L  L  +IF+ LG+ LFG   C   N      R  +F++   A +T+F+I T ++WN ++   + +              ++  A +YFV  +    +VL N++VA+L++          D+ +L  ++  ++  +E+   L + +  K++E  +N+ I+  E+  NN  +      S+NQ Q+
Sbjct: 1466 KWRRTINSVVTSKYFDLAIAGVIGLNVITMATEFHMMPQVLKTALKVFNYFFTSTFVLEALLKLVALGLARYISDKWNQLDMMIVILSIAGVVIDEVESNFMPINPTIMRVMRVLRIARVLKLLKMASGIRALLDTVIQALPQVGNLGLLFFLLFYIFAALGVELFGRLECSDINPCVGLGRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLREKCISSEDCQRNCCVSAIIAPIYFVIFVLMAQFVLVNVVVAVLMKHLEESHKMMCDDYELEREV--QRDLDEEAKELAREKQLKDEENNENTLIDI-EIDKNNNFLDKKENNSINQNQI 1795          

HSP 5 Score: 88.9669 bits (219), Expect = 5.247e-17
Identity = 74/275 (26.91%), Postives = 135/275 (49.09%), Query Frame = 2
Query: 4427 FDNIVLFFIALNCITLAMERPSIP-QKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXV---QLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            F   +L  I +N +++ +E    P Q ++  EF   +N VF+++F +EM +K+I +G+L     Y+++G+N+ DG++VV+ +    I L     +    ILR FRLLR L+ +R +   P L+   Q L   +R I N+        +   IF +    LF  KF  C+              N+KR      + NFD+L  +++++F + +++ W  ++Y G+             + W  LYFI+ +    + + N+ V ++VE F   R ++
Sbjct:  592 FQRGILIAILINTLSMGIEYHQQPVQLTQTLEF---SNIVFSILFLIEMILKLIGEGIL----GYIKNGFNLFDGIIVVLGV----IELCQQGGTSGLSILRTFRLLRILKLVRFM---PALR---QQLFVMIRTIDNVATFFALLILFIFIFSILGMSLFGCKF--CT------------IENNKRTC---DRKNFDSLLWSIVTVFQILTQEDWNTVLYNGMTRT----------SSWAALYFIALMTFGNYVLFNLLVAILVEGFSSERLDE 822          

HSP 6 Score: 79.337 bits (194), Expect = 4.025e-14
Identity = 57/153 (37.25%), Postives = 90/153 (58.82%), Query Frame = 2
Query: 4451 IALNCITLAMERPSIPQ--KSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            IA+NCITL+M +P   Q  ++ + + +   +Y+    F  EM IK+IA G L G   Y    WN +D  +V++    I I+   G++  +  I    R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQ+++G
Sbjct:    4 IAVNCITLSMYQPCGDQNCETSKCQIMQAFDYIIFAFFTCEMVIKIIAMGFL-GDLGYFGDTWNRLDMFIVIV--GSIEILPSTGNNIGLTAI----RTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQMWQG 149          

HSP 7 Score: 70.8626 bits (172), Expect = 1.683e-11
Identity = 65/208 (31.25%), Postives = 111/208 (53.37%), Query Frame = 2
Query: 5354 IHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            I  LVN   F   I   I +N ++M +E++  PV+L   L+  N +F+ +F+IE ++K I  G   YI + +N  D +IV+L V      E+  +     ++I+R FR+LRI   LKL++    +R  L  +I+ +  V     L  L  FIF+ LG+ LFG   C+  N      R  +F++   + +T+F+I T ++WN ++ + +
Sbjct:  583 IKTLVNDVKFQRGILIAILINTLSMGIEYHQQPVQLTQTLEFSNIVFSILFLIEMILKLIGEGILGYIKNGFNLFDGIIVVLGVI-----ELCQQGGTSGLSILRTFRLLRI---LKLVRFMPALRQQLFVMIRTIDNVATFFALLILFIFIFSILGMSLFGCKFCTIENNKRTCDR-KNFDSLLWSIVTVFQILTQEDWNTVLYNGM 781          

HSP 8 Score: 70.0922 bits (170), Expect = 2.764e-11
Identity = 67/288 (23.26%), Postives = 134/288 (46.53%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEY-----HNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVELAQEGGASGLSVL-----RTFRLLRIL---------KLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL-----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGF 3235
            +FR+K + IV  + F   +L  I +N +++ +E      H++  L    L  +N IF  +F  EM++K+L++GLL     Y+ +G+N+ DG +V + L++L        +++L     R F +LR+          +++   P L+L +  +L ++  +     +   F  IF ILG+ L                       K+   + K  + NFD+L  A++ +F + +++ W  ++ +G+               WA +YF++ +    + + N+ V ++VE F
Sbjct: 1148 QFRQKCQHIVDKKSFDYLVLFFITLNCITLAMERPSIPPHSKERLF---LTVTNYIFTIIFTGEMIIKVLSKGLLIGDQAYLKSGWNIMDGFLVFISLLDLF-------ITILLGHSNRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGKFYYCDGPHLQAVKTKNDCLKYSQNEWKNQKYNFDNLGQALMALFVLSSKDGWVQIMYTGIDAVGVNIQPQENHNEWALIYFISFLLLVAFFVLNMFVGVVVENF 1425          

HSP 9 Score: 58.5362 bits (140), Expect = 9.052e-8
Identity = 32/87 (36.78%), Postives = 53/87 (60.92%), Query Frame = 2
Query: 2672 IFNGLFLVEMLLKILAEGLLG---YISNGFNVFDGGIVILGLVE-LAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTM 2920
            I    F  EM++KI+A G LG   Y  + +N  D  IVI+G +E L   G   GL+ +RT R+LR L+ +  +P++R+ ++++L T+
Sbjct:   36 IIFAFFTCEMVIKIIAMGFLGDLGYFGDTWNRLDMFIVIVGSIEILPSTGNNIGLTAIRTIRVLRPLRAINRIPSMRILVMLLLDTL 122          

HSP 10 Score: 53.9138 bits (128), Expect = 2.281e-6
Identity = 33/120 (27.50%), Postives = 67/120 (55.83%), Query Frame = 2
Query:  614 FEQLSIAVIIVNCITLGM---YKPCEDTSCKTIRCKILGGFDHCIF-MFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMR 961
            F++  +  I++N +++G+    +P + T  +T+       F + +F + F +E+++K+   G+LG   Y    +N  D +IV+ G+IE     G   L+ +RT R+LR L+ +  +P++R
Sbjct:  592 FQRGILIAILINTLSMGIEYHQQPVQLT--QTLE------FSNIVFSILFLIEMILKLIGEGILG---YIKNGFNLFDGIIVVLGVIELCQQGGTSGLSILRTFRLLRILKLVRFMPALR 700          

HSP 11 Score: 52.7582 bits (125), Expect = 5.112e-6
Identity = 26/80 (32.50%), Postives = 46/80 (57.50%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRE 1612
            NFDN+G A +A+F + S + WV IMY   DA          H+ W   YF+S +++ +FF++N+ + V+   F + ++ +
Sbjct: 1353 NFDNLGQALMALFVLSSKDGWVQIMYTGIDAVGVNIQPQENHNEWALIYFISFLLLVAFFVLNMFVGVVVENFHKCQENQ 1432          

