Oxygen-dependent choline dehydrogenase

Overview
NameOxygen-dependent choline dehydrogenase
Smed IDSMED30004686
Length (bp)1941
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Oxygen-dependent choline dehydrogenase (SMED30004686) t-SNE clustered cells

Violin plots show distribution of expression levels for Oxygen-dependent choline dehydrogenase (SMED30004686) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Oxygen-dependent choline dehydrogenase (SMED30004686) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Oxygen-dependent choline dehydrogenase (SMED30004686) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004686

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30004686SMESG000064120.1 SmedASXL_013467SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30004686SMESG000064120.1 SmedASXL_013467SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30004686SMESG000064120.1 dd_Smed_v4_13047_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30004686SMESG000064120.1 SMED30004686smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Human
Match: CHDH (choline dehydrogenase [Source:HGNC Symbol;Acc:HGNC:24288])

HSP 1 Score: 78.5666 bits (192), Expect = 1.478e-14
Identity = 82/312 (26.28%), Postives = 135/312 (43.27%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLLHSS-------LKYNQIPI-------GKNLQDHVIFGMFYQLTRSKTI--SVEDLYHIREVMEYI--FLGKGLYSIPSAMVTSGYFTFENSSTP--DIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVK 1898
            ++ILS GAI S +LL  S       LK   IP+       G+NLQDH+   +    TR  T+  + + L  +   +E++  F G+G     +A + +G F       P  DIQ+       ++H  +               P  Q      + + +  ++  S G +K  S        I P Y S+  D+   +  V+ +TR+I     F      P+  K  Q P      D  +   ++  + S+YH + T  +G   D  +V++P  RV    NL V+DAS++P + +GN      +IA K AD++K
Sbjct:  291 EVILSGGAINSPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTRPITLHSAQKPLRKVCIGLEWLWKFTGEGA----TAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRV---------------PTQQE----AYQVHVGPMRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVK-LTREI-----FAQEALAPFRGKELQ-PGSHIQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENLRVVDASIMPSMVSGNLNAPTIMIAEKAADIIK 572          

HSP 2 Score: 57.7658 bits (138), Expect = 4.540e-8
Identity = 42/134 (31.34%), Postives = 69/134 (51.49%), Query Frame = 1
Query:  325 KTDFTYIIVGAGTAGSILAARLSETKND-VLLLEAGPKSGIITRAFSNTPLLVP-LIIKN--DSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSW---NISGWKYKDIDKYL 705
            + +++Y++VGAG+AG +LA RL+E   + VLLLEAGPK  +      +  + +P  ++ N  D    W Y T  Q      +  + +    G++ GG+S +NAM+  +   ED++ W      GW Y     Y 
Sbjct:   38 RDEYSYVVVGAGSAGCVLAGRLTEDPAERVLLLEAGPKDVLAGSKRLSWKIHMPAALVANLCDDRYNWCYHTEVQRG----LDGRVLYWPRGRVWGGSSSLNAMVYVRGHAEDYERWQRQGARGWDYAHCLPYF 167          
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Human
Match: CHDH (choline dehydrogenase [Source:HGNC Symbol;Acc:HGNC:24288])

HSP 1 Score: 56.6102 bits (135), Expect = 6.764e-9
Identity = 39/121 (32.23%), Postives = 66/121 (54.55%), Query Frame = 1
Query:  325 KTDFTYIIVGAGTAGSILAARLSETKND-VLLLEAGPKSGIITRAFSNTPLLVP-LIIKN--DSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSWNISG 675
            + +++Y++VGAG+AG +LA RL+E   + VLLLEAGPK  +      +  + +P  ++ N  D    W Y T  Q      +  + +    G++ GG+S +NAM+  +   ED++ W   G
Sbjct:   38 RDEYSYVVVGAGSAGCVLAGRLTEDPAERVLLLEAGPKDVLAGSKRLSWKIHMPAALVANLCDDRYNWCYHTEVQRG----LDGRVLYWPRGRVWGGSSSLNAMVYVRGHAEDYERWQRQG 154          
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Human
Match: CHDH (choline dehydrogenase [Source:HGNC Symbol;Acc:HGNC:24288])

HSP 1 Score: 47.7506 bits (112), Expect = 4.688e-6
Identity = 21/38 (55.26%), Postives = 31/38 (81.58%), Query Frame = 1
Query:  325 KTDFTYIIVGAGTAGSILAARLSETKND-VLLLEAGPK 435
            + +++Y++VGAG+AG +LA RL+E   + VLLLEAGPK
Sbjct:   38 RDEYSYVVVGAGSAGCVLAGRLTEDPAERVLLLEAGPK 75          
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Celegans
Match: C34C6.4 (pep chromosome:WBcel235:II:8696591:8698928:-1 gene:WBGene00007917.1 transcript:C34C6.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C34C6.4)

HSP 1 Score: 81.6481 bits (200), Expect = 6.949e-16
Identity = 77/323 (23.84%), Postives = 149/323 (46.13%), Query Frame = 3
Query: 1035 IILSAGAIESAKLLHSS-------LKYNQIPI-------GKNLQDHVIFGMFYQLTRSKTISVEDLYHIREVMEYIFL-GKGLYSIPSAMVTSGYFTFENSSTPDIQYCIFGIGSLNHSTIKWLSNYEDSIWQ-----KYLPNNQSE------SASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPD-LRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVKEMTKM 1913
            +IL+ GAI + +LL  S       L+ ++IPI       G+NLQDH+                 ++Y  +E  + + L  K  +  P  M+  G   F N +         G+G+ +H      +  +D++        +LP+   +      +  G+ + +  ++ +S+G I   +K   +   I+P Y     D    +  ++ ++R++ +SK F +       P    C Q D + D +    ++  + S+YH + T  +G+ +D  +V+NP+ + V  T NL V+DASV+P + +GN    + ++A + ADL+K   ++
Sbjct:  298 VILAGGAINTPQLLMLSGVGPADHLRSHEIPIVANLPGVGQNLQDHL-----------------EIYVQQESTQPVTLYNKSSWKFPHNMIKIGLEWFTNRT---------GLGASSHLETGGFARSDDTVTHPDIQFHFLPSTVHDDGRTNGTCHGYQVHVGPMRSQSKGYIMLQAKDPRRAPIINPNYMEEDSDWREFRKCIR-VSRELFASKAFDEFRGKELAPG-PDC-QSDADIDRF----VKEKAASAYHPSCTCKMGSENDKMAVVNPETMGVYGTENLKVVDASVMPSIVSGNLNAPVIMMAERAADLIKHKKQL 587          

HSP 2 Score: 52.7582 bits (125), Expect = 7.338e-7
Identity = 49/152 (32.24%), Postives = 69/152 (45.39%), Query Frame = 1
Query:  301 ATDSMGLLKTDFTYIIVGAGTAGSILAARLSE-TKNDVLLLEAGP-KSGIITRAFSNTPLLVPLIIKNDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSW---NISGWKYKDIDKYLNPEKYCGQRTKP 741
             T S  + +   T+IIVGAG+AG +LA RL+E   N VLL+EAGP       R      L+  L      +  W Y T  Q N    + N+      G++ GG+S +NAM   +    D++ W     SGW Y +   Y    +     T P
Sbjct:   27 GTFSADIAENKPTHIIVGAGSAGCVLANRLTEDPSNRVLLIEAGPVDHKWDWRIHMPAALMYNLC---SDTYNWHYHTTAQKN----LGNRVFYWPRGRVWGGSSTLNAMCYVRGHAYDYNRWEKEGASGWNYANCLPYFKKAETYSDATGP 171          
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Fly
Match: CG9518 (gene:FBgn0030590 transcript:FBtr0073983)

HSP 1 Score: 125.561 bits (314), Expect = 1.574e-43
Identity = 91/314 (28.98%), Postives = 150/314 (47.77%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLL-------------HSSLKYNQIPIGKNLQDHVIFGMFYQLTRSKTISVEDLYHIREV-MEYIFLGKG----LYSIPSAMVTSGYFTFENSSTPDIQYCIF--GIGSLNHSTIKWLSNYEDSIWQK-YLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVKE 1901
            ++I+SAGAI + +L+             H       +P+G+N+QDHV  G    L       V+D ++   V  +Y+   +G    L  +         ++  +   PDIQ+ +    I S N + +K +   ++S++Q+ Y P    +S   + I   LL+P SRG +K  S   +    I+  YF    D  TL  G + I  ++  ++ F+  G+  +      C Q     D YL C ++  S++ YH  GT  +G   D  +V++P LRV     L VIDAS++P + +GN    + +IA KGADL+KE
Sbjct:  306 EVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLPVGENMQDHVGMGGLTFLVDKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPYSNRSLDWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPIANKDS---WTIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAK-IALRVAEAQVFKQFGSRLWRKPLPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRVIDASIMPTISSGNTNAPVIMIAEKGADLIKE 615          

HSP 2 Score: 71.633 bits (174), Expect = 1.574e-43
Identity = 77/263 (29.28%), Postives = 118/263 (44.87%), Query Frame = 1
Query:  322 LKTDFTYIIVGAGTAGSILAARLSETKN-DVLLLEAGPKSGIITRAFSNTPLLVPLIIKNDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSW---NISGWKYKDIDKYL-------NP----EKYCGQRTKPLRQE-----PRLEVLRRSATFL---NGKYENEGTLSFDYPQISYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSVTSVNGLYRSENVNFRLKKGGKLY 1041
            L  ++ +I+VG+G+AG+++A RLSE +   VLL+EAGP    I    S+ P L   +    S + W Y+T     A L M+N +     G++LGG+S++N M+  +  + D+D W      GW Y ++ +Y        NP     KY G+      QE     P +     + T L   N          F   Q +     R ST    L  I   KN H+  +  VT++ I+         G  R++ V F   K GK+Y
Sbjct:   53 LYPEYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEI----SDVPSLAAYL--QLSKLDWAYKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVLRYFKKSEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDINGAKQAGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEP--------GTMRAQAVEF--VKHGKVY 299          
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Fly
Match: CG9518 (gene:FBgn0030590 transcript:FBtr0343598)

HSP 1 Score: 125.561 bits (314), Expect = 1.574e-43
Identity = 91/314 (28.98%), Postives = 150/314 (47.77%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLL-------------HSSLKYNQIPIGKNLQDHVIFGMFYQLTRSKTISVEDLYHIREV-MEYIFLGKG----LYSIPSAMVTSGYFTFENSSTPDIQYCIF--GIGSLNHSTIKWLSNYEDSIWQK-YLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVKE 1901
            ++I+SAGAI + +L+             H       +P+G+N+QDHV  G    L       V+D ++   V  +Y+   +G    L  +         ++  +   PDIQ+ +    I S N + +K +   ++S++Q+ Y P    +S   + I   LL+P SRG +K  S   +    I+  YF    D  TL  G + I  ++  ++ F+  G+  +      C Q     D YL C ++  S++ YH  GT  +G   D  +V++P LRV     L VIDAS++P + +GN    + +IA KGADL+KE
Sbjct:  306 EVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLPVGENMQDHVGMGGLTFLVDKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPYSNRSLDWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPIANKDS---WTIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAK-IALRVAEAQVFKQFGSRLWRKPLPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRVIDASIMPTISSGNTNAPVIMIAEKGADLIKE 615          

HSP 2 Score: 71.633 bits (174), Expect = 1.574e-43
Identity = 77/263 (29.28%), Postives = 118/263 (44.87%), Query Frame = 1
Query:  322 LKTDFTYIIVGAGTAGSILAARLSETKN-DVLLLEAGPKSGIITRAFSNTPLLVPLIIKNDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSW---NISGWKYKDIDKYL-------NP----EKYCGQRTKPLRQE-----PRLEVLRRSATFL---NGKYENEGTLSFDYPQISYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSVTSVNGLYRSENVNFRLKKGGKLY 1041
            L  ++ +I+VG+G+AG+++A RLSE +   VLL+EAGP    I    S+ P L   +    S + W Y+T     A L M+N +     G++LGG+S++N M+  +  + D+D W      GW Y ++ +Y        NP     KY G+      QE     P +     + T L   N          F   Q +     R ST    L  I   KN H+  +  VT++ I+         G  R++ V F   K GK+Y
Sbjct:   53 LYPEYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEI----SDVPSLAAYL--QLSKLDWAYKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVLRYFKKSEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDINGAKQAGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEP--------GTMRAQAVEF--VKHGKVY 299          
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Fly
Match: CG9518 (gene:FBgn0030590 transcript:FBtr0344175)

