PRKR-interacting protein 1

Overview
NamePRKR-interacting protein 1
Smed IDSMED30004679
Length (bp)581
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PRKR-interacting protein 1 (SMED30004679) t-SNE clustered cells

Violin plots show distribution of expression levels for PRKR-interacting protein 1 (SMED30004679) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PRKR-interacting protein 1 (SMED30004679) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PRKR-interacting protein 1 (SMED30004679) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004679

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30004679SMESG000063624.1 SmedASXL_004523SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30004679SMESG000063624.1 SmedASXL_004523SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30004679SMESG000063632.1 SMESG000063625.1 SMESG000063624.1 dd_Smed_v4_8973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30004679SMESG000063632.1 SMESG000063625.1 SMESG000063624.1 dd_Smed_v4_8973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004679SMESG000063632.1 SMESG000063625.1 SMESG000063624.1 dd_Smed_v4_8973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004679SMESG000063632.1 SMESG000063625.1 SMESG000063624.1 dd_Smed_v4_8973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004679SMESG000063632.1 SMESG000063625.1 SMESG000063624.1 dd_Smed_v4_8973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004679SMESG000063632.1 SMESG000063625.1 SMESG000063624.1 dd_Smed_v4_8973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004679SMESG000063632.1 SMESG000063625.1 SMESG000063624.1 dd_Smed_v4_8973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004679SMESG000063632.1 SMESG000063625.1 SMESG000063624.1 dd_Smed_v4_8973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30004679SMESG000063632.1 SMESG000063625.1 SMESG000063624.1 dd_Smed_v4_8973_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PRKR-interacting protein 1 vs. Ensembl Human
Match: PRKRIP1 (PRKR interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:21894])

HSP 1 Score: 70.8626 bits (172), Expect = 5.510e-15
Identity = 40/84 (47.62%), Postives = 60/84 (71.43%), Query Frame = 2
Query:  122 DEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEK 373
            +EQ+  LE+LM  PDK V IP    E  PR P EF+R++ GSSAG GSG+FH+YR +RRR+ +R++YM+  ++ + LD E+ ++
Sbjct:   29 EEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLDAEFQKR 112          
BLAST of PRKR-interacting protein 1 vs. Ensembl Human
Match: PRKRIP1 (PRKR interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:21894])

HSP 1 Score: 70.8626 bits (172), Expect = 5.510e-15
Identity = 40/84 (47.62%), Postives = 60/84 (71.43%), Query Frame = 2
Query:  122 DEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEK 373
            +EQ+  LE+LM  PDK V IP    E  PR P EF+R++ GSSAG GSG+FH+YR +RRR+ +R++YM+  ++ + LD E+ ++
Sbjct:   29 EEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLDAEFQKR 112          
BLAST of PRKR-interacting protein 1 vs. Ensembl Celegans
Match: F37A4.2 (pep chromosome:WBcel235:III:6722545:6723284:1 gene:WBGene00018132.1 transcript:F37A4.2.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F37A4.2)

HSP 1 Score: 59.6918 bits (143), Expect = 3.143e-11
Identity = 37/85 (43.53%), Postives = 51/85 (60.00%), Query Frame = 2
Query:  113 TVYDEQRKHLEKLMSEPDKPVHIPSPAKE-RKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEY 364
            +  D  R  L +L    DKP  IP   +  R P+EP EF+RN+ GSSA  GS +FHIYR  RR++  R +Y++  +K E LD+ Y
Sbjct:   16 SATDLIRMRLARLQQNIDKPAPIPIKKETLRAPKEPLEFVRNVVGSSAAAGSAEFHIYRNNRRKEQNRLDYIDAVAKKEELDDAY 100          
BLAST of PRKR-interacting protein 1 vs. Ensembl Celegans
Match: F37A4.2 (pep chromosome:WBcel235:III:6722454:6723283:1 gene:WBGene00018132.1 transcript:F37A4.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F37A4.2)