HSP 12 Score: 52.373 bits (124), Expect = 6.860e-6
Identity = 25/97 (25.77%), Postives = 54/97 (55.67%), Query Frame = 2
Query: 4949 FSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            +++C   ++N ++    NFDN+G A +++F + S + WV IMY   DA          ++ W  +YF++ +++  FF++N+ + V+   F + +  +
Sbjct:  244 YTDCQPGEKNPYEGA-INFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWIYFVALIIIGSFFMINLCLVVIASQFSETKRRE 329          

HSP 13 Score: 52.373 bits (124), Expect = 7.337e-6
Identity = 24/81 (29.63%), Postives = 46/81 (56.79%), Query Frame = 2
Query: 3047 NFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEK 3289
            NFD++ +A V +FQ+++ E W  ++       S W  +YFVAL+  G++ + NL + ++   FS  +  E    E++ +E+
Sbjct:  260 NFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWIYFVALIIIGSFFMINLCLVVIASQFSETKRRE---TERMWIER 337          
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000005760.1 (SMESG000005760.1)

HSP 1 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 519/766 (67.75%), Postives = 607/766 (79.24%), Query Frame = 2
Query: 4238 EDSSLLNQDQDDHNENEEKILCNYFWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLMEKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQXXXXXXXXXXXXXXXXXXXXXXMMQPPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFXXXXXXXXXXXXXXXXXKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRENITSDVEEIENRGNKEIKEQIIEPNNNNIVFEPKKIEIKCNRLSNSAAVKFNRNANSQDSADSGKTPPDNGSGGTLHILNLPASRKLHEQLSQSQPLLLVNLNPDSL 6535
            ++SS +N  +D   E+ E ++C    C      F   YY SL+V S DN+FR  CQ++++KK FD +VLFFI LNCITLAMERPSIP  S+ER FLT+TNY+FT+IF  EM IKV++KGLL+G  +YL+SGWN+MDG LV ISL D+ I +++GHS+RIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGI GVQLFKGKFYYC GP +  VK  ++C    +N WKNQ+YNFDNLGQALM+LFVLSSKDGWVQIMYTG+DAVGVN QPQEN+NEW L+YFISFLLLV FFVLNMFVGVVVENFHKC+ENQEKEEKARRAAKRARRLEKK+K +  P YW+ Y  WR  I+ +V SKYFDLAIAG+IGLNVITMA EF+MMP  L+ ALK  NY FTS F++EAL+K +A G  RYI D+WNQLD++IVILS++G+V++E+++ ++PIN TI+RV RVLRIARVLKLLKMA GIRALLDTVIQALPQVGNLGLLFFLLF+IFAALGVELFGRLECSD NPC GL RHAHFENFGMAFLTLFRIATGDNWNGIMKDTLR KC +SE+CQ+NCCVS IIAPIYFVIFVLMAQFVLVNVVVAVLMKHLEESHKMMCDD E+E+EVQR++DEE KE  RE    D E  EN     + +  I+ NNN   F  KK   + N ++ +   K      S     S      N S   +H++N+ +     + LS+S P L VNL+  S 
Sbjct: 1087 QNSSRMNNVEDPDEEDMEAMICLSKCCPQPKGIFAKRYYHSLYVFSVDNQFRQKCQHIVDKKSFDYLVLFFITLNCITLAMERPSIPPHSKERLFLTVTNYIFTIIFTGEMIIKVLSKGLLIGDQAYLKSGWNIMDGFLVFISLLDLFITILLGHSNRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGKFYYCDGPHLQAVKTKNDCLKYSQNEWKNQKYNFDNLGQALMALFVLSSKDGWVQIMYTGIDAVGVNIQPQENHNEWALIYFISFLLLVAFFVLNMFVGVVVENFHKCQENQEKEEKARRAAKRARRLEKKRKHLRAPLYWENYSKWRRTINSVVTSKYFDLAIAGVIGLNVITMATEFHMMPQVLKTALKVFNYFFTSTFVLEALLKLVALGLARYISDKWNQLDMMIVILSIAGVVIDEVESNFMPINPTIMRVMRVLRIARVLKLLKMASGIRALLDTVIQALPQVGNLGLLFFLLFYIFAALGVELFGRLECSDINPCVGLGRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLREKCISSEDCQRNCCVSAIIAPIYFVIFVLMAQFVLVNVVVAVLMKHLEESHKMMCDDYELEREVQRDLDEEAKELAREKQLKDEENNEN----TLIDIEIDKNNN---FLDKK---ENNSINQNQIKKL-----SCGDCHSINAQLRNVSCQNVHLVNIYS-----KNLSRSHPHLFVNLDSASF 1832          

HSP 2 Score: 490.345 bits (1261), Expect = 4.039e-141
Identity = 254/376 (67.55%), Postives = 304/376 (80.85%), Query Frame = 2
Query:  665 MYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGE-MSLTAIRTVRVLRPLRAINRIPSMRIXXXXXXXXXXXXGNVLLLCXXXXXXXXXXXXQMWQGILRNRCYLHLNSSYRHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLPSGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRETERMLMERKKQQSTSTLGSSI---EPQSCYHEIIKLISRFCRHLLKTVIKRYERFSEKH 1780
            MY+PC D +C+T +C+I+  FD+ IF FF  E++IKI AMG LG  GYF ++WNRLDM IVI G IE +PSTG  + LTAIRT+RVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGI+GVQMWQG+LRNRCYL+LN S+RHPGLNLS +YQ+N+T    +  KDFICS D  NG++KCSDIPPS++ L +   ++C   A P +DN+PT  SCVNWNQYY+ C+    NPY GAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDW YFV+LIIIGSFFMINLCLVVIA+QFSETK+RETERM +ER++  S++   SSI   EPQ+CY EIIKLI++    + + ++K Y +   +H
Sbjct:    1 MYQPCGDQNCETSKCQIMQAFDYIIFAFFTCEMVIKIIAMGFLGDLGYFGDTWNRLDMFIVIVGSIEILPSTGNNIGLTAIRTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQMWQGVLRNRCYLNLNESFRHPGLNLSSFYQINRTLFLNAVDKDFICSTDKNNGILKCSDIPPSIMLLSNNSLQICKQPARPFTDNLPTKHSCVNWNQYYTDCQPGEKNPYEGAINFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWIYFVALIIIGSFFMINLCLVVIASQFSETKRRETERMWIERRRFNSSNC--SSISKDEPQTCYLEIIKLITQIICKIYRRIVKLYNQMQIRH 374          

HSP 3 Score: 369.007 bits (946), Expect = 1.524e-102
Identity = 218/331 (65.86%), Postives = 264/331 (79.76%), Query Frame = 2
Query: 2528 RKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQVM----PIITHTDATPMPSPRASPFND 3508
            ++K+K++V    FQRGILIAILINTLSMGIEYH QPV LT TLE+SN++F+ LFL+EM+LK++ EG+LGYI NGFN+FDG IV+LG++EL Q+GG SGLS+LRTFRLLRILKLVRFMPALR QL VM++T+DNVATFFALLILFIFIFSILGMSLFGCKFC  +N KR CDRKNFDSLLW+IVTVFQILTQEDWN VL +GM++TSSWAALYF+ALMTFGNYVLFNLLVAILVEGFS+ER+DE KL        HN  +  +L K  A+  Q        E   +++N+     I+K    + Q +    P+I HT ATPMP+PR+SP+N+
Sbjct:  568 QQKIKTLVNDVKFQRGILIAILINTLSMGIEYHQQPVQLTQTLEFSNIVFSILFLIEMILKLIGEGILGYIKNGFNLFDGIIVVLGVIELCQQGGTSGLSILRTFRLLRILKLVRFMPALRQQLFVMIRTIDNVATFFALLILFIFIFSILGMSLFGCKFCTIENNKRTCDRKNFDSLLWSIVTVFQILTQEDWNTVLYNGMTRTSSWAALYFIALMTFGNYVLFNLLVAILVEGFSSERLDEQKLL-------HNYRQ--SLKKRRANNKQLRIMQHQSENLVLLTNS-----IQKDQTGENQKISSQPPVIIHTAATPMPTPRSSPYNE 884          