HSP 1 Score: 125.561 bits (314), Expect = 1.574e-43
Identity = 91/314 (28.98%), Postives = 150/314 (47.77%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLL-------------HSSLKYNQIPIGKNLQDHVIFGMFYQLTRSKTISVEDLYHIREV-MEYIFLGKG----LYSIPSAMVTSGYFTFENSSTPDIQYCIF--GIGSLNHSTIKWLSNYEDSIWQK-YLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVKE 1901
            ++I+SAGAI + +L+             H       +P+G+N+QDHV  G    L       V+D ++   V  +Y+   +G    L  +         ++  +   PDIQ+ +    I S N + +K +   ++S++Q+ Y P    +S   + I   LL+P SRG +K  S   +    I+  YF    D  TL  G + I  ++  ++ F+  G+  +      C Q     D YL C ++  S++ YH  GT  +G   D  +V++P LRV     L VIDAS++P + +GN    + +IA KGADL+KE
Sbjct:  306 EVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLPVGENMQDHVGMGGLTFLVDKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPYSNRSLDWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPIANKDS---WTIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAK-IALRVAEAQVFKQFGSRLWRKPLPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRVIDASIMPTISSGNTNAPVIMIAEKGADLIKE 615          

HSP 2 Score: 71.633 bits (174), Expect = 1.574e-43
Identity = 77/263 (29.28%), Postives = 118/263 (44.87%), Query Frame = 1
Query:  322 LKTDFTYIIVGAGTAGSILAARLSETKN-DVLLLEAGPKSGIITRAFSNTPLLVPLIIKNDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSW---NISGWKYKDIDKYL-------NP----EKYCGQRTKPLRQE-----PRLEVLRRSATFL---NGKYENEGTLSFDYPQISYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSVTSVNGLYRSENVNFRLKKGGKLY 1041
            L  ++ +I+VG+G+AG+++A RLSE +   VLL+EAGP    I    S+ P L   +    S + W Y+T     A L M+N +     G++LGG+S++N M+  +  + D+D W      GW Y ++ +Y        NP     KY G+      QE     P +     + T L   N          F   Q +     R ST    L  I   KN H+  +  VT++ I+         G  R++ V F   K GK+Y
Sbjct:   53 LYPEYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEI----SDVPSLAAYL--QLSKLDWAYKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVLRYFKKSEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDINGAKQAGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEP--------GTMRAQAVEF--VKHGKVY 299          
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Fly
Match: CG6142 (gene:FBgn0039415 transcript:FBtr0084987)

HSP 1 Score: 124.02 bits (310), Expect = 8.174e-43
Identity = 84/319 (26.33%), Postives = 148/319 (46.39%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLL-------------HSSLKYNQIPIGKNLQDHVIFGMFYQLTRSKTISVEDLYHIREVMEYIFLGKGLYSIPSAMVTSGYFTFENS----STPDIQYCIFGIGSLN---HSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTY---KIDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVKEMTKMSL 1919
            ++ILSAG I S +LL             H+      +P+G NLQDH+       +    T++   L +  ++  YIF G+G Y+IP       +    +S      PD++  + G GSL+     T++ L    D  +     + QS+   G  +   LL+P+SRG I   S+  +   +++P +     DV  +  G++ I  K+  SK    +G   +   +  C       + Y  C ++    S  H +GT  +G   D+ SV++  LR+     L V+DASV+P +P G+   ++ ++A K  D++K+  +M +
Sbjct:  297 EVILSAGTIASPQLLMLSGIGPAEHLREHNITVMQDLPVGYNLQDHITLNGLVFVVNDSTVNDARLLNPSDIFRYIFAGQGPYTIPGGAEAFAFVRTPSSKFAKDYPDMEL-VLGAGSLSGDRFGTMRNLLGITDEFYDYMFGDLQSKETFG--LVPVLLRPKSRGRISLRSRNPFHWPRMEPNFMQHPDDVRAMIEGIEMIL-KLSRSKPMAKMGTRFHDRPFPGCENLKFASEAYWKCCLRRYGSSLQHQSGTCKMGPATDNTSVVDAQLRIHGIRGLRVVDASVLPNVPAGHTNAIVIMVAEKAGDMIKDAWRMPI 611          

HSP 2 Score: 70.4774 bits (171), Expect = 8.174e-43
Identity = 85/306 (27.78%), Postives = 133/306 (43.46%), Query Frame = 1
Query:  214 LKLMNYAILPLCFINAMLGIFVLVKVKDFAT--------DSMGLLKTDFTYIIVGAGTAGSILAARLSE-TKNDVLLLEAGPKSGIITRAFSNTPLLVPLIIKNDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSW---NISGWKYKDIDKYLN-------PE----KYCGQRTKPLRQ--EPRLEVLRRSATFLNGKYE---------NEGTLSFDYPQISYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDD-EKSVTSVNGLYRSENVNFRLKK 1026
            ++     I+ L +I       ++   +DF T        D+   L  ++ +IIVGAG+AG ++A RLSE +   VLLLEAG +   I    S+ PL   L      +  W Y+     +A   +K        G+ +GGTS+IN M+  +  + D+D W   N SGW Y ++  Y         PE     Y G+  +   Q  + R ++L+    FL    E          E  + F   Q +     R ST    ++ + N KNLHI     VT++ ID   K+ T V  + + +    R +K
Sbjct:    1 MRFCGVLIICLWYIQVTWSQLLVDLARDFETSFLNNRIPDTTRFLP-EYDFIIVGAGSAGCVMANRLSEISSASVLLLEAGDQETFI----SDVPLTAALTQMTRYN--WGYKAEPTEHACQGLKGGVCNWPKGRGVGGTSLINFMLYTRGHRRDYDEWAAANNSGWSYDELLPYFRKSERIGIPELYKSPYHGRNGQLDVQYTDYRSQLLK---AFLKSGREMGYEITDPNGEHLMGFARSQATIRNGRRCSTSKAFIQPVVNRKNLHISMKSWVTRLIIDPITKTATGVEFVKQRQRYVVRARK 296          
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Fly
Match: CG9519 (gene:FBgn0030589 transcript:FBtr0073984)

HSP 1 Score: 110.153 bits (274), Expect = 1.241e-39
Identity = 78/310 (25.16%), Postives = 148/310 (47.74%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLLHSS-------------LKYNQIPIGKNLQDHVIFGMFYQLTRSKTISVEDLYHIREVMEYIFLGKGLYSIPSAMVTSGYFTFENSSTPD----IQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTY---KIDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVKE 1901
            ++ILSAGAI + +LL  S                  + +G NLQDH+   + + L    ++   +++   E M     G+G+  IP  +    ++  +++  PD    ++  + G G   +  ++     + +I++      + +SA+GFLI   +L+ +SRG IK  S+      +I   YF++  D+     G++     ++    F+ +GA     +   C +       Y  C  +  + + YH +GT  +G   D ++V++  LRV   + L V+DAS++P L +G+P   + +IA K AD++KE
Sbjct:  311 EVILSAGAINTPQLLMLSGVGPAKHLREMGIKPLADLAVGYNLQDHIAPAISF-LCNVSSLQTSEMFR-SEAMSDFLKGRGVLRIPGGVEAISFYALDDARNPDAWADMELFVVGGGLQTNLALRLALGIQSNIYETMFGELERQSANGFLIFPMILRAKSRGRIKLKSRNPEEHPRIYANYFANPYDMNITVRGIEQAVSLLDMPA-FKAIGAHLLEKRIPNCAKYKWKSSAYWACYARHFTFTIYHYSGTAKMGPRSDPSAVVDARLRVHGIDKLRVVDASIMPYLISGHPNGPVYLIAEKAADMIKE 617          

HSP 2 Score: 73.9442 bits (180), Expect = 1.241e-39
Identity = 74/246 (30.08%), Postives = 112/246 (45.53%), Query Frame = 1
Query:  307 DSMGLLKTDFTYIIVGAGTAGSILAARLSETKN-DVLLLEAGPKSGIITRAFSNTPLLVPLI--IKNDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSW---NISGWKYKDIDKYLNPEKYCGQ-----------RTKPLR---QEPRLEV------LRRSATFLNGKYENEGTLSFDYPQISYDYYVRRSTYSECLEKI-ANHKNLHIITDFLVTKINIDDE 963
            D   ++ T + +I+VGAGTAG  LAARLSE     VLLLEAG           N  + +P++  +     I WKY+T    +  L M N +     GK++GG+S++N M+  +  + D+D W      GW Y+++  Y   +KY G            R  P++    E R  +        + A    G Y  +  +   Y Q +     R S+    L  I    +NLH+  + LVTKI ID +
Sbjct:   53 DEGQVITTKYDFIVVGAGTAGCALAARLSENPRWRVLLLEAG--------GPENYAMDIPIVAHLLQLGEINWKYKTEPSNSYCLAMNNNRCNWPRGKVMGGSSVLNYMMYTRGNRRDYDRWARLGNPGWSYEEVLPYF--KKYEGSVVPDADENLVGRNGPVKVSYSETRTRIADAFVGATQDAGLPRGDYNGDKQIRVSYLQANIYNETRWSSNRAYLYPIKGKRRNLHVKKNALVTKILIDPQ 288          
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Zebrafish
Match: chdh (choline dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-120111-1])

HSP 1 Score: 84.7297 bits (208), Expect = 1.071e-16
Identity = 83/317 (26.18%), Postives = 141/317 (44.48%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLL-------HSSLKYNQIPI-------GKNLQDHVIFGMFYQLTRSKTI--SVEDLYHIREVMEYI--FLGKGLYSIPSAMVTSGYF--TFENSSTPDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVKEMTKM 1913
            ++ILS GAI S +LL          LK   IP+       G NLQDH+   + +  T+  T+  + + L  ++  +E++  F G G     +A + SG F  +  +   PDIQ+       ++H  +                   S     F + +  ++  S G +K  SK       + P Y S+  DVL  +  V+ +TR+I + + F +       P  +   Q D   D +    ++  + S+YH + T  +G   D  +V++P+LRV     L V+DASV+P + +GN      +IA K AD +K +  +
Sbjct:  345 EVILSGGAINSPQLLLLSGVGNADELKTLDIPVVQHLPGVGCNLQDHLELYVQHACTQPITLYRAQKPLQMLKIGLEWLLKFTGYGA----TAHLESGGFIRSRPDVPHPDIQFHFLPSQVIDHGRV-------------------SSKIEAFQVHVGPMRSTSVGWLKLKSKDPRDHPILQPNYLSTETDVLEFRECVR-LTREIFAQQAFDEFRGPEVQPGPAV--QSDAEIDAF----VRQKADSAYHPSCTCKMGRPEDRMAVVSPELRVFGVEGLRVVDASVMPSMVSGNLNAPTIMIAEKAADAIKGLPSL 631          

HSP 2 Score: 68.5514 bits (166), Expect = 1.519e-11
Identity = 50/146 (34.25%), Postives = 77/146 (52.74%), Query Frame = 1
Query:  334 FTYIIVGAGTAGSILAARLSETKND-VLLLEAGPKSGIITRAFSNTPLLVPLIIK---NDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSWN---ISGWKYKDIDKY--------LNPEKYCG 726
            ++Y+IVGAG+AG +LA+RL+E  +D VLLLEAGPK   +     +  + +P  +     D    W Y T+ QA+    M ++ M    G++ GG+S +NAM+  +   ED++ W      GW Y     Y        L P++Y G
Sbjct:   95 YSYVIVGAGSAGCVLASRLTENPSDSVLLLEAGPKDKHLGSTRLSWKIHMPAALTYNLCDDRYNWFYHTLPQAH----MDDRVMYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWQSEGADGWNYDHCLPYFRKAQTHELGPDRYRG 236          
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Zebrafish
Match: chdh (choline dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-120111-1])