HSP 1 Score: 59.6918 bits (143), Expect = 3.143e-11
Identity = 37/85 (43.53%), Postives = 51/85 (60.00%), Query Frame = 2
Query:  113 TVYDEQRKHLEKLMSEPDKPVHIPSPAKE-RKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEY 364
            +  D  R  L +L    DKP  IP   +  R P+EP EF+RN+ GSSA  GS +FHIYR  RR++  R +Y++  +K E LD+ Y
Sbjct:   16 SATDLIRMRLARLQQNIDKPAPIPIKKETLRAPKEPLEFVRNVVGSSAAAGSAEFHIYRNNRRKEQNRLDYIDAVAKKEELDDAY 100          
BLAST of PRKR-interacting protein 1 vs. Ensembl Fly
Match: CG8441 (gene:FBgn0034086 transcript:FBtr0304748)

HSP 1 Score: 71.633 bits (174), Expect = 4.522e-15
Identity = 41/88 (46.59%), Postives = 55/88 (62.50%), Query Frame = 2
Query:  113 TVYDEQRKHLEKLMSEPDKPVHIPSPAKERKPREPR-EFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEK 373
            T  D QR  LEKLM  PDKPV IP   +ER        F+RN+ GSSAG GSG+FH+YR +RR++  R++ ++ +S  E  D  Y +K
Sbjct:   42 TATDLQRLKLEKLMKNPDKPVVIPEQRRERDFMSSVPTFVRNVMGSSAGAGSGEFHVYRHLRRKEYARQKNIQNQSAREAADEAYQQK 129          
BLAST of PRKR-interacting protein 1 vs. Ensembl Fly
Match: CG8441 (gene:FBgn0034086 transcript:FBtr0087247)

HSP 1 Score: 71.633 bits (174), Expect = 4.522e-15
Identity = 41/88 (46.59%), Postives = 55/88 (62.50%), Query Frame = 2
Query:  113 TVYDEQRKHLEKLMSEPDKPVHIPSPAKERKPREPR-EFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEK 373
            T  D QR  LEKLM  PDKPV IP   +ER        F+RN+ GSSAG GSG+FH+YR +RR++  R++ ++ +S  E  D  Y +K
Sbjct:   42 TATDLQRLKLEKLMKNPDKPVVIPEQRRERDFMSSVPTFVRNVMGSSAGAGSGEFHVYRHLRRKEYARQKNIQNQSAREAADEAYQQK 129          
BLAST of PRKR-interacting protein 1 vs. Ensembl Zebrafish
Match: prkrip1 (PRKR interacting protein 1 [Source:NCBI gene;Acc:550595])

HSP 1 Score: 78.9518 bits (193), Expect = 2.934e-18
Identity = 45/87 (51.72%), Postives = 62/87 (71.26%), Query Frame = 2
Query:  113 TVYDEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEK 373
            T  +EQR  LE+LM  PDK   IP   KE  PR P EF+R++ GSSAG GSG+FH+YR +RRR+ +R++++E+ S+ + LD EY EK
Sbjct:   26 TPAEEQRLKLERLMRNPDKAAPIPEKPKEWNPRAPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDFLERLSEKQKLDEEYKEK 112          
BLAST of PRKR-interacting protein 1 vs. Ensembl Zebrafish
Match: prkrip1 (PRKR interacting protein 1 [Source:NCBI gene;Acc:550595])

HSP 1 Score: 78.5666 bits (192), Expect = 4.451e-18
Identity = 45/87 (51.72%), Postives = 62/87 (71.26%), Query Frame = 2
Query:  113 TVYDEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEK 373
            T  +EQR  LE+LM  PDK   IP   KE  PR P EF+R++ GSSAG GSG+FH+YR +RRR+ +R++++E+ S+ + LD EY EK
Sbjct:   26 TPAEEQRLKLERLMRNPDKAAPIPEKPKEWNPRAPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDFLERLSEKQKLDEEYKEK 112          
BLAST of PRKR-interacting protein 1 vs. Ensembl Xenopus
Match: prkrip1 (PRKR interacting protein 1 [Source:NCBI gene;Acc:549979])