HSP 4 Score: 92.0485 bits (227), Expect = 6.346e-18
Identity = 89/333 (26.73%), Postives = 165/333 (49.55%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFDGGIVILGLVELAQEGGASG--------LSVLRTFRLLRILKLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSLXXXXXXXXXXXXXXXDR-KNFDSLLWAIVTVFQILTQEDWNAVLISGMSQ--------------TSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTER---VDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSSIEPQEVISNNKNIAIIRKGSLNQKQV 3442
            ++R+ + S+V  +YF   I   I +N ++M  E+H  P +L   L+  N  F   F++E LLK++A GL  YIS+ +N  D  IVIL +  +  +   S         + V+R  R+ R+LKL++    +R  L  +++ +  V     L  L  +IF+ LG+ LFG   C   N      R  +F++   A +T+F+I T ++WN ++   + +              ++  A +YFV  +    +VL N++VA+L++          D+ +L  ++  ++  +E+   L + +  K++E  +N+ I+  E+  NN  +      S+NQ Q+
Sbjct: 1454 KWRRTINSVVTSKYFDLAIAGVIGLNVITMATEFHMMPQVLKTALKVFNYFFTSTFVLEALLKLVALGLARYISDKWNQLDMMIVILSIAGVVIDEVESNFMPINPTIMRVMRVLRIARVLKLLKMASGIRALLDTVIQALPQVGNLGLLFFLLFYIFAALGVELFGRLECSDINPCVGLGRHAHFENFGMAFLTLFRIATGDNWNGIMKDTLREKCISSEDCQRNCCVSAIIAPIYFVIFVLMAQFVLVNVVVAVLMKHLEESHKMMCDDYELEREV--QRDLDEEAKELAREKQLKDEENNENTLIDI-EIDKNNNFLDKKENNSINQNQI 1783          

HSP 5 Score: 88.9669 bits (219), Expect = 4.940e-17
Identity = 74/275 (26.91%), Postives = 135/275 (49.09%), Query Frame = 2
Query: 4427 FDNIVLFFIALNCITLAMERPSIP-QKSREREFLTITNYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXV---QLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            F   +L  I +N +++ +E    P Q ++  EF   +N VF+++F +EM +K+I +G+L     Y+++G+N+ DG++VV+ +    I L     +    ILR FRLLR L+ +R +   P L+   Q L   +R I N+        +   IF +    LF  KF  C+              N+KR      + NFD+L  +++++F + +++ W  ++Y G+             + W  LYFI+ +    + + N+ V ++VE F   R ++
Sbjct:  580 FQRGILIAILINTLSMGIEYHQQPVQLTQTLEF---SNIVFSILFLIEMILKLIGEGIL----GYIKNGFNLFDGIIVVLGV----IELCQQGGTSGLSILRTFRLLRILKLVRFM---PALR---QQLFVMIRTIDNVATFFALLILFIFIFSILGMSLFGCKF--CT------------IENNKRTC---DRKNFDSLLWSIVTVFQILTQEDWNTVLYNGMTRT----------SSWAALYFIALMTFGNYVLFNLLVAILVEGFSSERLDE 810          

HSP 6 Score: 70.8626 bits (172), Expect = 1.626e-11
Identity = 65/208 (31.25%), Postives = 111/208 (53.37%), Query Frame = 2
Query: 5354 IHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELEVALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDXXXXXXXXXXXXMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALPQVGNXXXXXXXXXXXXXXXXVELFGRLECSDYNPCTGLSRHAHFENFGMAFLTLFRIATGDNWNGIMKDTL 5977
            I  LVN   F   I   I +N ++M +E++  PV+L   L+  N +F+ +F+IE ++K I  G   YI + +N  D +IV+L V      E+  +     ++I+R FR+LRI   LKL++    +R  L  +I+ +  V     L  L  FIF+ LG+ LFG   C+  N      R  +F++   + +T+F+I T ++WN ++ + +
Sbjct:  571 IKTLVNDVKFQRGILIAILINTLSMGIEYHQQPVQLTQTLEFSNIVFSILFLIEMILKLIGEGILGYIKNGFNLFDGIIVVLGVI-----ELCQQGGTSGLSILRTFRLLRI---LKLVRFMPALRQQLFVMIRTIDNVATFFALLILFIFIFSILGMSLFGCKFCTIENNKRTCDR-KNFDSLLWSIVTVFQILTQEDWNTVLYNGM 769          

HSP 7 Score: 70.0922 bits (170), Expect = 2.670e-11
Identity = 67/288 (23.26%), Postives = 134/288 (46.53%), Query Frame = 2
Query: 2522 RFRKKMKSIVAHRYFQRGILIAILINTLSMGIEY-----HNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLL----GYISNGFNVFDGGIVILGLVELAQEGGASGLSVL-----RTFRLLRIL---------KLVRFMPALRLQLIVMLKTMDNVATXXXXXXXXXXXXXXXGMSL-----------------XXXXXXXXXXXXXXXDRKNFDSLLWAIVTVFQILTQEDWNAVLISGMSQTS----------SWAALYFVALMTFGNYVLFNLLVAILVEGF 3235
            +FR+K + IV  + F   +L  I +N +++ +E      H++  L    L  +N IF  +F  EM++K+L++GLL     Y+ +G+N+ DG +V + L++L        +++L     R F +LR+          +++   P L+L +  +L ++  +     +   F  IF ILG+ L                       K+   + K  + NFD+L  A++ +F + +++ W  ++ +G+               WA +YF++ +    + + N+ V ++VE F
Sbjct: 1136 QFRQKCQHIVDKKSFDYLVLFFITLNCITLAMERPSIPPHSKERLF---LTVTNYIFTIIFTGEMIIKVLSKGLLIGDQAYLKSGWNIMDGFLVFISLLDLF-------ITILLGHSNRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFFIIFGILGVQLFKGKFYYCDGPHLQAVKTKNDCLKYSQNEWKNQKYNFDNLGQALMALFVLSSKDGWVQIMYTGIDAVGVNIQPQENHNEWALIYFISFLLLVAFFVLNMFVGVVVENF 1413          

HSP 8 Score: 65.855 bits (159), Expect = 6.088e-10
Identity = 47/123 (38.21%), Postives = 72/123 (58.54%), Query Frame = 2
Query: 4535 NYVFTVIFAVEMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRIFGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLXXXXXXXXXXXXXVQLFKG 4903
            +Y+    F  EM IK+IA G L G   Y    WN +D  +V++    I I+   G++  +  I    R +R LRPLR I+R P ++++V  LL +L  +GN++L+C   F IFGI GVQ+++G
Sbjct:   22 DYIIFAFFTCEMVIKIIAMGFL-GDLGYFGDTWNRLDMFIVIV--GSIEILPSTGNNIGLTAI----RTIRVLRPLRAINRIPSMRILVMLLLDTLPMLGNVLLLCFFVFFIFGIIGVQMWQG 137          

