Synaptotagmin 16

Overview
NameSynaptotagmin 16
Smed IDSMED30004667
Length (bp)1164
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synaptotagmin 16 (SMED30004667) t-SNE clustered cells

Violin plots show distribution of expression levels for Synaptotagmin 16 (SMED30004667) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptotagmin 16 (SMED30004667) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptotagmin 16 (SMED30004667) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004667

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30004667h1SMcG0004520 dd_Smed_v4_5370_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004667h1SMcG0004520 dd_Smed_v4_5370_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004667h1SMcG0004520 dd_Smed_v4_5370_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004667h1SMcG0004520 dd_Smed_v4_5370_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004667h1SMcG0004520 dd_Smed_v4_5370_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30004667h1SMcG0004520 dd_Smed_v4_5370_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004667h1SMcG0004520 dd_Smed_v4_5370_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004667h1SMcG0004520 dd_Smed_v4_5370_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004667h1SMcG0004520 dd_Smed_v4_5370_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004667h1SMcG0004520 dd_Smed_v4_5370_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004667h1SMcG0004520 dd_Smed_v4_5370_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004667h1SMcG0004520 dd_Smed_v4_5370_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptotagmin 16 vs. Ensembl Human
Match: SYT16 (synaptotagmin 16 [Source:HGNC Symbol;Acc:HGNC:23142])

HSP 1 Score: 104.375 bits (259), Expect = 1.075e-25
Identity = 48/138 (34.78%), Postives = 78/138 (56.52%), Query Frame = 1
Query:  367 PTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            P + VGL Y+   G+LSV +IKG++ +  +     D Y KL +    G ++S   T +   + +P + E F F +  FQ+  VTLM+S Y ++ + + EMIGWIA+G  +S E++  HW  +    G ++ RWH  L+
Sbjct:   65 PELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKLFLLNSVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISVYNRRTMKRKEMIGWIALGQNSSGEEEQDHWEEMKETKGQQICRWHTLLE 202          
BLAST of Synaptotagmin 16 vs. Ensembl Human
Match: SYT14 (synaptotagmin 14 [Source:HGNC Symbol;Acc:HGNC:23143])

HSP 1 Score: 108.612 bits (270), Expect = 2.733e-25
Identity = 53/152 (34.87%), Postives = 86/152 (56.58%), Query Frame = 1
Query:  325 ESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            ES       E  S P I +GL Y+   G+LS  VIKG++ +  +A    + Y+KL +    G ++S   T +   + +P + E F F +  FQ+  VTL++S Y K+++ + EMIGWI++G  +S E++L+HW  +    G +V RWH  L+
Sbjct:  365 ESTSSCQSLEHGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNTYVKLTLLNSMGQEMSKCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELNHWTEMKESKGQQVCRWHALLE 516          
BLAST of Synaptotagmin 16 vs. Ensembl Human
Match: SYT14 (synaptotagmin 14 [Source:HGNC Symbol;Acc:HGNC:23143])

HSP 1 Score: 108.612 bits (270), Expect = 2.733e-25
Identity = 53/152 (34.87%), Postives = 86/152 (56.58%), Query Frame = 1
Query:  325 ESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            ES       E  S P I +GL Y+   G+LS  VIKG++ +  +A    + Y+KL +    G ++S   T +   + +P + E F F +  FQ+  VTL++S Y K+++ + EMIGWI++G  +S E++L+HW  +    G +V RWH  L+
Sbjct:  365 ESTSSCQSLEHGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNTYVKLTLLNSMGQEMSKCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELNHWTEMKESKGQQVCRWHALLE 516          
BLAST of Synaptotagmin 16 vs. Ensembl Human
Match: SYT14 (synaptotagmin 14 [Source:HGNC Symbol;Acc:HGNC:23143])

HSP 1 Score: 108.612 bits (270), Expect = 3.220e-25
Identity = 53/152 (34.87%), Postives = 86/152 (56.58%), Query Frame = 1
Query:  325 ESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            ES       E  S P I +GL Y+   G+LS  VIKG++ +  +A    + Y+KL +    G ++S   T +   + +P + E F F +  FQ+  VTL++S Y K+++ + EMIGWI++G  +S E++L+HW  +    G +V RWH  L+
Sbjct:  403 ESTSSCQSLEHGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNTYVKLTLLNSMGQEMSKCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELNHWTEMKESKGQQVCRWHALLE 554          
BLAST of Synaptotagmin 16 vs. Ensembl Human
Match: SYT16 (synaptotagmin 16 [Source:HGNC Symbol;Acc:HGNC:23142])