HSP 1 Score: 84.7297 bits (208), Expect = 1.181e-16
Identity = 83/317 (26.18%), Postives = 141/317 (44.48%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLL-------HSSLKYNQIPI-------GKNLQDHVIFGMFYQLTRSKTI--SVEDLYHIREVMEYI--FLGKGLYSIPSAMVTSGYF--TFENSSTPDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVKEMTKM 1913
            ++ILS GAI S +LL          LK   IP+       G NLQDH+   + +  T+  T+  + + L  ++  +E++  F G G     +A + SG F  +  +   PDIQ+       ++H  +                   S     F + +  ++  S G +K  SK       + P Y S+  DVL  +  V+ +TR+I + + F +       P  +   Q D   D +    ++  + S+YH + T  +G   D  +V++P+LRV     L V+DASV+P + +GN      +IA K AD +K +  +
Sbjct:  285 EVILSGGAINSPQLLLLSGVGNADELKTLDIPVVQHLPGVGCNLQDHLELYVQHACTQPITLYRAQKPLQMLKIGLEWLLKFTGYGA----TAHLESGGFIRSRPDVPHPDIQFHFLPSQVIDHGRV-------------------SSKIEAFQVHVGPMRSTSVGWLKLKSKDPRDHPILQPNYLSTETDVLEFRECVR-LTREIFAQQAFDEFRGPEVQPGPAV--QSDAEIDAF----VRQKADSAYHPSCTCKMGRPEDRMAVVSPELRVFGVEGLRVVDASVMPSMVSGNLNAPTIMIAEKAADAIKGLPSL 571          

HSP 2 Score: 68.5514 bits (166), Expect = 1.289e-11
Identity = 50/146 (34.25%), Postives = 77/146 (52.74%), Query Frame = 1
Query:  334 FTYIIVGAGTAGSILAARLSETKND-VLLLEAGPKSGIITRAFSNTPLLVPLIIK---NDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSWN---ISGWKYKDIDKY--------LNPEKYCG 726
            ++Y+IVGAG+AG +LA+RL+E  +D VLLLEAGPK   +     +  + +P  +     D    W Y T+ QA+    M ++ M    G++ GG+S +NAM+  +   ED++ W      GW Y     Y        L P++Y G
Sbjct:   35 YSYVIVGAGSAGCVLASRLTENPSDSVLLLEAGPKDKHLGSTRLSWKIHMPAALTYNLCDDRYNWFYHTLPQAH----MDDRVMYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWQSEGADGWNYDHCLPYFRKAQTHELGPDRYRG 176          
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Mouse
Match: Chdh (choline dehydrogenase [Source:MGI Symbol;Acc:MGI:1860776])

HSP 1 Score: 67.781 bits (164), Expect = 4.704e-24
Identity = 77/314 (24.52%), Postives = 131/314 (41.72%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLLHSS-------LKYNQIPI-------GKNLQDHVIFGMFYQLTRSKTISVEDLYH-IREV---MEYI--FLGKGLYSIPSAMVTSGYFTFENSSTP--DIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVK 1898
            ++ILS GAI S +LL  S       L+   IP+       G+NLQDH    ++ Q   ++ I++      +R+V   +E++  + G G     +A + +G F       P  DIQ+       ++H                  P  Q      + + +  ++  S G +K  S        I P Y S+  DV   +  V+       S + F      P+  K  Q P      D  +   ++  + S+YH + T  +G   D  +V++   +V    NL V+DAS++P + +GN      +IA K AD++K
Sbjct:  293 EVILSGGAINSPQLLMLSGVGNADDLRKLDIPVVCHLPGVGQNLQDH--LEVYVQQACTQPITLHSAQKPLRKVCIGLEWLWSYTGDGA----TAHLETGGFIRSRPGVPHPDIQFHFLPSQVIDHGR---------------KPTQQE----AYQVHVGTMRATSVGWLKLRSANPRDHPVIHPNYLSTETDVEDFRQCVRL------SREIFAQEALAPFRGKELQ-PGSHVQSDKEIDAFVRAKADSAYHPSCTCKMGRSSDPTAVVDAQTKVIGVENLRVVDASIMPSVVSGNLNAPTVMIAEKAADIIK 574          

HSP 2 Score: 64.3142 bits (155), Expect = 4.704e-24
Identity = 68/253 (26.88%), Postives = 115/253 (45.45%), Query Frame = 1
Query:  301 ATDSMGLLKTDFTYIIVGAGTAGSILAARLSETKND-VLLLEAGPKSGIITRAFSNTPLLVPL-IIKN--DSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSWN---ISGWKYKDIDKYLNPEKYC------------------GQRTKPLRQEPRLEVLRRSA----TFLNGKYENEGTLSFDYPQISYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSV 972
            A  S+G  K ++T+++VGAG+AG +LA+RL+E  N  VLLLEAGPK  ++        + +P  ++ N  D    W Y T  Q      M ++ +    G++ GG+S +NAM+  +   ED++ W+     GW Y     Y    +                    G+   PL Q   L+  R++       +NG ++ EG   F +  ++     R ST    L  + +  NL      LV+++  +  ++V
Sbjct:   34 AVASVG--KDEYTFVVVGAGSAGCVLASRLTEDPNHRVLLLEAGPKDLLMGSKRLQWKIHMPAALVSNLCDDKYNWYYHTEPQPG----MDSRVLYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWHREGAEGWDYAHCLPYFRKAQRHELGANMYRGGDGPLHVSRGKTNHPLHQA-FLQAARQAGYPFTEDMNG-FQQEG---FGWMDMTVHQGKRWSTACAYLHPVLSRPNLRAEVQTLVSRVLFEGTRAV 275          
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Mouse
Match: Chdh (choline dehydrogenase [Source:MGI Symbol;Acc:MGI:1860776])

HSP 1 Score: 67.781 bits (164), Expect = 4.704e-24
Identity = 77/314 (24.52%), Postives = 131/314 (41.72%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLLHSS-------LKYNQIPI-------GKNLQDHVIFGMFYQLTRSKTISVEDLYH-IREV---MEYI--FLGKGLYSIPSAMVTSGYFTFENSSTP--DIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVK 1898
            ++ILS GAI S +LL  S       L+   IP+       G+NLQDH    ++ Q   ++ I++      +R+V   +E++  + G G     +A + +G F       P  DIQ+       ++H                  P  Q      + + +  ++  S G +K  S        I P Y S+  DV   +  V+       S + F      P+  K  Q P      D  +   ++  + S+YH + T  +G   D  +V++   +V    NL V+DAS++P + +GN      +IA K AD++K
Sbjct:  293 EVILSGGAINSPQLLMLSGVGNADDLRKLDIPVVCHLPGVGQNLQDH--LEVYVQQACTQPITLHSAQKPLRKVCIGLEWLWSYTGDGA----TAHLETGGFIRSRPGVPHPDIQFHFLPSQVIDHGR---------------KPTQQE----AYQVHVGTMRATSVGWLKLRSANPRDHPVIHPNYLSTETDVEDFRQCVRL------SREIFAQEALAPFRGKELQ-PGSHVQSDKEIDAFVRAKADSAYHPSCTCKMGRSSDPTAVVDAQTKVIGVENLRVVDASIMPSVVSGNLNAPTVMIAEKAADIIK 574          

HSP 2 Score: 64.3142 bits (155), Expect = 4.704e-24
Identity = 68/253 (26.88%), Postives = 115/253 (45.45%), Query Frame = 1
Query:  301 ATDSMGLLKTDFTYIIVGAGTAGSILAARLSETKND-VLLLEAGPKSGIITRAFSNTPLLVPL-IIKN--DSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSWN---ISGWKYKDIDKYLNPEKYC------------------GQRTKPLRQEPRLEVLRRSA----TFLNGKYENEGTLSFDYPQISYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSV 972
            A  S+G  K ++T+++VGAG+AG +LA+RL+E  N  VLLLEAGPK  ++        + +P  ++ N  D    W Y T  Q      M ++ +    G++ GG+S +NAM+  +   ED++ W+     GW Y     Y    +                    G+   PL Q   L+  R++       +NG ++ EG   F +  ++     R ST    L  + +  NL      LV+++  +  ++V
Sbjct:   34 AVASVG--KDEYTFVVVGAGSAGCVLASRLTEDPNHRVLLLEAGPKDLLMGSKRLQWKIHMPAALVSNLCDDKYNWYYHTEPQPG----MDSRVLYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWHREGAEGWDYAHCLPYFRKAQRHELGANMYRGGDGPLHVSRGKTNHPLHQA-FLQAARQAGYPFTEDMNG-FQQEG---FGWMDMTVHQGKRWSTACAYLHPVLSRPNLRAEVQTLVSRVLFEGTRAV 275          
BLAST of Oxygen-dependent choline dehydrogenase vs. UniProt/SwissProt
Match: sp|Q9WWW2|ALKJ_PSEPU (Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.849e-29
Identity = 85/325 (26.15%), Postives = 137/325 (42.15%), Query Frame = 3
Query: 1008 QFQTEKGWKIILSAGAIESAKLL-------------HSSLKYNQIP-IGKNLQDHVIFGMFYQLTRSKTISVEDLYHIREVM---EYIFLGKGLYSIPSAMVTSGYF--TFENSSTPDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVKEMTKMS 1916
            Q +T    ++ILS GA+ + +LL             H     + +P +GKNLQDH+   +         I V   +  R ++    YIF  KG  +  S +  SG F  +      P++Q+         H    +L ++   I   Y          G+ + I  L P+SRG I   S        IDP Y S  +D+ T+  G++ I R I       D  ++  + K    P      D  +   I+  + + YH  GT  +G   D  SV++P L+V+   N+ V+DAS++P L  GN      +IA   A+++     M+
Sbjct:  240 QVKTTDSGEVILSLGAVNTPQLLMLSGVGAAAELKEHGIALVHDLPEVGKNLQDHLDITLMCAANSRTPIGVAFSFIPRGLVGLFSYIFKRKGFLT--SNVAESGGFVKSSPERDRPNLQF---------HFLPTYLKDHGRKIAVGY----------GYTLHICDLLPKSRGRIGLKSANPMDDPLIDPNYLSDPEDIKTMIAGIK-IGRAI------FDAPSMAKHFKREIVPGPAVTSDDEIVADIRSRAETIYHPVGTCRMGK--DPASVVDPCLQVRGLRNIRVVDASIMPNLVAGNTNAPTIMIAENAAEIIVRKVDMA 534          

HSP 2 Score: 71.2478 bits (173), Expect = 3.849e-29
Identity = 68/239 (28.45%), Postives = 108/239 (45.19%), Query Frame = 1
Query:  334 FTYIIVGAGTAGSILAARLS-ETKNDVLLLEAGPKSGIITRAFSNTPLLVPLIIKNDSSILWKYETIYQAN---ASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSWNISG---WKYK---------DIDKYLNPEKYCG----------QRTKPLRQEPRLEVLRRSATFLNGKYENEGTLSFDYPQISYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSV 972
            + YIIVGAG+AG +LA RLS +    V LLEAGP+    T    + PL + L + N   + W ++T  Q +    SLF    K        LGG+S INAM+  +  +ED+ +W  +G   W +K         + ++  +   Y G          +   PL +      +    +F NG +         + Q++  +  R S+    L  + +  NL IIT+   TK+  +D K+V
Sbjct:    2 YDYIIVGAGSAGCVLANRLSADPSKRVCLLEAGPRD---TNPLIHMPLGIAL-LSNSKKLNWAFQTAPQQHLNERSLFWPRGK-------TLGGSSSINAMVYIRGHEEDYQAWEQAGGEYWGWKRAFALFKKLEHNQRFDKSNYHGTDGELAVSDLKDLNPLSKSFVQAGMEAKISF-NGDFNGAHQEGVGFYQVTQKHGQRWSSARAFLHDVIDRPNLDIITEAHATKVLFEDRKAV 228          
BLAST of Oxygen-dependent choline dehydrogenase vs. UniProt/SwissProt
Match: sp|P18172|DHGL_DROPS (Glucose dehydrogenase [FAD, quinone] OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=Gld PE=3 SV=4)