HSP 1 Score: 74.3294 bits (181), Expect = 2.565e-16
Identity = 45/94 (47.87%), Postives = 64/94 (68.09%), Query Frame = 2
Query:  122 DEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEKQKSLNEKCEE 403
            DEQR  LE+LM  PDK   IP   KE  PR   EF+R++ GSSAG GSG+FH+YR +RRR+ +R+E++++ S+   LD+++  K    N+K EE
Sbjct:   28 DEQRLRLERLMRNPDKLAAIPERPKEWSPRSAPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQEFLDRVSEKHNLDDDFQRKLME-NKKLEE 120          
BLAST of PRKR-interacting protein 1 vs. Ensembl Mouse
Match: Prkrip1 (Prkr interacting protein 1 (IL11 inducible) [Source:MGI Symbol;Acc:MGI:1914051])

HSP 1 Score: 72.0182 bits (175), Expect = 1.430e-15
Identity = 40/84 (47.62%), Postives = 60/84 (71.43%), Query Frame = 2
Query:  122 DEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEK 373
            +EQ+  LE+LM  PDK V IP    E  PR P EF+R++ GSSAG GSG+FH+YR +RRR+ +R++YM+  ++ + LD E+ ++
Sbjct:   29 EEQKLKLERLMKNPDKAVPIPEKMNEWAPRAPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLDAEFQKR 112          
BLAST of PRKR-interacting protein 1 vs. UniProt/SwissProt
Match: sp|Q568A0|PKRI1_DANRE (PRKR-interacting protein 1 homolog OS=Danio rerio OX=7955 GN=prkrip1 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.360e-17
Identity = 45/87 (51.72%), Postives = 62/87 (71.26%), Query Frame = 2
Query:  113 TVYDEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEK 373
            T  +EQR  LE+LM  PDK   IP   KE  PR P EF+R++ GSSAG GSG+FH+YR +RRR+ +R++++E+ S+ + LD EY EK
Sbjct:   26 TPAEEQRLKLERLMRNPDKAAPIPEKPKEWNPRAPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDFLERLSEKQKLDEEYKEK 112          
BLAST of PRKR-interacting protein 1 vs. UniProt/SwissProt
Match: sp|Q6GNG8|PKRI1_XENLA (PRKR-interacting protein 1 homolog OS=Xenopus laevis OX=8355 GN=prkrip1 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.198e-16
Identity = 43/86 (50.00%), Postives = 60/86 (69.77%), Query Frame = 2
Query:  116 VYDEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEK 373
              DEQR  LE+LM  PDKP  +P   KE  PR   EF+R++ GSSAG GSG+FH+YR +RRR+ +R+E+++  S+ + LD EY +K
Sbjct:   26 ATDEQRLKLERLMRNPDKPATVPERPKEWSPRSAPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQEFLDGMSEKQRLDEEYKKK 111          
BLAST of PRKR-interacting protein 1 vs. UniProt/SwissProt
Match: sp|Q28IN9|PKRI1_XENTR (PRKR-interacting protein 1 homolog OS=Xenopus tropicalis OX=8364 GN=prkrip1 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.359e-15
Identity = 45/94 (47.87%), Postives = 64/94 (68.09%), Query Frame = 2
Query:  122 DEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEKQKSLNEKCEE 403
            DEQR  LE+LM  PDK   IP   KE  PR   EF+R++ GSSAG GSG+FH+YR +RRR+ +R+E++++ S+   LD+++  K    N+K EE
Sbjct:   28 DEQRLRLERLMRNPDKLAAIPERPKEWSPRSAPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQEFLDRVSEKHNLDDDFQRKLME-NKKLEE 120          
BLAST of PRKR-interacting protein 1 vs. UniProt/SwissProt
Match: sp|Q5ZKU0|PKRI1_CHICK (PRKR-interacting protein 1 homolog OS=Gallus gallus OX=9031 GN=PRKRIP1 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 6.558e-15
Identity = 40/84 (47.62%), Postives = 60/84 (71.43%), Query Frame = 2
Query:  122 DEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEK 373
            +EQR  LE+LM  P+K V IP    E  PR P EF+R++ GSSAG GSG+FH+YR +RRR+ +R+++M+  ++ + LD E+ +K
Sbjct:   27 EEQRLRLERLMRNPEKTVPIPEKLNEWAPRPPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDFMDAMAEKQRLDEEFQKK 110          
BLAST of PRKR-interacting protein 1 vs. UniProt/SwissProt