HSP 9 Score: 58.5362 bits (140), Expect = 9.044e-8
Identity = 32/87 (36.78%), Postives = 53/87 (60.92%), Query Frame = 2
Query: 2672 IFNGLFLVEMLLKILAEGLLG---YISNGFNVFDGGIVILGLVE-LAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLKTM 2920
            I    F  EM++KI+A G LG   Y  + +N  D  IVI+G +E L   G   GL+ +RT R+LR L+ +  +P++R+ ++++L T+
Sbjct:   24 IIFAFFTCEMVIKIIAMGFLGDLGYFGDTWNRLDMFIVIVGSIEILPSTGNNIGLTAIRTIRVLRPLRAINRIPSMRILVMLLLDTL 110          

HSP 10 Score: 53.9138 bits (128), Expect = 2.010e-6
Identity = 33/120 (27.50%), Postives = 67/120 (55.83%), Query Frame = 2
Query:  614 FEQLSIAVIIVNCITLGM---YKPCEDTSCKTIRCKILGGFDHCIF-MFFAVELMIKICAMGLLGPSGYFSESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMR 961
            F++  +  I++N +++G+    +P + T  +T+       F + +F + F +E+++K+   G+LG   Y    +N  D +IV+ G+IE     G   L+ +RT R+LR L+ +  +P++R
Sbjct:  580 FQRGILIAILINTLSMGIEYHQQPVQLT--QTLE------FSNIVFSILFLIEMILKLIGEGILG---YIKNGFNLFDGIIVVLGVIELCQQGGTSGLSILRTFRLLRILKLVRFMPALR 688          

HSP 11 Score: 52.7582 bits (125), Expect = 4.857e-6
Identity = 26/80 (32.50%), Postives = 46/80 (57.50%), Query Frame = 2
Query: 1403 NFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWSYFVSLIIIGSFFMINLCLVVIATQFSETKKRE 1612
            NFDN+G A +A+F + S + WV IMY   DA          H+ W   YF+S +++ +FF++N+ + V+   F + ++ +
Sbjct: 1341 NFDNLGQALMALFVLSSKDGWVQIMYTGIDAVGVNIQPQENHNEWALIYFISFLLLVAFFVLNMFVGVVVENFHKCQENQ 1420          

HSP 12 Score: 52.373 bits (124), Expect = 7.029e-6
Identity = 25/97 (25.77%), Postives = 54/97 (55.67%), Query Frame = 2
Query: 4949 FSECNNDKRNTWKNQQYNFDNLGQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLLLVGFFVLNMFVGVVVENFHKCRENQ 5239
            +++C   ++N ++    NFDN+G A +++F + S + WV IMY   DA          ++ W  +YF++ +++  FF++N+ + V+   F + +  +
Sbjct:  232 YTDCQPGEKNPYEGA-INFDNIGFAWVAIFQVISMESWVDIMYYVQDA----------HSFWDWIYFVALIIIGSFFMINLCLVVIASQFSETKRRE 317          