HSP 1 Score: 80.8777 bits (198), Expect = 2.262e-26
Identity = 84/324 (25.93%), Postives = 139/324 (42.90%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLLHSS--------LKYNQIPI------GKNLQDHVIFGMFYQLTRSKTISVEDLYHIREVMEYIFL------GKGLYSIPSAMVTSGYFTFENSSTPDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYKIDPKYFSSY----KDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVKEMTKMSLRQVE 1931
            ++I+S GA+ S ++L  S         K N  P+      GKNL +HV +   + +  + T  +    +    MEY+        G G+  + + M T      +  + PD+Q    G          +L++   +     L +N S +     I   +L P+SRG I   S       P+ F++Y    +DV TL  G++F  R  ++S   Q  G          C       D Y  CA++  +    H AG+  +G  HD  +V+N +LRV     L V+D S++P++  GN      +IA KGA L+K      + +V+
Sbjct:  315 EVIVSGGAVNSPQILLLSGVGPKEDLQKVNVRPVHHLPGVGKNLHNHVAYFTNFFIDDADTAPL----NWATAMEYLLFRDGLMSGTGISDVTAKMATR---WADRPNLPDLQLYFGG----------YLASCARTGQVGELLSNNSRA---IQIFPAVLNPKSRGYITLRSADPLD-PPRIFANYLTDERDVKTLVEGIKFAIRLSQTSPLKQ-YGMRLDKTVVKGCESHAFASDAYWECAVRQNTGPENHQAGSCKMGPSHDPMAVVNHELRVHGVRGLRVMDTSIMPKVTAGNTHAPAVMIAEKGAYLLKRAWGAKVURVD 616          

HSP 2 Score: 61.2326 bits (147), Expect = 2.262e-26
Identity = 67/238 (28.15%), Postives = 106/238 (44.54%), Query Frame = 1
Query:  331 DFTYIIVGAGTAGSILAARLSETKN-DVLLLEAG---PKSGIITRAFSNTPLLVPLIIKNDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSWNIS---GWKYKDIDKY------------LNPEKYCGQRTKPLRQEP-----------RLEVLRRSATFLNGKYENEGTLSFDYPQISYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINI 954
            ++ +I++G G+AGS++A+RLSE     VLL+EAG   P    I   F N        I +D  I ++Y T  +  A L    Q+     GK+LGGTS++N M+  +  +ED+D W      GW Y+D+  +            +  E +      P+ + P             E +  S   LNG    + +  F   Q++    +R S+    L       NLHI+ +  VTK+ I
Sbjct:   64 EYDFIVIGGGSAGSVVASRLSEVPQWKVLLIEAGGDEPVGAQIPSMFLN-------FIGSD--IDYRYNTEPERMACLSSMEQRCYWPRGKVLGGTSVMNGMMYIRGNREDYDDWAAQGNPGWSYQDVLPFFKKSEDNLELDAVGTEYHAKGGLLPVGKFPYNPPLSYALLKAGEEMGFSVQDLNG----QNSTGFMIAQMTARNGIRYSSARAFLRPARMRNNLHILLNTTVTKVLI 288          
BLAST of Oxygen-dependent choline dehydrogenase vs. UniProt/SwissProt
Match: sp|Q6UPE0|CHDH_RAT (Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.624e-24
Identity = 82/312 (26.28%), Postives = 136/312 (43.59%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLLHSS-------LKYNQIPI-------GKNLQDHVIFGMFYQLTRSKTI--SVEDLYHIREVMEYI--FLGKGLYSIPSAMVTSGYFTFENSSTP--DIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVK 1898
            ++ILS GAI S +LL  S       LK   IP+       G+NLQDH+   + +  T+  T+  + + L  +   +E++  F G G     +A + +G F       P  DIQ+       ++H                  P  Q      + + +  ++  S G +K  S        I+P Y S+  DV   +  V+ +TR+I + + F      P+  K  Q P      D  +   ++  + S+YH + T  +G   D  +V++   RV    NL VIDAS++P + +GN      +IA K AD++K
Sbjct:  296 EVILSGGAINSPQLLMLSGVGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQHACTQPITLHSAQKPLRKVCIGLEWLWRFTGDGA----TAHLETGGFIRSRPGVPHPDIQFHFLPSQVIDHGR---------------KPTQQE----AYQVHVGTMRATSVGWLKLRSTNPQDHPMINPNYLSTETDVEDFRQCVK-LTREIFAQEAF-----APFRGKELQ-PGSHVQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDQQTRVIGVENLRVIDASIMPSVVSGNLNAPTIMIAEKAADVIK 577          

HSP 2 Score: 61.6178 bits (148), Expect = 1.624e-24
Identity = 65/243 (26.75%), Postives = 108/243 (44.44%), Query Frame = 1
Query:  325 KTDFTYIIVGAGTAGSILAARLSETKND-VLLLEAGPKSGIITRAFSNTPLLVP-LIIKNDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSWN---ISGWKYKDIDKYLNPEKYC------------------GQRTKPLRQEPRLEVLRRSA----TFLNGKYENEGTLSFDYPQISYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSV 972
            K ++T+I+VGAG+AG +LA RL+E  N  VLLLEAGPK  ++        + +P  ++ N      KY   Y   A   +  + +    G++ GG+S +NAM+  +   ED++ W+     GW Y     Y    +                    G+   PL Q   L+  R++       +NG ++ EG   F +  ++     R ST S  L    +  NL      LV+++  +  ++V
Sbjct:   43 KDEYTFIVVGAGSAGCVLANRLTEDPNHRVLLLEAGPKDLLMGSKRLQWKIHMPAALVANLCDD--KYNWYYHTEAQPGLDGRVLYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWHRQGAEGWDYAHCLPYFRKAQKHELGANMYRGGDGPLHVSRGKTNHPLHQA-FLQAARQAGYPFTEDMNG-FQQEG---FGWMDMTIHQGKRWSTASAYLRPALSRPNLRAEVQTLVSRVLFEGTRAV 278          
BLAST of Oxygen-dependent choline dehydrogenase vs. UniProt/SwissProt
Match: sp|Q8BJ64|CHDH_MOUSE (Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 2.869e-23
Identity = 77/314 (24.52%), Postives = 131/314 (41.72%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLLHSS-------LKYNQIPI-------GKNLQDHVIFGMFYQLTRSKTISVEDLYH-IREV---MEYI--FLGKGLYSIPSAMVTSGYFTFENSSTP--DIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVK 1898
            ++ILS GAI S +LL  S       L+   IP+       G+NLQDH    ++ Q   ++ I++      +R+V   +E++  + G G     +A + +G F       P  DIQ+       ++H                  P  Q      + + +  ++  S G +K  S        I P Y S+  DV   +  V+       S + F      P+  K  Q P      D  +   ++  + S+YH + T  +G   D  +V++   +V    NL V+DAS++P + +GN      +IA K AD++K
Sbjct:  293 EVILSGGAINSPQLLMLSGVGNADDLRKLDIPVVCHLPGVGQNLQDH--LEVYVQQACTQPITLHSAQKPLRKVCIGLEWLWSYTGDGA----TAHLETGGFIRSRPGVPHPDIQFHFLPSQVIDHGR---------------KPTQQE----AYQVHVGTMRATSVGWLKLRSANPRDHPVIHPNYLSTETDVEDFRQCVRL------SREIFAQEALAPFRGKELQ-PGSHVQSDKEIDAFVRAKADSAYHPSCTCKMGRSSDPTAVVDAQTKVIGVENLRVVDASIMPSVVSGNLNAPTVMIAEKAADIIK 574          

HSP 2 Score: 64.3142 bits (155), Expect = 2.869e-23
Identity = 68/253 (26.88%), Postives = 115/253 (45.45%), Query Frame = 1
Query:  301 ATDSMGLLKTDFTYIIVGAGTAGSILAARLSETKND-VLLLEAGPKSGIITRAFSNTPLLVPL-IIKN--DSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSWN---ISGWKYKDIDKYLNPEKYC------------------GQRTKPLRQEPRLEVLRRSA----TFLNGKYENEGTLSFDYPQISYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSV 972
            A  S+G  K ++T+++VGAG+AG +LA+RL+E  N  VLLLEAGPK  ++        + +P  ++ N  D    W Y T  Q      M ++ +    G++ GG+S +NAM+  +   ED++ W+     GW Y     Y    +                    G+   PL Q   L+  R++       +NG ++ EG   F +  ++     R ST    L  + +  NL      LV+++  +  ++V
Sbjct:   34 AVASVG--KDEYTFVVVGAGSAGCVLASRLTEDPNHRVLLLEAGPKDLLMGSKRLQWKIHMPAALVSNLCDDKYNWYYHTEPQPG----MDSRVLYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWHREGAEGWDYAHCLPYFRKAQRHELGANMYRGGDGPLHVSRGKTNHPLHQA-FLQAARQAGYPFTEDMNG-FQQEG---FGWMDMTVHQGKRWSTACAYLHPVLSRPNLRAEVQTLVSRVLFEGTRAV 275          
BLAST of Oxygen-dependent choline dehydrogenase vs. UniProt/SwissProt
Match: sp|B4SHV9|BETA_STRM5 (Oxygen-dependent choline dehydrogenase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=betA PE=3 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 9.158e-23
Identity = 79/323 (24.46%), Postives = 139/323 (43.03%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLLHSS--------------LKYNQIPIGKNLQDHVIFGMFYQLTRSKTISVE---DLYHIREV-MEYIFLGKGLYSIPSAMVTSGYFTFENSS--TPDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYKIDPK--------YFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVKEMTKMS 1916
            +++L  GAI S ++L  S              L ++   +G NLQDH+   M+ Q    K +S+     LY+   +  E++FLG G+ +  S    +G F   ++    P++QY    +            NY  S   K         A  F + +  ++  SRG I   SK     DP+        Y S  +D    +  ++ ITR+I     F      PY  +    P      D  +   ++  + ++YH + +N +G+  D  +V++   RV     L ++DAS++P++ TGN      +IA K AD+++  T ++
Sbjct:  255 EVLLCGGAIASPQILQRSGVGPADLLRSLDIDLVHHLPGVGANLQDHLE--MYLQYECKKPVSLAPALKLYNQPAIGAEWLFLGTGIGA--SNQFEAGGFIRSDTEFDWPNLQYHFLPVAI----------NYNGSNPIK---------AHSFQMHVGSMRSPSRGRIHVRSK-----DPREHPSILFNYMSHDQDWREFRAAIR-ITREI-----FAQPALAPYSGR-EISPGSALQTDAQIDAFVREHAETAYHPSCSNKMGHADDPMAVVDGQGRVHGLEGLRIVDASIMPQVVTGNLNAPTIMIAEKLADVIRGRTPLA 542          