Match: sp|Q9CWV6|PKRI1_MOUSE (PRKR-interacting protein 1 OS=Mus musculus OX=10090 GN=Prkrip1 PE=1 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 1.001e-14
Identity = 40/84 (47.62%), Postives = 60/84 (71.43%), Query Frame = 2
Query:  122 DEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEK 373
            +EQ+  LE+LM  PDK V IP    E  PR P EF+R++ GSSAG GSG+FH+YR +RRR+ +R++YM+  ++ + LD E+ ++
Sbjct:   29 EEQKLKLERLMKNPDKAVPIPEKMNEWAPRAPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLDAEFQKR 112          
BLAST of PRKR-interacting protein 1 vs. TrEMBL
Match: A0A183KK27 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS15387 PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.072e-19
Identity = 49/99 (49.49%), Postives = 69/99 (69.70%), Query Frame = 2
Query:  107 KYTVYDEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEKQKSLNEKCEE 403
            K + YD  R+ +EK  + P++ +  P  A+ + P+ P EF+RN+WGS+AGVGSGDFHIYRGIRRR+  R E +EK ++ E LD E+  KQK+LN+   E
Sbjct:   25 KMSTYDFVRRDIEKYFAHPEEALVAPELAQPQLPKPPPEFVRNVWGSAAGVGSGDFHIYRGIRRREYTRLEMIEKTAEEERLDREFQMKQKALNDLAAE 123          
BLAST of PRKR-interacting protein 1 vs. TrEMBL
Match: T1G5R5 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20216412 PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.247e-19
Identity = 51/86 (59.30%), Postives = 62/86 (72.09%), Query Frame = 2
Query:  122 DEQRKHLEKLMSEPDKPVHIPSPAKERKPRE--PREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEK 373
            D QR  +EKLM  PDK  +IP   KE+ PR   P EF+RNIWGSSAG GSGDFH+YRG+RRR+  R++Y+E K K ETL+  Y EK
Sbjct:   24 DLQRLKIEKLMKNPDKLAYIPDKGKEKIPRAFNPPEFVRNIWGSSAGAGSGDFHVYRGVRRRENIRQKYLEAKEKEETLNKRYLEK 109          
BLAST of PRKR-interacting protein 1 vs. TrEMBL
Match: A0A433UA64 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_001566 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.498e-19
Identity = 50/87 (57.47%), Postives = 63/87 (72.41%), Query Frame = 2
Query:  113 TVYDEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEK 373
            T  D QR  LEKLM+ P K V IP  +KE+ PR P EFIRNIWGSSAG GSGDFH+YRG+RRR+  R++++++K   E LD  Y +K
Sbjct:   27 TPVDLQRLKLEKLMNNPTKEVVIPEKSKEKNPRAPLEFIRNIWGSSAGAGSGDFHVYRGVRRREYARQKFIKEKGAKEELDEAYQKK 113          
BLAST of PRKR-interacting protein 1 vs. TrEMBL
Match: A0A0R3UG23 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS6125 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.821e-19
Identity = 47/101 (46.53%), Postives = 70/101 (69.31%), Query Frame = 2
Query:  107 KYTVYDEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXX----XXXXXKKSKTETLDNEYSEKQKSLNEKC 397
            K   YD  R  + KLM +PD PV IP  +++++P+ P +F+RN+WGS+AGVGSGDFHIYRGIRRR+  R    E+  ++K+K +  + E+ EK +++ EK 
Sbjct:   19 KMGTYDLVRMRINKLMEKPDVPVVIPESSRKKQPKAPPDFVRNVWGSAAGVGSGDFHIYRGIRRREYARLEFIEQQAKEKAKADAFNAEHEEKNRAIEEKT 119          
BLAST of PRKR-interacting protein 1 vs. TrEMBL
Match: A0A183N0F4 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS21779 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.845e-19
Identity = 49/99 (49.49%), Postives = 68/99 (68.69%), Query Frame = 2
Query:  107 KYTVYDEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEKQKSLNEKCEE 403
            K   YD  R+ +EK  + P++ +  P  A+ + P+ P EF+RN+WGS+AGVGSGDFHIYRGIRRR+  R E +EK ++ E LD E+  KQK+LN+   E
Sbjct:   25 KMGTYDFVRRDIEKYFAHPEEALVAPELAQPQLPKPPPEFVRNVWGSAAGVGSGDFHIYRGIRRREYTRLEMIEKTAEEERLDREFQMKQKALNDLAAE 123          
BLAST of PRKR-interacting protein 1 vs. Ensembl Cavefish
Match: prkrip1 (PRKR interacting protein 1 [Source:NCBI gene;Acc:103041346])