HSP 1 Score: 106.301 bits (264), Expect = 3.183e-24
Identity = 48/138 (34.78%), Postives = 78/138 (56.52%), Query Frame = 1
Query:  367 PTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            P + VGL Y+   G+LSV +IKG++ +  +     D Y KL +    G ++S   T +   + +P + E F F +  FQ+  VTLM+S Y ++ + + EMIGWIA+G  +S E++  HW  +    G ++ RWH  L+
Sbjct:  507 PELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKLFLLNSVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISVYNRRTMKRKEMIGWIALGQNSSGEEEQDHWEEMKETKGQQICRWHTLLE 644          
BLAST of Synaptotagmin 16 vs. Ensembl Celegans
Match: snt-6 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:A0A0S4XQZ9])

HSP 1 Score: 66.6254 bits (161), Expect = 1.037e-12
Identity = 42/136 (30.88%), Postives = 68/136 (50.00%), Query Frame = 1
Query:  373 IQVGLRYHPNNGKLSVNVIKGNYIQSAEE--KIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKM--VTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKF 768
            I + L Y P +GK++V++IK   + + +     D Y+K+ +    G +L    T V  +   P FNE F F+IP  Q+ +  V L+++A +   +  NE IG + +G   S   Q  HW+  +N     V  WHK 
Sbjct:   60 IMISLCYLPTSGKITVSIIKARDLHAKDRTRHYDTYVKMWM-VQQGNKLEKRKTSVKPHTPSPIFNESFAFSIPVKQVLLAEVNLVLTAMEYDVIGSNEEIGHVIVGGLGSEHGQ-RHWSECVNHPEQPVAMWHKL 193          
BLAST of Synaptotagmin 16 vs. Ensembl Celegans
Match: snt-6 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:A0A0S4XQZ9])

HSP 1 Score: 66.6254 bits (161), Expect = 1.037e-12
Identity = 42/136 (30.88%), Postives = 68/136 (50.00%), Query Frame = 1
Query:  373 IQVGLRYHPNNGKLSVNVIKGNYIQSAEE--KIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKM--VTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKF 768
            I + L Y P +GK++V++IK   + + +     D Y+K+ +    G +L    T V  +   P FNE F F+IP  Q+ +  V L+++A +   +  NE IG + +G   S   Q  HW+  +N     V  WHK 
Sbjct:   60 IMISLCYLPTSGKITVSIIKARDLHAKDRTRHYDTYVKMWM-VQQGNKLEKRKTSVKPHTPSPIFNESFAFSIPVKQVLLAEVNLVLTAMEYDVIGSNEEIGHVIVGGLGSEHGQ-RHWSECVNHPEQPVAMWHKL 193          
BLAST of Synaptotagmin 16 vs. Ensembl Celegans
Match: snt-6 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:A0A0S4XQZ9])

HSP 1 Score: 67.3958 bits (163), Expect = 1.683e-12
Identity = 42/136 (30.88%), Postives = 68/136 (50.00%), Query Frame = 1
Query:  373 IQVGLRYHPNNGKLSVNVIKGNYIQSAEEK--IDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKM--VTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKF 768
            I + L Y P +GK++V++IK   + + +     D Y+K+ +    G +L    T V  +   P FNE F F+IP  Q+ +  V L+++A +   +  NE IG + +G   S   Q  HW+  +N     V  WHK 
Sbjct:  128 IMISLCYLPTSGKITVSIIKARDLHAKDRTRHYDTYVKMWM-VQQGNKLEKRKTSVKPHTPSPIFNESFAFSIPVKQVLLAEVNLVLTAMEYDVIGSNEEIGHVIVGGLGSEHGQ-RHWSECVNHPEQPVAMWHKL 261          
BLAST of Synaptotagmin 16 vs. Ensembl Celegans
Match: snt-6 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:A0A0S4XQZ9])

HSP 1 Score: 67.781 bits (164), Expect = 3.144e-12
Identity = 42/136 (30.88%), Postives = 68/136 (50.00%), Query Frame = 1
Query:  373 IQVGLRYHPNNGKLSVNVIKGNYIQSAEEK--IDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKM--VTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKF 768
            I + L Y P +GK++V++IK   + + +     D Y+K+ +    G +L    T V  +   P FNE F F+IP  Q+ +  V L+++A +   +  NE IG + +G   S   Q  HW+  +N     V  WHK 
Sbjct:  236 IMISLCYLPTSGKITVSIIKARDLHAKDRTRHYDTYVKMWM-VQQGNKLEKRKTSVKPHTPSPIFNESFAFSIPVKQVLLAEVNLVLTAMEYDVIGSNEEIGHVIVGGLGSEHGQ-RHWSECVNHPEQPVAMWHKL 369          
BLAST of Synaptotagmin 16 vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 61.6178 bits (148), Expect = 3.321e-10
Identity = 39/134 (29.10%), Postives = 66/134 (49.25%), Query Frame = 1
Query:  385 LRYHPNNGKLSVNVIKGNYIQSAEEK--IDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLKLE 780
            LRY P  GKL+V +++   ++  +     D Y+K+ V    G +L    T +    ++P +NE F F +P  QI+ V+LM++      L  N+ IG   +G  N +  +L HW  +L      + +WH    +E
Sbjct:  300 LRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKI-VLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKVSLMITVMDYDKLGSNDAIGRCLLGC-NGTGAELRHWMDMLASPRRPIAQWHTLGPVE 431          
BLAST of Synaptotagmin 16 vs. Ensembl Fly
Match: Syt14 (gene:FBgn0261086 transcript:FBtr0339551)