HSP 2 Score: 64.3142 bits (155), Expect = 9.158e-23
Identity = 73/243 (30.04%), Postives = 104/243 (42.80%), Query Frame = 1
Query:  331 DFTYIIVGAGTAGSILAARLSETKN-DVLLLEA-GPKSGIITRAFSNTPLLVPLIIKNDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSW----NISGWKYKDIDKY--------LNPEKYCGQRTKPLR---------------QEPRLEVLRRSATFLNGKYENEGTLSFDYPQISYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSV 972
            ++ YII+GAG+AG++LA RL+E  +  VLLLEA GP   +  R      L  PL  K       +Y   Y+ +   FM N++M    GK LGG+S+IN M   +    D+D+W     +  W Y D   Y        + P  Y G    PLR                E  ++        LNG Y+ EG    D  +       R ST    L+      NL I+T  L  +I    +++V
Sbjct:    6 EYDYIIIGAGSAGNVLATRLTEDADVSVLLLEAGGPDYRLDFRTQMPAALAFPLQGK-------RYNWAYKTDPEPFMNNRRMDCGRGKGLGGSSLINGMCYIRGNAMDYDNWASMPGLEDWTYLDCLPYFRKAETRDIGPNDYHGGE-GPLRVTTPKAGNNELFAAMVEAGVQAGYPRTDDLNG-YQQEGFGPMD--RTVTPKGRRSSTARGYLDLAKPRPNLTIVTHALTDRILFSGKRAV 237          
BLAST of Oxygen-dependent choline dehydrogenase vs. TrEMBL
Match: E9HAW2 (Uncharacterized protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_309217 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 6.394e-49
Identity = 98/321 (30.53%), Postives = 169/321 (52.65%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLLHSS--------------LKYNQIPIGKNLQDHVIFGMFYQLTRSKTISVEDLYHIREVMEYIFLGKGLYSIPSAMVTSGYF-------TFEN--SSTPDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVL----TLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKD-HNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVKE 1901
            ++ILSAG I++ ++L  S              +K + +P+G+NLQDH+   +F +L  S +++V  + + R+   Y+  GKG      A+ TSG         T EN  SS P     +F +GS+N      ++N +   + ++ P + S S  GF++    L P SRG ++  S    +   IDP Y +   DV     T+K GV+ +     ++  F+ LGA  ++P + +C  K   +   Y+ C ++  +++ YH AGT ++G   + ++V++P+LRV+    L V+DASV+PRLP+G P  ++  IA + AD + E
Sbjct:  296 EVILSAGTIKTTQILQQSGVGPPHVLEPLDIPIKVD-LPVGENLQDHLQVPLFVELNSSVSMNVIKMLNPRQFWNYMVHGKG------ALATSGIEGIATLTKTRENGKSSKPYGMLILFNMGSINADVYTSVANIKKEAFHRWFPKSSSLSQEGFVLISVCLHPRSRGHVRIISTDPTQPPEIDPAYLNHEYDVQCSIDTIKQGVELL-----NTDAFRALGAKLHWPTFPECGGKQGSDNQRYMECLVRTAALTMYHPAGTAAMGREDNPDAVVDPELRVRGVTGLRVVDASVLPRLPSGPPNSVLIAIADRAADFILE 604          

HSP 2 Score: 75.0998 bits (183), Expect = 6.394e-49
Identity = 63/215 (29.30%), Postives = 107/215 (49.77%), Query Frame = 1
Query:  334 FTYIIVGAGTAGSILAARLSETKNDVLLLEAGPKSGIITRAFSNTPLLVPLIIKNDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSWNISGWKYKDIDKYLNPEKYC---GQRT----KPLRQEPRLEVLRRSATFLN--GKYENEGTLSFDYPQISYDYYVRRSTY-SECLEKIANHKNLHIITDFLVTKI 948
            + YI+VGAGT+G +LAA+L+ + + VL++EAG +       +S  PL+ P I++      W++ T+ Q  A+  +   +     GK++GG+  +N +I    +  DFDSW + GW  + +   L     C   G R     KPL +   L+  R     ++   ++ + G+    +  I      R STY S  +  +  H NLH++T   VTK+
Sbjct:   62 YDYIVVGAGTSGCVLAAKLAGSNSKVLVIEAGGEP----PWYSWIPLIAP-ILQGSQQHDWRFRTVPQKFAAGALHGNQAFWPQGKMVGGSGQMNFLIHTTGSPGDFDSWKVPGWDSQTMKNTLE-GLTCWTKGNRVNATEKPLLKA-FLDAGRACGHSVSDMDRWSDTGSFMASHNTIDGLAGQRWSTYLSHLMPAMKTHNNLHVLTKSSVTKL 269          
BLAST of Oxygen-dependent choline dehydrogenase vs. TrEMBL
Match: A0A1D1UXV3 (Uncharacterized protein OS=Ramazzottius varieornatus OX=947166 GN=RvY_05365-1 PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 9.197e-48
Identity = 94/335 (28.06%), Postives = 158/335 (47.16%), Query Frame = 3
Query:  966 ISDICQRIVSLGKCQFQTEKGWKIILSAGAIESAKLL-------HSSLKYNQI------PIGKNLQDHVIFGMFYQLTRSKT-ISVEDLYHIREVMEYIFLGKGLYSIPSAMVTSGYFTFENSST--------PDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLV 1895
            +S +  R+VS+ K         ++ILSAGAI S K+L        + L+ N+I      P+G+NLQDH+   M +    ++  +++ +L   +++  Y   G GL+S  S++V+ G+F     +         P IQ  I          +    N       +Y    ++    GF+I+   L P+SRG +K +         IDP++ S  +DV     G +F+      S+ F+ +G  P +P +  C       + Y  C I+  + S+YH  GT  +G   D+++V++  LRVK  + L V DAS+IP + +GN      +I  K AD+V
Sbjct:  294 VSPLVSRVVSVRK---------EVILSAGAINSPKILMLSGIGSAAELRKNKIEPLSDLPVGENLQDHLQVQMVFNTNDTEVGLNMAELTDPKQISRYAKDGTGLFSA-SSVVSFGFFHIPELAAQYGTPPTFPHIQTAIVNTAMYPPEELILRQNMAPETIPQYYTKPENMGKPGFIISPLFLHPKSRGTVKLADNNPMSPPVIDPRFLSEEEDVKVYAKGFKFVADFFLQSEEFKKVGITPNFPSFPVCAALPAGSEEYYECIIRYAARSAYHPVGTCKMGKSSDASTVVDSSLRVKGISKLRVADASIIPTIISGNTHAPTVMIGEKAADMV 618          

HSP 2 Score: 87.8113 bits (216), Expect = 9.197e-48
Identity = 79/253 (31.23%), Postives = 124/253 (49.01%), Query Frame = 1
Query:  298 FATDSMGLLKTDFTYIIVGAGTAGSILAARLSETKN-DVLLLEAGPKSGIITRAFSNTPLLVPLIIKNDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSW---NISGWKYKDIDKYL-------NPE---KYCGQRTKPLRQE--PRLEVLRRSATFLNGKYEN--------EGTLSFDYPQISYDYYVRRSTYSECL--EKIANHKNLHIITDFLVTKINIDDEKSVTS 978
            F T   G    ++ +IIVGAGTAGS++A+RL+E K+  +LLLEAGP       +FS+T  LV +     + + W + T+ Q  +   +  ++ ++  G+++GGTS IN ++  +  +ED+D W      GW +KD+  Y        NP+           PLR E  P  E+      F   K +N        E  L F   QI+  +  R S  S  L  +K  + +NLH+I++  V +I ID     T+
Sbjct:   37 FLTTIPGNATKEYDFIIVGAGTAGSVVASRLAEHKHWKILLLEAGPP-----ESFSHTFPLVHIADPQATFLDWNFTTVPQKWSGAGLNGRQNLMSAGRVVGGTSSINHLLYIRGNREDYDMWAKEGADGWSWKDVFPYFLKSENNQNPDLVKTGLHGSNGPLRIEDNPNQEIYLADLLFRAAKAKNLYNPDSNGESQLGFAPTQINAFHGYRWSAASAYLRPDKQKHRRNLHVISNAQVARIVIDPRTKQTT 284          
BLAST of Oxygen-dependent choline dehydrogenase vs. TrEMBL
Match: A0A224XLN0 (Putative glucose dehydrogenase OS=Panstrongylus lignarius OX=156445 PE=3 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 1.628e-46
Identity = 100/314 (31.85%), Postives = 157/314 (50.00%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLL-------------HSSLKYNQIPIGKNLQDHV-IFGMFYQLTRSKTISVEDLYHIREVMEYIFLGKGLYSIPSAMVTSGYFT--FENSST--PDIQYCIF--GIGSLNHSTIKWLSNYEDSIWQK-YLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVKE 1901
            ++I+SAGAI S ++L             H       +P+G+NLQDHV + G+ + + +   I    L  +   MEY+   KG  +    +   G+    F N S   PDIQ+ +    I S + + +K +    +SI+Q  Y P  + ++   + I   LL+P SRG +K  S   ++   I+P YFS  +D+LTL  G + I  K+   + F+   +  +      C       D+Y  CAI+  S++ YH  GT  +G   D  +V++P LRV     L VIDAS++P + +GN    + +IA KGADLVKE
Sbjct:  304 EVIMSAGAINSPQILMLSGIGPAEHLRSHCIHVIRDLPVGQNLQDHVGMAGLTFLIDKPVAIVQNRLKAVPVTMEYVIREKGPMTTLGGVEGLGFIKTKFANHSIDYPDIQFHMAPASINSDSGARVKKILGIRESIYQAVYRPIEERDT---WTIIPLLLRPRSRGWVKLRSANPFQYPIINPNYFSHPQDILTLVEGTK-IALKVAEGRSFRQFHSRLHRIPLPGCRHLLFGSDMYWECAIRHMSMTIYHPVGTCKMGPSSDQKAVVDPRLRVYGIKGLRVIDASIMPTIVSGNTNAPVVMIAEKGADLVKE 613          

HSP 2 Score: 80.1073 bits (196), Expect = 1.628e-46
Identity = 74/247 (29.96%), Postives = 111/247 (44.94%), Query Frame = 1
Query:  322 LKTDFTYIIVGAGTAGSILAARLSETKN-DVLLLEAGPKSGIITRAFSNTPLLVPLIIKNDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSWNI---SGWKYKD----------------IDKYLNPEKYCGQRTKPLRQEPRLEVLRRSATF------LNGKYENEGTLSFDYPQISYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSVTSVN 984
            L  ++ ++I+G GTAG+++A+RLSE     VLLLEAGP+   I    S+ P L   +    S+I W+Y+T     A L MKN +     GK+LGG+S++N M+  +  K D+D W      GW Y +                I +Y +   Y   +  P R    L  ++           +NG+Y+      F   Q +     R ST    L  +    NLHI  +  VTK+ I+  K    V 
Sbjct:   53 LLPEYDFVIIGGGTAGAVIASRLSEIHGWTVLLLEAGPQENEI----SDVPSLSAYL--QLSNIDWQYKTQPTGRACLAMKNGRCNWPRGKVLGGSSVLNYMLYVRGNKHDYDQWEAMGNPGWAYSNVLHYFKKSEDNRNDYLIGRYHSRGGYLTVQEAPWRTPLVLAFIQAGEELGYKNRDINGEYQT----GFMIAQGTIRRGSRCSTTKAFLRPVRRRGNLHIAMNSHVTKVLINGRKRAYGVQ 289          
BLAST of Oxygen-dependent choline dehydrogenase vs. TrEMBL
Match: T1HCA7 (Uncharacterized protein OS=Rhodnius prolixus OX=13249 PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.478e-45
Identity = 97/314 (30.89%), Postives = 159/314 (50.64%), Query Frame = 3
Query: 1032 KIILSAGAIES-----------AKLLHSSLKY--NQIPIGKNLQDHV-IFGMFYQLTRSKTISVEDLYHIREVMEYIFLGKGLYSIPSAMVTSGYFT--FENSST--PDIQYCIF--GIGSLNHSTIKWLSNYEDSIWQK-YLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVKE 1901
            ++I++AGAI +           A+ LHS   +    +P+G+NLQDHV + G+ + + +   I    L  +   MEY+   KG  +    +   G+    F N S   PDIQ+ +    I S + + +K +    +SI+Q  Y P  + ++   + I   LL+P SRG +K  S   ++   I+P YFS  +D++TL  G + I  K+   + F+   +  +      C       D+Y  CAI+  S++ YH  GT  +G   D  +V++P LRV     L VIDAS++P + +GN    + +IA KGAD++KE
Sbjct:  364 EVIMAAGAINTPQILMLSGVGPAEHLHSLGIHVVRDLPVGQNLQDHVGMAGLTFLIDKPVAIVQNRLKAVPVTMEYVIREKGPMTTLGGVEGLGFIKTKFANHSIDYPDIQFHMAPASINSDSGARVKKILGIRESIYQAVYRPIEERDT---WTIIPLLLRPRSRGWVKLRSANPFQYPIINPNYFSHPQDIMTLVEGTK-IALKVAEGRSFKQFHSRLHRIPLPGCKHLLFGSDMYWECAIRHMSMTIYHPVGTCKMGPSSDQKAVVDPRLRVYGVKGLRVIDASIMPTIVSGNTNAPVVMIAEKGADMIKE 673          