HSP 13 Score: 52.373 bits (124), Expect = 7.149e-6
Identity = 24/81 (29.63%), Postives = 46/81 (56.79%), Query Frame = 2
Query: 3047 NFDSLLWAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLVAILVEGFSTERVDEAKLAEKIHLEK 3289
            NFD++ +A V +FQ+++ E W  ++       S W  +YFVAL+  G++ + NL + ++   FS  +  E    E++ +E+
Sbjct:  248 NFDNIGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWIYFVALIIIGSFFMINLCLVVIASQFSETKRRE---TERMWIER 325          
The following BLAST results are available for this feature:
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CACNA1H1.599e-10958.85calcium voltage-gated channel subunit alpha1 H [So... [more]
CACNA1H6.791e-1461.53calcium voltage-gated channel subunit alpha1 H [So... [more]
CACNA1H1.599e-10958.85calcium voltage-gated channel subunit alpha1 H [So... [more]
CACNA1H2.930e-1360.51calcium voltage-gated channel subunit alpha1 H [So... [more]
CACNA1H7.994e-1460.21calcium voltage-gated channel subunit alpha1 H [So... [more]
back to top
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cca-11.558e-11564.67Voltage-dependent T-type calcium channel subunit a... [more]
cca-11.558e-11564.67Voltage-dependent T-type calcium channel subunit a... [more]
cca-11.558e-11564.67Voltage-dependent T-type calcium channel subunit a... [more]
cca-12.375e-11564.67Voltage-dependent T-type calcium channel subunit a... [more]
cca-12.375e-11564.67Voltage-dependent T-type calcium channel subunit a... [more]
back to top
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ca-alpha1T2.856e-12769.45gene:FBgn0264386 transcript:FBtr0112953[more]
Ca-alpha1T8.129e-12969.45gene:FBgn0264386 transcript:FBtr0304610[more]
Ca-alpha1T2.478e-12769.45gene:FBgn0264386 transcript:FBtr0304609[more]
Ca-alpha1T2.510e-12769.45gene:FBgn0264386 transcript:FBtr0089393[more]
Ca-alpha1T7.147e-12669.45gene:FBgn0264386 transcript:FBtr0334984[more]
back to top
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacna1ha7.625e-10360.98calcium channel, voltage-dependent, T type, alpha ... [more]
cacna1hb1.832e-7655.03calcium channel, voltage-dependent, T type, alpha ... [more]
cacna1ha1.032e-1164.23calcium channel, voltage-dependent, T type, alpha ... [more]
cacna1hb6.212e-9862.25calcium channel, voltage-dependent, T type, alpha ... [more]
cacna1ia9.184e-17860.43calcium voltage-gated channel subunit alpha1 Ia [S... [more]
back to top
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
efhd18.865e-11358.65EF-hand domain family member D1 [Source:Xenbase;Ac... [more]
efhd16.290e-11355.34EF-hand domain family member D1 [Source:Xenbase;Ac... [more]
efhd19.928e-11354.59EF-hand domain family member D1 [Source:Xenbase;Ac... [more]
efhd12.140e-11263.90EF-hand domain family member D1 [Source:Xenbase;Ac... [more]
CACNA1I1.008e-10362.72calcium channel, voltage-dependent, T type, alpha ... [more]
back to top
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cacna1h1.419e-10959.97calcium channel, voltage-dependent, T type, alpha ... [more]
Cacna1h1.419e-10959.97calcium channel, voltage-dependent, T type, alpha ... [more]
Cacna1h1.619e-9559.97calcium channel, voltage-dependent, T type, alpha ... [more]
Cacna1i4.616e-10761.20calcium channel, voltage-dependent, alpha 1I subun... [more]
Cacna1i2.654e-10761.20calcium channel, voltage-dependent, alpha 1I subun... [more]
back to top
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9EQ60|CAC1H_RAT1.208e-10859.68Voltage-dependent T-type calcium channel subunit a... [more]
sp|O88427|CAC1H_MOUSE3.086e-10859.31Voltage-dependent T-type calcium channel subunit a... [more]
sp|O95180|CAC1H_HUMAN8.584e-10957.73Voltage-dependent T-type calcium channel subunit a... [more]
sp|Q9P0X4|CAC1I_HUMAN1.018e-10560.33Voltage-dependent T-type calcium channel subunit a... [more]
sp|Q9Z0Y8|CAC1I_RAT2.659e-18061.20Voltage-dependent T-type calcium channel subunit a... [more]
back to top
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
J9M5X04.011e-11753.99Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
A0A2S2PRI11.918e-11854.54Voltage-dependent T-type calcium channel subunit a... [more]
G0YP353.261e-1266.24Voltage operated calcium channel Cav3 (Fragment) O... [more]
W5KSK61.704e-9750.56Calcium channel, voltage-dependent, T type, alpha ... [more]
A0A1I8J5671.800e-14380.20CCHC-type domain-containing protein OS=Macrostomum... [more]
back to top
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacna1ha6.456e-10150.56calcium channel, voltage-dependent, T type, alpha ... [more]
cacna1ha5.644e-17657.46calcium channel, voltage-dependent, T type, alpha ... [more]
cacna1ib2.460e-17057.62calcium voltage-gated channel subunit alpha1 Ib [S... [more]
ENSAMXT00000033959.11.425e-9151.75pep primary_assembly:Astyanax_mexicanus-2.0:4:2732... [more]
ENSAMXT00000056794.16.485e-8950.58pep primary_assembly:Astyanax_mexicanus-2.0:2:2726... [more]
back to top
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001901.11.036e-8260.22pep scaffold:Pmarinus_7.0:GL477793:3961:23506:1 ge... [more]