HSP 1 Score: 75.0998 bits (183), Expect = 7.582e-17
Identity = 44/97 (45.36%), Postives = 64/97 (65.98%), Query Frame = 2
Query:  113 TVYDEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEKQKSLNEKCEE 403
            T  +EQR  LE+LM  PDK   IP   KE  PR P EF+R++ GSSAG GSG+FH+YR +RRR+ +R++++++ S  + LD +Y +K +      EE
Sbjct:   28 TPAEEQRLKLERLMRNPDKLAPIPERPKEWNPRAPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDFLDRMSDKQKLDEDYIQKVQDNQTAAEE 124          
BLAST of PRKR-interacting protein 1 vs. Ensembl Cavefish
Match: prkrip1 (PRKR interacting protein 1 [Source:NCBI gene;Acc:103041346])

HSP 1 Score: 74.3294 bits (181), Expect = 1.457e-16
Identity = 44/97 (45.36%), Postives = 64/97 (65.98%), Query Frame = 2
Query:  113 TVYDEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEKQKSLNEKCEE 403
            T  +EQR  LE+LM  PDK   IP   KE  PR P EF+R++ GSSAG GSG+FH+YR +RRR+ +R++++++ S  + LD +Y +K +      EE
Sbjct:   28 TPAEEQRLKLERLMRNPDKLAPIPERPKEWNPRAPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDFLDRMSDKQKLDEDYIQKVQDNQTAAEE 124          
BLAST of PRKR-interacting protein 1 vs. Ensembl Nematostella
Match: EDO44649 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVJ2])

HSP 1 Score: 79.7221 bits (195), Expect = 2.436e-19
Identity = 44/87 (50.57%), Postives = 63/87 (72.41%), Query Frame = 2
Query:  113 TVYDEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEK 373
            T  + Q+   E+LM +P++ VHIP   KE KP +P++F+R + GSSAG GSG+FH+YR  RRR+  R+EY+EKKSK  ++ NEY +K
Sbjct:   14 TAAELQKMQYERLMRDPERNVHIPETKKEWKPSDPKDFVRFVMGSSAGAGSGEFHVYRATRRREYNRQEYIEKKSKEASIQNEYHKK 100          
BLAST of PRKR-interacting protein 1 vs. Planmine SMEST
Match: SMESG000063624.1 (SMESG000063624.1)