HSP 2 Score: 81.6481 bits (200), Expect = 2.478e-45
Identity = 76/247 (30.77%), Postives = 112/247 (45.34%), Query Frame = 1
Query:  322 LKTDFTYIIVGAGTAGSILAARLSETKN-DVLLLEAGPKSGIITRAFSNTPLLVPLIIKNDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSWNI---SGWKYKD----------------IDKYLNPEKYCGQRTKPLRQEPRLEVLRRSATF------LNGKYENEGTLSFDYPQISYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSVTSVN 984
            L  ++ ++IVG GTAG+++A+RLSE     VLLLEAGP+   I    S+ P L   +    S+I W+Y+T     A L MKN +     GK+LGG+S++N M+  +  K D+D W      GW Y +                I KY +   Y   +  P R    L  ++           +NG+Y+      F   Q +     R ST    L  +    NLHI  +  VTK+ I+  K   +V 
Sbjct:  113 LLPEYDFVIVGGGTAGAVVASRLSEIHGWTVLLLEAGPQENEI----SDVPSLSAYL--QLSNIDWQYKTQPTGRACLAMKNGRCNWPRGKVLGGSSVLNYMLYVRGNKHDYDHWEAMGNHGWAYSNVLHYFKKSEDNRNDYLIGKYHSRGGYLTVQEAPWRTPLVLAFIQAGEELGYKNRDINGEYQT----GFMIAQGTIRRGSRCSTTKAFLRPVRRRGNLHIAMNSHVTKVLINGRKRAYAVQ 349          
BLAST of Oxygen-dependent choline dehydrogenase vs. TrEMBL
Match: A0A210Q361 (Glucose dehydrogenase [acceptor] OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT14830 PE=4 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 9.645e-45
Identity = 86/314 (27.39%), Postives = 150/314 (47.77%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLLHSS-------------LKYNQIPIGKNLQDHVIFGMFYQLTRSKTISVEDLYHIREVMEYIFLGKGLYSIPSAMVTSGYFTFENSST-----PDIQYCIFGIGSLNHSTIKWLS-NYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYP--KYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVKE 1901
            ++ILSAG++ S +LL  S                  +P+G NLQDH++  + Y +  + +I+++ L  I  V +Y +   GL+S  S    +  +   N  T      DIQ  +  + +   S    +  NY++ +  +   +  +E     L    LL+P+SRG I+  S+  +    IDP Y     DV TL  GV+F T K+  +   + +G     P   +  C   +   D +  C ++  +++ YH   T  +G   D ++V++P LRVK  + L V+DASV+  +P+GN      +I  K AD++++
Sbjct:  288 EVILSAGSVNSPQLLMLSGVGPKEHLNKLGIPVLADLPVGDNLQDHLMIPLVYGINTTGSITLDKLNSIWSVKQYEYFRTGLWSATSGECLAFVYRDFNKKTDAGKSADIQISVNSVHTTTPSMRDSMHFNYQEKVKDQIFTD--TEKVETILFLPILLRPKSRGYIRLKSRDPFDYPDIDPNYLEHPDDVHTLIEGVRF-TEKMVGTDSLKSIGMDVNSPILYHKMCSVHEFRSDKFWECFVRHFTLTVYHPTSTCRMGGKDDPSAVVDPQLRVKGISGLRVVDASVMRNVPSGNTNAPSIMIGEKAADMIRK 598          

HSP 2 Score: 94.3597 bits (233), Expect = 9.645e-45
Identity = 75/243 (30.86%), Postives = 123/243 (50.62%), Query Frame = 1
Query:  322 LKTDFTYIIVGAGTAGSILAARLS-ETKNDVLLLEAGPKSGIITRAFSNTPLLVPLIIKNDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSWN---ISGWKYKDIDKY-----------LNPEKYCGQRTKPLRQEPRLEVLRR-----------SATFLNGKYENEGTLSFDYPQISYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSV 972
            LKT + YIIVGAG++GS+LA+RLS + KNDV+LLEAG      T  +   P  V +++K++    W+Y T+ Q  A   M+ ++     G++LGG++ +N M+  +  + D+DSW+     GW YKD+  Y               +Y G+R       P +  +++           S    NG    E  + F + Q +     R S+Y   ++   +  NLHI+ + L TK+ I D+K++
Sbjct:   36 LKTSYDYIIVGAGSSGSVLASRLSKDPKNDVVLLEAGGSDE--TSPYIYKPGAVAMLLKSNED--WEYYTLPQEQACQAMEEERSYWPRGRVLGGSNALNWMVHIRGNRHDYDSWSEEGCDGWSYKDVLPYFIKSEDIQIDEFKQSEYRGKRGPLPVTRPNITPMQKLYLGAGKDLGYSLIDCNG----EDQIGFSWMQSTIKQGERWSSYRAFIKPHLDRSNLHIMPNTLTTKVIIKDKKAI 270          
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Cavefish
Match: chdh (choline dehydrogenase [Source:NCBI gene;Acc:103039657])

HSP 1 Score: 76.2554 bits (186), Expect = 4.786e-14
Identity = 78/314 (24.84%), Postives = 140/314 (44.59%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLLHSS-------LKYNQIPI-------GKNLQDHVIFGMFYQLTRSKTI-SVEDLYHIREV-MEYIFLGKGLYSIPSAMVTSGYFTFENSST-PDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVKEMTKM 1913
            ++ILS GAI S +LL  S       L+   IP+       G NLQDH+   +  Q T+  T+   +  +H+ ++ +E++    G Y   + + + G+       T PDIQ+       ++H  +                N++ E+   + + +  ++  S G +K  SK  +    + P Y S+  DV   +  V+ ++R+I + K F         P      Q D   D +    ++  + S+YH + T  +G   D  +V++P  RV     L V+DAS++P + +GN      +IA K AD +K +  +
Sbjct:  300 EVILSGGAINSPQLLMLSGVGNADYLQKLDIPVVQHLPGVGSNLQDHLELYVQQQCTQPITLYKAQKPFHMIKIGLEWMLKFTG-YGATAHLESGGFIRGRPHVTHPDIQFHFLPSQVIDHGRV----------------NSKIEA---YQVHVGPIRSTSVGWLKLKSKNPHDHPLLQPNYLSTDIDVWEFRQCVK-LSREIFAQKAFDPFRGPEAQP--GPAVQSDAEIDAF----VRQKADSAYHPSCTCKMGRSSDPMAVVDPQTRVYGLEGLRVVDASIMPSVVSGNLNAPTIMIAEKAADAIKGLPSL 586          

HSP 2 Score: 65.855 bits (159), Expect = 8.886e-11
Identity = 48/147 (32.65%), Postives = 75/147 (51.02%), Query Frame = 1
Query:  286 KVKDFATDSMGLLKTDFTYIIVGAGTAGSILAARLSETKND-VLLLEAGPKSGIITRAFSNTPLLVPLIIK---NDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSWN---ISGWKYKDIDKYL 705
            + + ++T S       F+Y+IVGAG+AG +LA RLSE  ++ VLLLEAGPK  ++     +  + +P  +     D    W Y T+ Q      M  + M    G++ GG+S +NAM+  +   ED++ W+     GW Y     Y 
Sbjct:   34 RHRHYSTVSASPKNPSFSYVIVGAGSAGCVLANRLSENSSESVLLLEAGPKDMVLGSRRLSWKIHMPAALTYNLCDDKYNWYYNTLPQDG----MDGRVMYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWHREGAEGWDYDHCLPYF 176          
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002402.1 (pep scaffold:Pmarinus_7.0:GL482915:11564:16540:1 gene:ENSPMAG00000002188.1 transcript:ENSPMAT00000002402.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 2.023e-13
Identity = 64/245 (26.12%), Postives = 107/245 (43.67%), Query Frame = 1
Query:  328 TDFTYIIVGAGTAGSILAARLSE-TKNDVLLLEAGPKSGIITRA----FSNTPLLVPLIIKNDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSW----NISGWKYKDIDKY--------LNPEKYCGQRTKPLR------QEPR----LEVLRRSATFLN---GKYENEGTLSFDYPQISYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSV 972
            + +++++VGAG+AG ++A RLSE   + VLLLEAGP+  ++         + P  +  ++ N      KY   Y       +  + ++   G++ GGTS +N MI  +    D+D W      SGW Y +   Y        L P++Y G    PLR      Q P     LE   ++   LN     +  EG   F +  ++     R S+    L    +  NL +    + T++    E++V
Sbjct:    6 SHYSHVVVGAGSAGCVMAGRLSEDAASRVLLLEAGPRDTVLGSKRLAWHIHMPAGLSKVLHNS-----KYAVHYYTEPQEHLGGRSLLWPRGRVWGGTSSMNGMIYIRGHALDYDGWEQEHGASGWSYANCLPYFRRAQSHALGPDEYRGG-DGPLRVSRVPTQSPLHVAFLEAASQAGHALNEDMNGFRQEG---FGWYDLTIHQGKRWSSACAYLHPALSRPNLEVRDGAVATRVLFRGERAV 241          

HSP 2 Score: 27.7202 bits (60), Expect = 2.023e-13
Identity = 18/48 (37.50%), Postives = 24/48 (50.00%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLL-------HSSLKYNQIPI-------GKNLQDHV 1133
            ++IL  GAI S +LL          LK   IP+       G+NLQDH+
Sbjct:  259 EVILCGGAINSPQLLLLSGIGPEKHLKQVGIPVLVNSPGVGRNLQDHL 306          
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Nematostella
Match: EDO38956 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBJ6])

HSP 1 Score: 69.707 bits (169), Expect = 7.838e-13
Identity = 80/314 (25.48%), Postives = 138/314 (43.95%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLLHSSLKYNQ-------IPI-------GKNLQDHVIFGMFYQLTRSKTISVEDLYHIREVMEYIFLG-------KGLYSIPSAMVTSGYF--TFENSSTPDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLV 1895
            ++I+S GAI S +LL  S   N        IP+       G+NLQDH+   M+ Q    K ++   LY  +++M  I +G        GL +  SA + +G F  + E    PDIQ+     G ++H                            + + +  ++ +S+G +K  S   Y    ID  Y S+  D   ++  V+ ++R+I + K F+        P      + D   D +    ++  + S+YH + T  +G+  D  +V++   RV   +NL V+DAS++P + +GN      +IA K AD +
Sbjct:   57 EVIISGGAINSPQLLMLSGVGNAEELTRLGIPVVVNLPGVGENLQDHL--EMYIQQECKKPLT---LYSAQKLMNMIPIGIRWFLFQTGLGA--SAHLEAGGFIRSREGVPHPDIQFHFLPSGVIDHGRTPI-------------------DRHAYQLHVGSMRSQSKGYVKLKSPNAYDHPIIDFNYMSTEDDWQEMRACVR-LSREIFAQKAFEPFRGDEMRP--GSHIRTDDEIDAF----VREFADSAYHPSCTCKMGSASDPLAVVDNAARVFHVDNLRVVDASIMPSVVSGNLNAPTVMIAEKIADAI 337          
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Nematostella
Match: EDO38958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBK1])

HSP 1 Score: 58.151 bits (139), Expect = 6.338e-9
Identity = 48/137 (35.04%), Postives = 68/137 (49.64%), Query Frame = 1
Query:  316 GLLKTDFTYIIVGAGTAGSILAARLS-ETKNDVLLLEAGPKSGIITRAFS-NTPLLVPLIIKN--DSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSW---NISGWKYKDIDKYL 705
             +  ++  Y+I GAG+AG +LA RLS +  + VLLLEAGPK     R +  + P     +I N  D    W Y T  Q +    M N+ M    G++ GG+S +NAM+  +    D+D W      GW Y D   Y 
Sbjct:    7 AIFSSEHDYVICGAGSAGCVLANRLSADPDSKVLLLEAGPKD----RTWKIHMPA---ALIYNLCDDKYNWYYHTAPQKH----MNNRVMYCPRGRVWGGSSSLNAMVYIRGHAYDYDRWEREGAQGWSYADCLPYF 132          
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Medaka
Match: chdh (choline dehydrogenase [Source:NCBI gene;Acc:101161152])