ENSPMAT00000001900.11.282e-8257.33pep scaffold:Pmarinus_7.0:GL477793:3961:23576:1 ge... [more]
ENSPMAT00000001904.14.750e-6666.23pep scaffold:Pmarinus_7.0:GL477793:127370:134209:1... [more]
ENSPMAT00000009098.18.637e-5666.67pep scaffold:Pmarinus_7.0:GL478807:14086:32911:1 g... [more]
ENSPMAT00000008004.11.205e-4831.09pep scaffold:Pmarinus_7.0:GL477228:88466:118438:1 ... [more]
back to top
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CCH11.455e-1221.29Voltage-gated high-affinity calcium channel; invol... [more]
back to top
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO368446.073e-16557.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354973.650e-14555.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354989.290e-8151.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469911.828e-6734.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356611.573e-6033.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacna1ha2.481e-17961.87voltage-dependent T-type calcium channel subunit a... [more]
cacna1ha8.768e-17961.87voltage-dependent T-type calcium channel subunit a... [more]
cacna1hb1.578e-17564.38calcium voltage-gated channel subunit alpha1 H [So... [more]
cacna1ha5.176e-15757.69voltage-dependent T-type calcium channel subunit a... [more]
ENSORLT00000044375.11.737e-9251.99pep primary_assembly:ASM223467v1:8:13621989:136980... [more]
back to top
BLAST of Voltage-dependent T-type calcium channel subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000986.12.387e-799.65SMESG000000986.1[more]
SMESG000000986.15.635e-1299.76SMESG000000986.1[more]
SMESG000000986.10.000e+099.30SMESG000000986.1[more]
SMESG000005760.16.882e-14667.75SMESG000005760.1[more]
SMESG000005760.14.039e-14167.75SMESG000005760.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004695 ID=SMED30004695|Name=Voltage-dependent T-type calcium channel subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=7707bp
GAAACACACATACAAGCAAGGGATTAATGTAACACGGAAGGTTTTTTATG
AGATTTCTTAAATTTGATTGGCGTATTAAAATGATGTATCACACATGAAA
ATATGATGAAAAATAGCATTCTACTGCGGGACAGTGCCTCTCAAAAGTCA
AATATCTTTACAATACCATGAACATGATGTAAAACAAACTGAATTTGAAA
GATATTATGTCAATATGGAATATTTACTGACTCCCGACGACTCTTTCCTC
AACAAATCTCGATCATCAGACACAGGTCTCAATAGGTCATTGAATGAAAA
CTATGATAGTTTAAAAATATCTACTTCTCAAACATCATTTTTACCTGTTA
TGAGAACTTCTGATTACAATGATCAATCATCAATTTGCAGTCGAATGCGT
ACATCAAACGAACCCAGTGGATTATATTTTAACAATGATTTGGATAGGTC
GTCGTACATGGTAGATTCCAGTGCTGCTGAAGAAGAAAGAATTGAAAATA
CCGAGAAAAATAAGGACCTTCCATATCCGGACTACCCAGAAAAAGTATTC
TTCTTCCTTAATCAAACTCACCATCCACGGGATTGGTGTTTAAAATTTAT
TTCTTGGCCTTGGTTCGAACAATTGAGCATCGCCGTGATAATCGTCAACT
GTATCACTCTTGGGATGTACAAGCCTTGTGAAGATACGAGTTGTAAGACA
ATCAGATGTAAAATTTTAGGAGGATTCGATCATTGCATTTTCATGTTTTT
TGCTGTTGAATTAATGATAAAAATTTGCGCAATGGGATTATTGGGGCCAT
CTGGATATTTTTCAGAATCATGGAATAGATTAGATATGGTCATAGTGATT
GCAGGTTTAATTGAGTGTATTCCATCGACTGGAGAGATGAGTCTGACAGC
CATCAGGACAGTCCGAGTGTTACGCCCGCTTAGAGCAATTAATAGAATCC
CAAGTATGAGGATTCTCGTGATGTTGTTATTGGACACATTGCCGATGTTA
GGAAATGTTCTGTTACTCTGTTTTTTTGTTTTTTTCATTTTCGGAATCGT
CGGAGTACAAATGTGGCAGGGCATTCTACGAAATCGCTGCTATTTGCATC
TTAATAGTTCTTATCGTCATCCTGGGTTAAACTTATCATATTACTATCAA
GTTAATCAAACGACCACCCAATTGAGTCCACACAAAGATTTTATATGTTC
TCCAGATAATTTCAATGGGCTAGTGAAATGCTCAGACATACCCCCAAGTG
TCATATGGTTGCCATCAGGAGAAGCTCGAGTTTGCAACGATTCAGCATTA
CCGAATTCCGACAATATGCCAACAAATGTGTCGTGCGTTAATTGGAATCA
GTATTATAGCAAATGTGAAGCCAGAGCCAATAATCCATATTACGGGGCCA
TAAATTTTGATAATATAGGATTTGCGTGGGTTGCAATTTTTCAAGTAATC
AGCATGGAGAGCTGGGTTGACATAATGTATTATGTTCAGGATGCTCATTC
ATTTTGGGACTGGTCGTATTTTGTTTCATTGATAATAATTGGTTCATTTT
TTATGATAAATCTCTGCCTCGTAGTAATCGCAACTCAATTCTCTGAAACA
AAAAAGCGAGAAACTGAGAGAATGCTTATGGAAAGAAAGAAACAACAATC
TACGAGCACATTAGGAAGCAGCATAGAACCTCAATCTTGTTATCATGAAA
TCATAAAGCTCATTTCAAGATTTTGTCGACATCTTCTTAAAACTGTCATT
AAACGATACGAAAGATTTTCGGAGAAACATGAAAATCTGACATATTTCAC
TAAGCGACTTGTTTTCATGCATAAAAAAAATTCAGTTAAAGGAAAAAGGA
AAAGAAACAAAAAAGATAAATCCACTTCAAAACAACTGGTTAAAGATTTC
AAATATAAAGATATAGACAGAACTAAATTTAAGGACACATTTCAAGTAGA
CTTTCAACCTCAAACGTTAAACAACCGCAATCAATCCGTACCCTGTAAAG
TGTTATTAAATGTCAGTAACAGGAATTTACGTCCATCAGACTCACAAACA
ACTCAATGTGGAATAACGCCTGCTTATGTCAAATTATCTATGATTAGAGG
ACTCAATGGATCTTCGAGATCGCAGTCTCTTTCGTCTGACTCAATGCTAT
CTGCATCTCCAATGCTAATAAAAGTTCCTTCGTCTCAGTTGAAATTCATT
ACTACAACTGCTGATATATCTACCAGCCGATCAAATCAGTCGTTCGTTTT
GCGTCGGTCGTCTTGGAACAGCAATTATAGACGATCACAGGCCATGTTGA
TTAAGGAAAATGTCAACGATCAATCAAAAGAACTTTTAAGTTCCAATCAA
CAAATTTCAGCGAATCAGCTTCAAAGACAACTGACCTGTTCAAAGACCAA
AGTCCTTCAGTTCAAAAATTTAAATGACGCTATTAATCATGATAAAGTCG
ATGAATCTGAAGAAAATTCCGATTATGAATCAGAGGGAGAACAATCAGAA
AGTAAAAAAAGTTTGGGTGTGAGATTCAGGAAAAAAATGAAAAGTATTGT
AGCTCACCGGTATTTTCAAAGGGGTATTCTTATTGCTATTCTCATCAATA
CTTTGAGTATGGGAATCGAGTACCACAATCAACCAGTTTTACTGACAAAC
ACTTTGGAGTATAGCAACATGATATTCAATGGACTTTTTTTGGTTGAGAT
GCTGCTAAAGATTTTAGCCGAAGGACTACTGGGTTACATAAGCAATGGAT
TCAATGTCTTTGATGGAGGCATCGTTATATTAGGACTTGTGGAATTAGCT
CAAGAAGGAGGGGCATCCGGGCTTTCAGTTTTACGTACTTTTCGTTTATT
GCGAATTCTCAAATTAGTAAGATTTATGCCAGCTCTTCGACTACAGTTGA