HSP 1 Score: 260.381 bits (664), Expect = 1.165e-89
Identity = 165/165 (100.00%), Postives = 165/165 (100.00%), Query Frame = 2
Query:   83 MDNENLGNKYTVYDEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEKQKSLNEKCEEXXXXXXXXXXXXXXXXXXXNELIQKSPSQERKLNIEEKVSEKTDNIPQEILNTETVSE 577
            MDNENLGNKYTVYDEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIRRRQMEREEYMEKKSKTETLDNEYSEKQKSLNEKCEEKTAKKRLKRQKKKLNKNTKNELIQKSPSQERKLNIEEKVSEKTDNIPQEILNTETVSE
Sbjct:    1 MDNENLGNKYTVYDEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIRRRQMEREEYMEKKSKTETLDNEYSEKQKSLNEKCEEKTAKKRLKRQKKKLNKNTKNELIQKSPSQERKLNIEEKVSEKTDNIPQEILNTETVSE 165          
BLAST of PRKR-interacting protein 1 vs. Planmine SMEST
Match: SMESG000074495.1 (SMESG000074495.1)

HSP 1 Score: 136.732 bits (343), Expect = 1.776e-40
Identity = 77/106 (72.64%), Postives = 91/106 (85.85%), Query Frame = 2
Query:   86 DNENLGNKYTVYDEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIRNIWGSSAGVGSGDFHIYRGIXXXXXXXXXXXXKKSKTETLDNEYSEKQKSLNEKCEE 403
            D E    K+TVYDEQRK L+KLM +P+KPV+IPS  K++KPREPREFIRNIWGSSAGVGSGDFHIYRGIRRRQMEREEYMEK ++ + L++EY+ K+K L EKCEE
Sbjct:    3 DGEKTETKFTVYDEQRKKLDKLMMDPEKPVYIPSMPKDQKPREPREFIRNIWGSSAGVGSGDFHIYRGIRRRQMEREEYMEKTTEKQRLNDEYAAKRKILEEKCEE 108          
The following BLAST results are available for this feature:
BLAST of PRKR-interacting protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PRKRIP15.510e-1547.62PRKR interacting protein 1 [Source:HGNC Symbol;Acc... [more]
PRKRIP15.510e-1547.62PRKR interacting protein 1 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of PRKR-interacting protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
F37A4.23.143e-1143.53pep chromosome:WBcel235:III:6722545:6723284:1 gene... [more]
F37A4.23.143e-1143.53pep chromosome:WBcel235:III:6722454:6723283:1 gene... [more]
back to top
BLAST of PRKR-interacting protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG84414.522e-1546.59gene:FBgn0034086 transcript:FBtr0304748[more]
CG84414.522e-1546.59gene:FBgn0034086 transcript:FBtr0087247[more]
back to top
BLAST of PRKR-interacting protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
prkrip12.934e-1851.72PRKR interacting protein 1 [Source:NCBI gene;Acc:5... [more]
prkrip14.451e-1851.72PRKR interacting protein 1 [Source:NCBI gene;Acc:5... [more]
back to top
BLAST of PRKR-interacting protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prkrip12.565e-1647.87PRKR interacting protein 1 [Source:NCBI gene;Acc:5... [more]
back to top
BLAST of PRKR-interacting protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Prkrip11.430e-1547.62Prkr interacting protein 1 (IL11 inducible) [Sourc... [more]
back to top
BLAST of PRKR-interacting protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q568A0|PKRI1_DANRE3.360e-1751.72PRKR-interacting protein 1 homolog OS=Danio rerio ... [more]
sp|Q6GNG8|PKRI1_XENLA1.198e-1650.00PRKR-interacting protein 1 homolog OS=Xenopus laev... [more]
sp|Q28IN9|PKRI1_XENTR1.359e-1547.87PRKR-interacting protein 1 homolog OS=Xenopus trop... [more]
sp|Q5ZKU0|PKRI1_CHICK6.558e-1547.62PRKR-interacting protein 1 homolog OS=Gallus gallu... [more]
sp|Q9CWV6|PKRI1_MOUSE1.001e-1447.62PRKR-interacting protein 1 OS=Mus musculus OX=1009... [more]
back to top