HSP 1 Score: 77.411 bits (189), Expect = 5.168e-28
Identity = 82/314 (26.11%), Postives = 140/314 (44.59%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLLHSS-------LKYNQIPI-------GKNLQDHVIFGMFYQLTRSKTI-SVEDLYHIREV-MEY--IFLGKGLYSIPSAMVTSGYF--TFENSSTPDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYK---IDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQ--KDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLVK 1898
            ++ILS GAI S +LL  S       LK   IP+       G NLQDH+   +  Q T+  T+   +  +H+ ++ +E+  +F G G     +A + SG F  +  N + PDIQ+       ++H  I                   +     + + +  ++  S G IK  S        + P Y S+  DV   +  V+ ++R+I + K F         P+    PQ   D   D +    ++  + S+YH + T  +G+  D  +V+  D RV   + L V+DAS++P + +GN      +IA K AD+++
Sbjct:  324 EVILSGGAINSPQLLMLSGVGNADDLKELGIPVVQHLPGVGSNLQDHLELYVQQQCTQPITLYKAQKPFHMVKIGLEWLSVFTGYGA----TAHLESGGFIRSRPNVTHPDIQFHFLPSQVIDHGRI-------------------ASKIEAYQVHVGPMRSTSIGWIKLKSPNPLDHPVLQPNYLSTDIDVWEFRQCVK-LSREIFAQKAFDPFRG----PEVQPGPQVQSDAEIDAF----VRQKADSAYHPSCTCKMGSPSDPMAVVGADTRVLGLDRLRVVDASIMPSIVSGNLNAPTIMIAEKAADIIR 605          

HSP 2 Score: 67.3958 bits (163), Expect = 5.168e-28
Identity = 71/242 (29.34%), Postives = 114/242 (47.11%), Query Frame = 1
Query:  334 FTYIIVGAGTAGSILAARLSETKND-VLLLEAGPKSGIITRAFSNTPLLVPLIIK---NDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSWN---ISGWKYKDIDKY--------LNPEKYCGQR----------TKPLRQEPRLEVLRRSA-TF---LNGKYENEGTLSFDYPQISYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSV 972
            F+Y++VGAG+AG +LA RL+E  ++ VLLLEAGPK   +     +  + +P  +     D    W Y T+ QA+    M N+ +    G++ GG+S +NAM+  +   ED++ W+    +GW Y+    Y        L   +Y G R            PL +   +E  R++   F   +NG Y+ EG    D   ++     R ST S  L  + +  NL      + T+I  D  ++V
Sbjct:   74 FSYVVVGAGSAGCVLANRLTEDAHESVLLLEAGPKDLWLGSLRLSWKIHMPAALTYNLCDDKYNWYYHTLPQAH----MNNRALYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWHREGAAGWDYQHCLPYFRKAQCHELGENRYRGGRGPLHVSRGKTNHPLHKA-FIEAGRQAGYPFTDDMNG-YQQEGLGWMD---MTIYKGKRWSTASAYLRPVLSRPNLKTEVRCVATRILFDGGRAV 306          
BLAST of Oxygen-dependent choline dehydrogenase vs. Planmine SMEST
Match: SMESG000064120.1 (SMESG000064120.1)

HSP 1 Score: 517.309 bits (1331), Expect = 4.613e-179
Identity = 250/259 (96.53%), Postives = 255/259 (98.46%), Query Frame = 3
Query: 1008 QFQTEKGWKIILSAGAIESAKLLHSSLKYNQIPIGKNLQDHVIFGMFYQLTRSKTISVEDLYHIREVMEYIFLGKGLYSIPSAMVTSGYFTFENSSTPDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYKIDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRV 1784
             F+ +KG K+ILSAGAIESAKLLHSSLKYNQIPIGKNLQDHVIFGMFYQLTRSKTISVEDLYHIREVMEYIFLGKGLYSIPSAMVTSGYFTFENSSTPDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSK TYKIDPKYFSSYKDV+TLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLR+
Sbjct:  207 NFRLKKGGKLILSAGAIESAKLLHSSLKYNQIPIGKNLQDHVIFGMFYQLTRSKTISVEDLYHIREVMEYIFLGKGLYSIPSAMVTSGYFTFENSSTPDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKRTYKIDPKYFSSYKDVITLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRL 465          

HSP 2 Score: 391.734 bits (1005), Expect = 7.053e-130
Identity = 214/259 (82.63%), Postives = 216/259 (83.40%), Query Frame = 1
Query:  262 MLGIFVLVKVKDFATDSMGLLKTDFTYIIVGAGTAGSILAARLSETKNDVLLLEAGPKSGIITRAFSNTPLLVPLIIKNDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSWNISGWKYKDIDKYLNPEKYCGQRTKPLRQEPRLEVLRRSATFLNGKYENEGTLSFDYPQISYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSVTSVNGLYRSENVNFRLKKGGKL 1038
            MLGIFVLVKVKDFATDSMGLLKTDFTYIIVGAGTAGSILAARLSETKNDVLLLEAGPKSGIITRAFSNTPLLVPLIIKNDSSILWKYETIYQANASLFMKNQKMILIGGKLLGGTSMINAMISYKPTK+DFDSWNISGWKYKDIDKYLNP                                           +SYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSVTSVNGLYRSENVNFRLKKGGKL
Sbjct:    1 MLGIFVLVKVKDFATDSMGLLKTDFTYIIVGAGTAGSILAARLSETKNDVLLLEAGPKSGIITRAFSNTPLLVPLIIKNDSSILWKYETIYQANASLFMKNQKMILIGGKLLGGTSMINAMISYKPTKDDFDSWNISGWKYKDIDKYLNP-------------------------------------------VSYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSVTSVNGLYRSENVNFRLKKGGKL 216          
BLAST of Oxygen-dependent choline dehydrogenase vs. Planmine SMEST
Match: SMESG000064120.1 (SMESG000064120.1)

HSP 1 Score: 517.309 bits (1331), Expect = 4.348e-178
Identity = 250/261 (95.79%), Postives = 256/261 (98.08%), Query Frame = 3
Query: 1011 FQTEKGWKIILSAGAIESAKLLHSSLKYNQIPIGKNLQDHVIFGMFYQLTRSKTISVEDLYHIREVMEYIFLGKGLYSIPSAMVTSGYFTFENSSTPDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYKIDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQT 1793
            F+ +KG K+ILSAGAIESAKLLHSSLKYNQIPIGKNLQDHVIFGMFYQLTRSKTISVEDLYHIREVMEYIFLGKGLYSIPSAMVTSGYFTFENSSTPDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSK TYKIDPKYFSSYKDV+TLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLR  ++
Sbjct:  212 FRLKKGGKLILSAGAIESAKLLHSSLKYNQIPIGKNLQDHVIFGMFYQLTRSKTISVEDLYHIREVMEYIFLGKGLYSIPSAMVTSGYFTFENSSTPDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKRTYKIDPKYFSSYKDVITLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRCNRS 472          

HSP 2 Score: 392.889 bits (1008), Expect = 1.696e-129
Identity = 214/259 (82.63%), Postives = 217/259 (83.78%), Query Frame = 1
Query:  262 MLGIFVLVKVKDFATDSMGLLKTDFTYIIVGAGTAGSILAARLSETKNDVLLLEAGPKSGIITRAFSNTPLLVPLIIKNDSSILWKYETIYQANASLFMKNQKMXXXXXXXXXXTSMINAMISYKPTKEDFDSWNISGWKYKDIDKYLNPEKYCGQRTKPLRQEPRLEVLRRSATFLNGKYENEGTLSFDYPQISYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSVTSVNGLYRSENVNFRLKKGGKL 1038
            MLGIFVLVKVKDFATDSMGLLKTDFTYIIVGAGTAGSILAARLSETKNDVLLLEAGPKSGIITRAFSNTPLLVPLIIKNDSSILWKYETIYQANASLFMKNQKMILIGGKLLGGTSMINAMISYKPTK+DFDSWNISGWKYKDIDKYLNP  +                                        +SYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSVTSVNGLYRSENVNFRLKKGGKL
Sbjct:    1 MLGIFVLVKVKDFATDSMGLLKTDFTYIIVGAGTAGSILAARLSETKNDVLLLEAGPKSGIITRAFSNTPLLVPLIIKNDSSILWKYETIYQANASLFMKNQKMILIGGKLLGGTSMINAMISYKPTKDDFDSWNISGWKYKDIDKYLNPGNFF---------------------------------------VSYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSVTSVNGLYRSENVNFRLKKGGKL 220          
BLAST of Oxygen-dependent choline dehydrogenase vs. Planmine SMEST
Match: SMESG000055659.1 (SMESG000055659.1)

HSP 1 Score: 77.0258 bits (188), Expect = 5.610e-15
Identity = 80/307 (26.06%), Postives = 141/307 (45.93%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLL-------------HSSLKYNQIP-IGKNLQDHVIFGMFYQLTRSKTI--SVEDLYH--IREVMEYIFLGKGLYSIPSAMVTSGYFTFE-NSSTPDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSSKGTYKIDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGNYHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADLV 1895
            +IILS GA+ S +LL             HS    N +P +GKNLQDH+   + ++  +  T+  +     H  IR  +++     G+ +  S + + G+   E   + PD+Q+       ++H   + L+ +    +Q ++   +S+S     ITI    P    LI          DP Y S  +D    +  ++ +TR+I S   F +       P      Q D   D +    I+  + ++YH + T  +G+   +++V++P  RV   +NL V+DASV+P + +GN      +IA K AD++
Sbjct:   32 EIILSGGAVNSPQLLMLSGVGDGAELKQHSIDVVNHVPGVGKNLQDHLELYVQHKSKKPVTLYSATWKFPHNVIRIGLQWFLFKSGMGAT-SHLDSGGFIRSEPGVAHPDLQFHFLPSTVIDHG--RKLATFH--AFQAHVGPMRSQSKGS--ITILSNDPRQHPLI----------DPNYNSLKRDFWEFRKAIR-LTREIFSQSAFDEFRGEEILPGSDA--QSDEQLDEF----IRQKTDTAYHPSCTCRMGSTKSNDTVVDPQCRVVGLDNLRVVDASVMPSIVSGNLNAPTMMIAEKVADMI 314          
BLAST of Oxygen-dependent choline dehydrogenase vs. Planmine SMEST
Match: SMESG000055689.1 (SMESG000055689.1)

HSP 1 Score: 51.6026 bits (122), Expect = 1.352e-6
Identity = 56/210 (26.67%), Postives = 90/210 (42.86%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLL-------------HSSLKYNQIP-IGKNLQDHVIFGMFYQLTRSKTI-SVEDLYHIREVMEYIFLGKGLYSIPSAMVTSGYFTFE-NSSTPDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSS---KGTYKIDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQD 1604
            ++IL  GAI S  LL             HS      IP +GKN QDH    + YQ  +  T+ S++     ++V +     K  Y     + + G+   E N + PDIQ+  F    L+H                     Q+ ++  F + ++ L+ ES+G I   S   K    IDP Y SS +D+   K+ ++ +TR+I +   F +
Sbjct:  156 EVILCGGAINSPHLLLLSGVGDGNELKKHSVNIVEHIPGVGKNFQDHPTIYVRYQCKKPVTLFSLQSPEFKKKVDQDWDEHKTGYGATVHLTSGGFIRSEANVTHPDIQFHFFPGLLLDHG-------------------RQTMTSHSFQMFVSPLRSESKGSISLHSIDPKEHPSIDPNYCSSERDICEFKSAIK-LTREIIAQSAFDE 345          
BLAST of Oxygen-dependent choline dehydrogenase vs. Planmine SMEST
Match: SMESG000055689.1 (SMESG000055689.1)