TTGTCATGTTGAAAACAATGGATAATGTAGCAACATTTTTCGCTCTTCTT
ATTCTATTTATTTTCATATTTAGTATTCTTGGAATGAGTTTGTTTGGATG
CAAATTTTGTAAATTCAAAAACGGCAAGAGGAAATGCGATAGGAAAAACT
TTGATTCTCTACTTTGGGCAATCGTTACGGTTTTCCAGATTTTAACTCAA
GAAGATTGGAATGCGGTTTTGATAAGCGGAATGTCCCAAACGTCTTCTTG
GGCAGCATTATATTTTGTAGCTTTGATGACTTTTGGGAATTATGTACTTT
TCAATTTACTTGTGGCCATTCTTGTGGAAGGATTTTCTACTGAAAGAGTA
GACGAAGCGAAACTTGCTGAGAAAATACATTTGGAAAAACACAATGAAGA
AAAGATGGCAAATTTAATGAAGCATGAAGCACATAAAAATCAAGAAACAA
CAAAAAATTCAAGTATCGAACCTCAGGAAGTGATATCAAACAATAAAAAT
ATTGCCATAATACGCAAGGGATCTCTGAATCAGAAACAAGTAATGCCCAT
AATAACTCATACCGACGCAACGCCAATGCCGTCTCCAAGGGCAAGTCCAT
TCAATGATCGGGAGATATTTCATCAGGAAATGGATTCTTTGAGTCGAAAA
TCGCAATTGATGAGCAACACTGACGGGGAGTCTCTCGGTGTCCCATTAGT
TTTACAGCATGATCAAAGAAATCTTTCTAGAAGAGGAAGTGATTCGTCGA
TTAACCACCAGCCGGTCGGGCAGCAATGTCGAAAAACCAATTGTTCACCA
ACTCGCCTCCATCCGAATTTGACAATTCCATCAAGTCGAACAGATGGATT
ATCAGTGATCCCAGCTGAATCCAACTATTCAACAGCTTCTACGTTCAGAT
CAAGATCGCCTAGCTTACAACTATATGGACTGCCAATAACTCTCAACAAA
TTCAATTCAAATAGTGGACAGATCATTCAGCATTCAGGTGTTTTGGTCAG
GAGATCATCAATCGGTCAAAACAGCAACTGCAGTGCATTAAGCAATCAAA
ATACCGCAGGCTCATTAACATTAAGTGAAAAGGGGGATGAAATATATTCC
AAATGTCCGACTCCAAACACGGAACATAACAACAAAGATACAGATGCCGA
GAGCAGTTTGATATGTAACAGTCGACGTTCTTCAAGTAACAGTAGTCGCT
TTGTGTCTCCAGAAAGCATTCATAACTCTCAACCATCATTAAAAACTAGC
ATGTTTCTTCCAATGGTTTTTATTGATAGTTCATTTGTTAGTAAACTTCC
AAGTAACTTAACCATGGGCAATGAAAAATGTGCAGATGAAGATTCAAGTC
TTTTAAATCAAGATCAAGATGATCACAATGAGAATGAAGAAAAAATTCTT
TGTAATTATTTTTGGTGCAGCTGGTTGTCAAAGTTTTTCAGAGCTCATTA
CTACGATTCCTTATTTGTCTTATCCCCGGATAACAGATTCCGAAACTCTT
GTCAAAATCTAATGGAAAAAAAAGTATTCGACAATATTGTCTTGTTTTTC
ATCGCTCTGAATTGCATAACATTGGCTATGGAAAGACCATCTATACCACA
GAAAAGCAGGGAGAGAGAATTTCTCACAATAACAAATTATGTATTTACTG
TGATATTTGCAGTTGAAATGACAATAAAAGTAATTGCTAAAGGATTACTT
GTAGGAAAGCATTCATATTTACGTAGCGGATGGAATGTTATGGATGGGTT
GTTGGTTGTCATATCCCTAGCTGATATCATGATCGTTCTTATTATCGGTC
ACAGCAGCAGAATATTTGGAATTCTTCGAGTGTTTCGCCTGTTGCGCACC
TTAAGACCATTAAGGGTAATTAGCAGAGCTCCCGGTCTCAAATTAGTTGT
TCAAACATTGCTTTCATCACTGAGGCCTATTGGAAACATTGTTTTGATTT
GTTGTACGTTTTTCATCATTTTTGGAATTTTCGGAGTTCAACTTTTTAAA
GGAAAGTTTTACTACTGTTCTGGTCCGGATGTAGCCCATGTCAAAAACTT
TAGTGAATGTAATAATGACAAGAGAAATACGTGGAAAAACCAACAATACA
ATTTTGACAATTTAGGGCAAGCGCTTATGTCTTTATTTGTTCTTTCATCA
AAAGATGGATGGGTTCAAATTATGTACACTGGATTAGATGCAGTTGGAGT
AAATCAACAACCCCAAGAAAATTACAACGAATGGTATTTGTTGTACTTTA
TTTCATTTTTGTTGCTTGTGGGATTTTTTGTACTCAATATGTTTGTTGGA
GTTGTAGTTGAAAACTTTCATAAATGTCGTGAAAACCAAGAGAAAGAAGA
AAAAGCAAGAAGAGCAGCAAAAAGAGCTAGAAGACTAGAGAAAAAGAAAA
AAAAAATGATGCAGCCTCCATATTGGAAATTTTATCCTCACTGGAGGCTT
CTAATTCATGGATTAGTAAATAGTAAATACTTTGATTTGGCTATTGCAGG
AATTATCGGTTTAAATGTCATTACAATGGCTATGGAGTTTTATATGATGC
CAGTAGAACTTGAAGTTGCTTTGAAAAGTTTGAATTACATTTTTACTTCG
GTTTTCATTATTGAAGCACTAATCAAGACCATTGCGTACGGTCCGAAACG
ATATATTATTGATAGGTGGAATCAATTAGACGTTTTAATAGTGATATTAT
CTGTTTCCGGAATTGTGATGGAAGAGATGAAAAATAAATACATTCCAATA
AATATGACAATAATCAGAGTGTTTAGGGTACTGAGAATTGCTAGAGTTCT
GAAACTCCTCAAGATGGCAAAAGGTATTCGTGCATTGCTGGATACTGTTA
TTCAAGCTCTACCTCAAGTTGGTAATCTGGGATTACTATTCTTTTTGCTG
TTTTTTATATTTGCTGCTCTTGGAGTTGAACTCTTTGGCCGATTAGAATG
TTCTGACTACAATCCATGTACCGGACTCAGTAGACACGCCCATTTTGAGA
ATTTTGGAATGGCTTTTCTTACGCTTTTTCGAATCGCTACAGGGGACAAT
TGGAATGGAATTATGAAAGATACATTACGAAACAAATGTGATAATTCGGA
AGAATGTCAGAAAAACTGTTGTGTATCGCCTATAATCGCACCGATTTACT
TTGTAATATTTGTTTTAATGGCTCAATTTGTACTAGTAAATGTTGTTGTT
GCCGTTTTAATGAAACATCTCGAGGAATCTCATAAAATGATGTGCGATGA
CGATGAAATTGAGAAAGAGGTTCAAAGAGAAATTGATGAGGAAAATAAAG
AAAAACTAAGAGAGAATATAACATCTGATGTCGAAGAAATTGAAAATCGT
GGCAATAAAGAAATTAAAGAACAAATCATTGAACCGAACAATAATAATAT
AGTTTTTGAACCGAAAAAAATTGAAATTAAATGTAATCGTCTTTCTAATT
CTGCTGCTGTAAAATTCAATCGCAACGCTAACTCACAAGACAGTGCTGAT
TCCGGGAAAACGCCGCCAGATAATGGCAGCGGTGGAACATTACATATCCT
CAATTTGCCTGCATCAAGGAAGCTCCATGAACAATTATCTCAGAGTCAAC
CGTTATTGCTAGTCAATTTAAACCCAGACTCTTTGAAAAATCTCAATCAA
ATTAGTAATACGAATACTCAAACGAAACCGGTTGAAAGTAGTAATAGAAA
AGTTTTGCTAAAAAATACATCTAAAAAATGGAGTACAATGGATGATGGAT
TTCCTGTTAAAAGAACGAAGCTCGTTTATCATCTTGCTACAGATTTGCCG
TTATCATCGGCTGTTATACCAATAAATGCCTATTCTCAAAAGAATAAAAA
TTATTGTGACTGGAATGAAGATGATTGCGACGAAGAAATACAGAAAATAA
CAGCGATAAGAGATCAGAAGCCTTCTAATGCAGAAACTAATAGACGAAAA
TTTGTTATGCAAAAATCATATTCTATGCAACAAAATTCCTCTGGAAACTT
TCTCACAATCAAACCTATTATTAACAAACAAGAAACCCCTTTGAAGAATT
TTTCAATTAAAGACCACGTAAACAGTGACGAACCAAATCTTCAAATGCGT
CCAAAGTTGTCAGTGAATATGGAAAATAGTGCAATTCAGACGAACACGAC
CATTCCTCAAATTGGCTTGGCTGAGAATAGACGAAAGGTTTTCGCAGCTG
GGGGTGGAAAAAAACGTAGCAATACAGGAGCTAGTATTGATACACAAAAT
ATTGAGAATGAGGAAATCCAAATACCAACTTCAGATTATGAAGATAACTC
AACAACTAATACGAGCGGTTTAAATATTTTTCTAAAACCTTCTAGTACTA
TCCCATCGGTAATGGCTGGTTCCATTCCACGCAAACGATCGAATGTTATC
ATGAGCAGTTTGGAAGTTCCAAATCCTCACTTGAAAGTTGGATCAGTTTC
ACCGATTTCAATTCGATCAAACAATATTCCTAGAGTGACTCCTGAAGCTA
GTGAAGAGTTTATTGATCAAGATTCAGATTTCTAAATTTCATTTCTAAGA
TGTATTTATTTACGGACTCCAGAGATGCTCAAAATACTTTAATTCCTCTA
ATTTACGATTCAAGATTCTTCACAGATGAAGAAAGTGATTTCATATTTGG
CTGAGTTGTGCACATTTGAAAGGGTTTTGTAGAATTGATTAGCTTATTAT
CATCGATTTTCACTTTTAAAATCAGATTTCCATATCAAAATTAAAATTAA
TGATTTGTTTGTGATTACCTTTTGTAATTATTGGTTTTAGAAATATTAAT
AAAGTGA
back to top