BLAST of PRKR-interacting protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183KK271.072e-1949.49Uncharacterized protein OS=Schistosoma curassoni O... [more]
T1G5R51.247e-1959.30Uncharacterized protein OS=Helobdella robusta OX=6... [more]
A0A433UA641.498e-1957.47Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A0R3UG231.821e-1946.53Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A183N0F41.845e-1949.49Uncharacterized protein OS=Schistosoma margrebowie... [more]
back to top
BLAST of PRKR-interacting protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
prkrip17.582e-1745.36PRKR interacting protein 1 [Source:NCBI gene;Acc:1... [more]
prkrip11.457e-1645.36PRKR interacting protein 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of PRKR-interacting protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PRKR-interacting protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PRKR-interacting protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO446492.436e-1950.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PRKR-interacting protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PRKR-interacting protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000063624.11.165e-89100.00SMESG000063624.1[more]
SMESG000074495.11.776e-4072.64SMESG000074495.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004679 ID=SMED30004679|Name=PRKR-interacting protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=581bp
TTTAAAAAAACTTCATAAAATATTTTATAATTAACAAAATTAAGGTGTTT
AAATATTGCCTTTATTAAAAAATTTATCTGAAATGGATAATGAAAACTTG
GGCAATAAATATACTGTTTATGATGAACAAAGAAAGCATTTAGAAAAATT
AATGAGTGAGCCAGATAAACCAGTACATATTCCGAGTCCTGCTAAAGAAC
GTAAACCTAGAGAGCCCAGGGAGTTTATTAGAAACATTTGGGGATCATCC
GCTGGTGTTGGTAGTGGAGATTTTCACATTTACCGTGGAATTCGTCGTCG
GCAAATGGAAAGAGAAGAATATATGGAAAAGAAGAGTAAAACTGAAACGC
TTGATAATGAATATTCCGAAAAGCAAAAATCATTAAATGAAAAGTGTGAA
GAAAAAACTGCGAAAAAACGATTAAAACGTCAGAAAAAAAAATTAAATAA
AAACACAAAAAACGAACTTATTCAAAAAAGCCCTTCTCAAGAAAGAAAAT
TAAATATAGAGGAAAAAGTCTCGGAAAAAACTGACAATATACCACAAGAA
ATTCTCAATACAGAAACTGTCAGCGAATAAA
back to top

protein sequence of SMED30004679-orf-1

>SMED30004679-orf-1 ID=SMED30004679-orf-1|Name=SMED30004679-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=166bp
MDNENLGNKYTVYDEQRKHLEKLMSEPDKPVHIPSPAKERKPREPREFIR
NIWGSSAGVGSGDFHIYRGIRRRQMEREEYMEKKSKTETLDNEYSEKQKS
LNEKCEEKTAKKRLKRQKKKLNKNTKNELIQKSPSQERKLNIEEKVSEKT
DNIPQEILNTETVSE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR009548Prkrip1
Vocabulary: molecular function
TermDefinition
GO:0003725double-stranded RNA binding
GO:0004860protein kinase inhibitor activity
GO:0019901protein kinase binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
Vocabulary: biological process
TermDefinition
GO:0006469negative regulation of protein kinase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 111..131
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 11..47
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 78..165
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 137..151
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..47
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 78..110
IPR009548PRKR-interacting protein 1PFAMPF06658DUF1168coord: 27..148
e-value: 5.8E-37
score: 126.5
IPR009548PRKR-interacting protein 1PANTHERPTHR13507UNCHARACTERIZEDcoord: 12..150