HSP 1 Score: 51.6026 bits (122), Expect = 1.404e-6
Identity = 56/210 (26.67%), Postives = 90/210 (42.86%), Query Frame = 3
Query: 1032 KIILSAGAIESAKLL-------------HSSLKYNQIP-IGKNLQDHVIFGMFYQLTRSKTI-SVEDLYHIREVMEYIFLGKGLYSIPSAMVTSGYFTFE-NSSTPDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITITLLKPESRGLIKYSS---KGTYKIDPKYFSSYKDVLTLKTGVQFITRKIESSKYFQD 1604
            ++IL  GAI S  LL             HS      IP +GKN QDH    + YQ  +  T+ S++     ++V +     K  Y     + + G+   E N + PDIQ+  F    L+H                     Q+ ++  F + ++ L+ ES+G I   S   K    IDP Y SS +D+   K+ ++ +TR+I +   F +
Sbjct:  153 EVILCGGAINSPHLLLLSGVGDGNELKKHSVNIVEHIPGVGKNFQDHPTIYVRYQCKKPVTLFSLQSPEFKKKVDQDWDEHKTGYGATVHLTSGGFIRSEANVTHPDIQFHFFPGLLLDHG-------------------RQTMTSHSFQMFVSPLRSESKGSISLHSIDPKEHPSIDPNYCSSERDICEFKSAIK-LTREIIAQSAFDE 342          
The following BLAST results are available for this feature:
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CHDH1.478e-1426.28choline dehydrogenase [Source:HGNC Symbol;Acc:HGNC... [more]
CHDH6.764e-932.23choline dehydrogenase [Source:HGNC Symbol;Acc:HGNC... [more]
CHDH4.688e-655.26choline dehydrogenase [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C34C6.46.949e-1623.84pep chromosome:WBcel235:II:8696591:8698928:-1 gene... [more]
back to top
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG95181.574e-4328.98gene:FBgn0030590 transcript:FBtr0073983[more]
CG95181.574e-4328.98gene:FBgn0030590 transcript:FBtr0343598[more]
CG95181.574e-4328.98gene:FBgn0030590 transcript:FBtr0344175[more]
CG61428.174e-4326.33gene:FBgn0039415 transcript:FBtr0084987[more]
CG95191.241e-3925.16gene:FBgn0030589 transcript:FBtr0073984[more]
back to top
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
chdh1.071e-1626.18choline dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-12... [more]
chdh1.181e-1626.18choline dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-12... [more]
back to top
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Chdh4.704e-2424.52choline dehydrogenase [Source:MGI Symbol;Acc:MGI:1... [more]
Chdh4.704e-2424.52choline dehydrogenase [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Oxygen-dependent choline dehydrogenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WWW2|ALKJ_PSEPU3.849e-2926.15Alcohol dehydrogenase [acceptor] OS=Pseudomonas pu... [more]
sp|P18172|DHGL_DROPS2.262e-2625.93Glucose dehydrogenase [FAD, quinone] OS=Drosophila... [more]
sp|Q6UPE0|CHDH_RAT1.624e-2426.28Choline dehydrogenase, mitochondrial OS=Rattus nor... [more]
sp|Q8BJ64|CHDH_MOUSE2.869e-2324.52Choline dehydrogenase, mitochondrial OS=Mus muscul... [more]
sp|B4SHV9|BETA_STRM59.158e-2324.46Oxygen-dependent choline dehydrogenase OS=Stenotro... [more]
back to top
BLAST of Oxygen-dependent choline dehydrogenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E9HAW26.394e-4930.53Uncharacterized protein OS=Daphnia pulex OX=6669 G... [more]
A0A1D1UXV39.197e-4828.06Uncharacterized protein OS=Ramazzottius varieornat... [more]
A0A224XLN01.628e-4631.85Putative glucose dehydrogenase OS=Panstrongylus li... [more]
T1HCA72.478e-4530.89Uncharacterized protein OS=Rhodnius prolixus OX=13... [more]
A0A210Q3619.645e-4527.39Glucose dehydrogenase [acceptor] OS=Mizuhopecten y... [more]
back to top
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
chdh4.786e-1424.84choline dehydrogenase [Source:NCBI gene;Acc:103039... [more]
back to top
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002402.12.023e-1326.12pep scaffold:Pmarinus_7.0:GL482915:11564:16540:1 g... [more]
back to top
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO389567.838e-1325.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389586.338e-935.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Oxygen-dependent choline dehydrogenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
chdh5.168e-2826.11choline dehydrogenase [Source:NCBI gene;Acc:101161... [more]
back to top
BLAST of Oxygen-dependent choline dehydrogenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064120.14.613e-17996.53SMESG000064120.1[more]
SMESG000064120.14.348e-17895.79SMESG000064120.1[more]
SMESG000055659.15.610e-1526.06SMESG000055659.1[more]
SMESG000055689.11.352e-626.67SMESG000055689.1[more]
SMESG000055689.11.404e-626.67SMESG000055689.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004686 ID=SMED30004686|Name=Oxygen-dependent choline dehydrogenase|organism=Schmidtea mediterranea sexual|type=transcript|length=1941bp
CAAACTAGGACCTATGTTAATTGTATTTTTGCAGATTCTCACTTCTCAAA
AAGTATTTATGTCGTTGATTGGTTTGCATTTTGACAGAAACTTGTGAATG
AAAAAATAATTATTATATTCATCGTCATGGGAGAAAATATTTTATTATGA
AATTAAATGATTTTTGCTGACTGAGTCTTTTTAATGACATCATAGATAAT
AAATATTTATTTTTTAAAATTAATGAATTACGCGATTCTTCCATTATGTT
TTATCAATGCTATGTTAGGAATATTCGTACTTGTAAAGGTGAAAGATTTT
GCGACAGACTCGATGGGATTACTAAAAACAGATTTCACTTATATAATCGT
TGGTGCTGGAACGGCCGGAAGCATTTTGGCAGCGCGACTCTCTGAAACCA
AGAATGATGTTTTGCTTTTAGAGGCAGGTCCGAAATCAGGAATAATTACT
CGAGCATTTAGCAATACTCCGCTCTTGGTTCCACTTATTATTAAAAATGA
CTCTTCTATATTATGGAAATATGAAACTATTTATCAAGCAAACGCAAGTC
TTTTTATGAAAAATCAGAAAATGATTTTAATCGGGGGGAAATTACTCGGT
GGGACCTCAATGATAAATGCTATGATATCGTATAAACCAACAAAAGAGGA
TTTCGATTCTTGGAACATATCTGGTTGGAAGTACAAGGACATTGATAAAT
ATTTAAACCCGGAAAAATATTGCGGACAAAGAACCAAACCCCTCCGACAA
GAACCTCGACTGGAAGTTTTAAGGCGATCAGCAACATTTTTAAATGGCAA
ATACGAAAATGAAGGAACTTTATCATTTGATTACCCGCAAATTAGCTACG
ACTACTACGTTAGAAGAAGTACATATTCAGAGTGCCTGGAAAAAATAGCA
AACCATAAAAATTTGCATATAATTACTGATTTTCTTGTGACAAAGATTAA
CATCGATGATGAAAAATCAGTGACATCTGTCAACGGATTGTATCGCTCGG
AAAATGTCAATTTCAGACTGAAAAAGGGTGGAAAATTATACTTTCAGCTG
GTGCAATAGAAAGTGCAAAATTACTTCATAGTTCACTGAAATATAATCAA
ATTCCAATTGGCAAAAATCTTCAAGATCATGTCATATTTGGTATGTTTTA
TCAGTTAACTCGAAGTAAAACTATATCAGTTGAAGATCTATATCATATAA
GAGAAGTTATGGAATATATTTTCCTTGGAAAAGGTCTTTACAGTATTCCA
TCTGCTATGGTTACATCTGGTTATTTTACATTTGAAAATTCTTCAACTCC
AGACATCCAATATTGTATATTCGGAATCGGCTCATTGAACCATTCAACTA
TCAAATGGTTATCTAATTATGAAGACTCCATTTGGCAAAAGTATTTACCA
AACAACCAATCTGAATCTGCATCAGGATTTCTGATTACAATAACTCTGCT
GAAACCCGAATCTCGAGGACTAATAAAATATTCAAGCAAAGGAACTTATA
AAATTGATCCAAAATATTTTAGTTCATATAAAGATGTTCTAACTTTGAAA
ACTGGAGTTCAATTCATTACAAGAAAAATTGAATCCAGTAAATATTTCCA
GGATCTCGGAGCTGTTCCCTACTATCCAAAATATTCTCAATGCCCCCAAA
AAGATCATAATTTTGATTTGTATTTGACATGCGCCATTCAAGGCACCTCC
ATATCGTCTTATCATTTAGCAGGAACAAATTCTTTGGGAAATTATCACGA
TTCAAATTCAGTTTTGAACCCTGATTTGAGAGTAAAGCAGACAAATAATT
TATTTGTCATTGATGCATCCGTCATTCCTCGCTTGCCAACTGGGAATCCT
GCAAGGATGATAACAATAATTGCCCATAAAGGAGCAGACCTGGTCAAAGA
AATGACTAAAATGTCATTACGTCAAGTGGAGAACAATTTAC
back to top

protein sequence of SMED30004686-orf-1

>SMED30004686-orf-1 ID=SMED30004686-orf-1|Name=SMED30004686-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=279bp
MNYAILPLCFINAMLGIFVLVKVKDFATDSMGLLKTDFTYIIVGAGTAGS
ILAARLSETKNDVLLLEAGPKSGIITRAFSNTPLLVPLIIKNDSSILWKY
ETIYQANASLFMKNQKMILIGGKLLGGTSMINAMISYKPTKEDFDSWNIS
GWKYKDIDKYLNPEKYCGQRTKPLRQEPRLEVLRRSATFLNGKYENEGTL
SFDYPQISYDYYVRRSTYSECLEKIANHKNLHIITDFLVTKINIDDEKSV
TSVNGLYRSENVNFRLKKGGKLYFQLVQ*
back to top

protein sequence of SMED30004686-orf-2

>SMED30004686-orf-2 ID=SMED30004686-orf-2|Name=SMED30004686-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=266bp
MFYQLTRSKTISVEDLYHIREVMEYIFLGKGLYSIPSAMVTSGYFTFENS
STPDIQYCIFGIGSLNHSTIKWLSNYEDSIWQKYLPNNQSESASGFLITI
TLLKPESRGLIKYSSKGTYKIDPKYFSSYKDVLTLKTGVQFITRKIESSK
YFQDLGAVPYYPKYSQCPQKDHNFDLYLTCAIQGTSISSYHLAGTNSLGN
YHDSNSVLNPDLRVKQTNNLFVIDASVIPRLPTGNPARMITIIAHKGADL
VKEMTKMSLRQVENNL
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008802betaine-aldehyde dehydrogenase activity
GO:0008812choline dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
Vocabulary: biological process
TermDefinition
GO:0019285glycine betaine biosynthetic process from choline
GO:0055114oxidation-reduction process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000418head
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036188FAD/NAD-bd_sf
IPR023753FAD/NAD-binding_dom
IPR007867GMC_OxRtase_C
IPR000172GMC_OxRdtase_N
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000172Glucose-methanol-choline oxidoreductase, N-terminalPFAMPF00732GMC_oxred_Ncoord: 38..279
e-value: 2.3E-25
score: 89.6
NoneNo IPR availableGENE3DG3DSA:3.30.560.10coord: 78..120
e-value: 1.8E-30
score: 108.4
NoneNo IPR availablePANTHERPTHR11552GLUCOSE-METHANOL-CHOLINE GMC OXIDOREDUCTASEcoord: 30..279
NoneNo IPR availableTMHMMTMhelixcoord: 4..21
IPR036188FAD/NAD(P)-binding domain superfamilyGENE3DG3DSA:3.50.50.60coord: 204..279
e-value: 3.0E-10
score: 42.0
IPR036188FAD/NAD(P)-binding domain superfamilyGENE3DG3DSA:3.50.50.60coord: 38..163
e-value: 1.8E-30
score: 108.4
IPR036188FAD/NAD(P)-binding domain superfamilySUPERFAMILYSSF51905FAD/NAD(P)-binding domaincoord: 32..279