protein sequence of SMED30004695-orf-1

>SMED30004695-orf-1 ID=SMED30004695-orf-1|Name=SMED30004695-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2407bp
MEYLLTPDDSFLNKSRSSDTGLNRSLNENYDSLKISTSQTSFLPVMRTSD
YNDQSSICSRMRTSNEPSGLYFNNDLDRSSYMVDSSAAEEERIENTEKNK
DLPYPDYPEKVFFFLNQTHHPRDWCLKFISWPWFEQLSIAVIIVNCITLG
MYKPCEDTSCKTIRCKILGGFDHCIFMFFAVELMIKICAMGLLGPSGYFS
ESWNRLDMVIVIAGLIECIPSTGEMSLTAIRTVRVLRPLRAINRIPSMRI
LVMLLLDTLPMLGNVLLLCFFVFFIFGIVGVQMWQGILRNRCYLHLNSSY
RHPGLNLSYYYQVNQTTTQLSPHKDFICSPDNFNGLVKCSDIPPSVIWLP
SGEARVCNDSALPNSDNMPTNVSCVNWNQYYSKCEARANNPYYGAINFDN
IGFAWVAIFQVISMESWVDIMYYVQDAHSFWDWSYFVSLIIIGSFFMINL
CLVVIATQFSETKKRETERMLMERKKQQSTSTLGSSIEPQSCYHEIIKLI
SRFCRHLLKTVIKRYERFSEKHENLTYFTKRLVFMHKKNSVKGKRKRNKK
DKSTSKQLVKDFKYKDIDRTKFKDTFQVDFQPQTLNNRNQSVPCKVLLNV
SNRNLRPSDSQTTQCGITPAYVKLSMIRGLNGSSRSQSLSSDSMLSASPM
LIKVPSSQLKFITTTADISTSRSNQSFVLRRSSWNSNYRRSQAMLIKENV
NDQSKELLSSNQQISANQLQRQLTCSKTKVLQFKNLNDAINHDKVDESEE
NSDYESEGEQSESKKSLGVRFRKKMKSIVAHRYFQRGILIAILINTLSMG
IEYHNQPVLLTNTLEYSNMIFNGLFLVEMLLKILAEGLLGYISNGFNVFD
GGIVILGLVELAQEGGASGLSVLRTFRLLRILKLVRFMPALRLQLIVMLK
TMDNVATFFALLILFIFIFSILGMSLFGCKFCKFKNGKRKCDRKNFDSLL
WAIVTVFQILTQEDWNAVLISGMSQTSSWAALYFVALMTFGNYVLFNLLV
AILVEGFSTERVDEAKLAEKIHLEKHNEEKMANLMKHEAHKNQETTKNSS
IEPQEVISNNKNIAIIRKGSLNQKQVMPIITHTDATPMPSPRASPFNDRE
IFHQEMDSLSRKSQLMSNTDGESLGVPLVLQHDQRNLSRRGSDSSINHQP
VGQQCRKTNCSPTRLHPNLTIPSSRTDGLSVIPAESNYSTASTFRSRSPS
LQLYGLPITLNKFNSNSGQIIQHSGVLVRRSSIGQNSNCSALSNQNTAGS
LTLSEKGDEIYSKCPTPNTEHNNKDTDAESSLICNSRRSSSNSSRFVSPE
SIHNSQPSLKTSMFLPMVFIDSSFVSKLPSNLTMGNEKCADEDSSLLNQD
QDDHNENEEKILCNYFWCSWLSKFFRAHYYDSLFVLSPDNRFRNSCQNLM
EKKVFDNIVLFFIALNCITLAMERPSIPQKSREREFLTITNYVFTVIFAV
EMTIKVIAKGLLVGKHSYLRSGWNVMDGLLVVISLADIMIVLIIGHSSRI
FGILRVFRLLRTLRPLRVISRAPGLKLVVQTLLSSLRPIGNIVLICCTFF
IIFGIFGVQLFKGKFYYCSGPDVAHVKNFSECNNDKRNTWKNQQYNFDNL
GQALMSLFVLSSKDGWVQIMYTGLDAVGVNQQPQENYNEWYLLYFISFLL
LVGFFVLNMFVGVVVENFHKCRENQEKEEKARRAAKRARRLEKKKKKMMQ
PPYWKFYPHWRLLIHGLVNSKYFDLAIAGIIGLNVITMAMEFYMMPVELE
VALKSLNYIFTSVFIIEALIKTIAYGPKRYIIDRWNQLDVLIVILSVSGI
VMEEMKNKYIPINMTIIRVFRVLRIARVLKLLKMAKGIRALLDTVIQALP
QVGNLGLLFFLLFFIFAALGVELFGRLECSDYNPCTGLSRHAHFENFGMA
FLTLFRIATGDNWNGIMKDTLRNKCDNSEECQKNCCVSPIIAPIYFVIFV
LMAQFVLVNVVVAVLMKHLEESHKMMCDDDEIEKEVQREIDEENKEKLRE
NITSDVEEIENRGNKEIKEQIIEPNNNNIVFEPKKIEIKCNRLSNSAAVK
FNRNANSQDSADSGKTPPDNGSGGTLHILNLPASRKLHEQLSQSQPLLLV
NLNPDSLKNLNQISNTNTQTKPVESSNRKVLLKNTSKKWSTMDDGFPVKR
TKLVYHLATDLPLSSAVIPINAYSQKNKNYCDWNEDDCDEEIQKITAIRD
QKPSNAETNRRKFVMQKSYSMQQNSSGNFLTIKPIINKQETPLKNFSIKD
HVNSDEPNLQMRPKLSVNMENSAIQTNTTIPQIGLAENRRKVFAAGGGKK
RSNTGASIDTQNIENEEIQIPTSDYEDNSTTNTSGLNIFLKPSSTIPSVM
AGSIPRKRSNVIMSSLEVPNPHLKVGSVSPISIRSNNIPRVTPEASEEFI
DQDSDF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005261cation channel activity
GO:0005245voltage-gated calcium channel activity
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005262calcium channel activity
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005891voltage-gated calcium channel complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR043203VGCC_Ca_Na
IPR005445VDCC_T_a1
IPR002077VDCCAlpha1
IPR005821Ion_trans_dom
IPR027359Volt_channel_dom_sf
IPR001507ZP_dom
Vocabulary: biological process
TermDefinition
GO:0070588calcium ion transmembrane transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0006816calcium ion transport
GO:0034765regulation of ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1992..2012
NoneNo IPR availableCOILSCoilCoilcoord: 1674..1694
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 892..1006
e-value: 4.7E-37
score: 128.3
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 1837..1974
e-value: 2.9E-30
score: 106.4
coord: 378..465
e-value: 1.3E-15
score: 59.2
coord: 1524..1673
e-value: 9.3E-24
score: 85.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 742..761
NoneNo IPR availablePANTHERPTHR10037:SF192VOLTAGE-DEPENDENT T-TYPE CALCIUM CHANNEL SUBUNIT ALPHA-1Hcoord: 137..2247
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 1402..1672
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 781..1008
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 131..462
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 1720..1973
NoneNo IPR availableTMHMMTMhelixcoord: 391..413
NoneNo IPR availableTMHMMTMhelixcoord: 1855..1877
NoneNo IPR availableTMHMMTMhelixcoord: 820..842
NoneNo IPR availableTMHMMTMhelixcoord: 1897..1916
NoneNo IPR availableTMHMMTMhelixcoord: 980..1002
NoneNo IPR availableTMHMMTMhelixcoord: 948..970
NoneNo IPR availableTMHMMTMhelixcoord: 905..927
NoneNo IPR availableTMHMMTMhelixcoord: 1473..1495
NoneNo IPR availableTMHMMTMhelixcoord: 1755..1777
NoneNo IPR availableTMHMMTMhelixcoord: 1944..1966
NoneNo IPR availableTMHMMTMhelixcoord: 259..281
NoneNo IPR availableTMHMMTMhelixcoord: 1723..1745
NoneNo IPR availableTMHMMTMhelixcoord: 1643..1665
NoneNo IPR availableTMHMMTMhelixcoord: 1436..1458
NoneNo IPR availableTMHMMTMhelixcoord: 1539..1561
NoneNo IPR availableTMHMMTMhelixcoord: 433..455
IPR002077Voltage-dependent calcium channel, alpha-1 subunitPRINTSPR00167CACHANNELcoord: 1595..1607
score: 41.11
coord: 944..970
score: 56.83
IPR005445Voltage-dependent calcium channel, T-type, alpha-1 subunitPRINTSPR01629TVDCCALPHA1coord: 800..813
score: 66.67
coord: 488..502
score: 43.89
coord: 112..128
score: 56.86
coord: 154..170
score: 52.94
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 1393..1523
e-value: 6.2E-34
score: 118.6
coord: 771..891
e-value: 2.2E-30
score: 107.1
coord: 1711..1835
e-value: 2.5E-31
score: 110.1
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 124..246
e-value: 1.0E-23
score: 85.7
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 132..466
e-value: 2.0E-66
score: 223.7
coord: 1403..1675
e-value: 7.6E-67
score: 225.1
coord: 1721..1973
e-value: 7.7E-53
score: 179.2
coord: 781..1013
e-value: 1.2E-49
score: 168.7
IPR043203Voltage-gated cation channel calcium and sodiumPANTHERPTHR10037VOLTAGE-GATED CATION CHANNEL CALCIUM AND SODIUMcoord: 137..2247