HSP 1 Score: 99.3673 bits (246), Expect = 3.189e-22
Identity = 49/152 (32.24%), Postives = 85/152 (55.92%), Query Frame = 1
Query:  316 ATKESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQSAE--EKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLN-ETGNEVVRWH 762
            A  ESA   +  +      + +GL Y+   G+LSV +IKG+  +S    +  D Y+K+++ +  G ++S   T +   + +P F E F F +  FQ+  VTLM+S Y K+++ +NEM+GW ++G  +S  ++++HW  V     G  + RWH
Sbjct:  430 ARSESAGSTSSMQHGGVSELLLGLSYNGVTGRLSVEIIKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQVALFQLNDVTLMISVYAKRHMKKNEMVGWFSLGLNSSGSEEVAHWADVCEMPKGEMLARWH 581          
BLAST of Synaptotagmin 16 vs. Ensembl Fly
Match: Syt14 (gene:FBgn0261086 transcript:FBtr0336485)

HSP 1 Score: 98.9821 bits (245), Expect = 3.720e-22
Identity = 49/152 (32.24%), Postives = 85/152 (55.92%), Query Frame = 1
Query:  316 ATKESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQSAE--EKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLN-ETGNEVVRWH 762
            A  ESA   +  +      + +GL Y+   G+LSV +IKG+  +S    +  D Y+K+++ +  G ++S   T +   + +P F E F F +  FQ+  VTLM+S Y K+++ +NEM+GW ++G  +S  ++++HW  V     G  + RWH
Sbjct:  430 ARSESAGSTSSMQHGGVSELLLGLSYNGVTGRLSVEIIKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQVALFQLNDVTLMISVYAKRHMKKNEMVGWFSLGLNSSGSEEVAHWADVCEMPKGEMLARWH 581          
BLAST of Synaptotagmin 16 vs. Ensembl Fly
Match: Syt14 (gene:FBgn0261086 transcript:FBtr0078957)

HSP 1 Score: 98.9821 bits (245), Expect = 3.720e-22
Identity = 49/152 (32.24%), Postives = 85/152 (55.92%), Query Frame = 1
Query:  316 ATKESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQSAE--EKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLN-ETGNEVVRWH 762
            A  ESA   +  +      + +GL Y+   G+LSV +IKG+  +S    +  D Y+K+++ +  G ++S   T +   + +P F E F F +  FQ+  VTLM+S Y K+++ +NEM+GW ++G  +S  ++++HW  V     G  + RWH
Sbjct:  430 ARSESAGSTSSMQHGGVSELLLGLSYNGVTGRLSVEIIKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQVALFQLNDVTLMISVYAKRHMKKNEMVGWFSLGLNSSGSEEVAHWADVCEMPKGEMLARWH 581          
BLAST of Synaptotagmin 16 vs. Ensembl Fly
Match: Syt4 (gene:FBgn0028400 transcript:FBtr0081578)

HSP 1 Score: 67.0106 bits (162), Expect = 8.833e-12
Identity = 44/174 (25.29%), Postives = 83/174 (47.70%), Query Frame = 1
Query:  271 PVT-VDVRKVEQFKLDATKESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQSAEEK--IDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQ-----IKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKF 768
            P+T +++  + +  L  +KE          +    + + L + P  G+L+V ++K   +   +     D Y+K+ +  + G +++   T V    + P FNE F F+IP  +     ++ V+L +       + +NE+IG + +G  NSS   L+HWN V N    ++  WHK 
Sbjct:  300 PLTSIEIGDISKEALSISKEIQPRSLKIRAQGRGELLISLCWQPAAGRLTVVLLKARNLPRMDVTGLADPYVKIYLLYN-GQRIAKKKTHVKKRTLSPVFNESFAFDIPAAEGAGASLEGVSLELMLLDWDRVTKNEVIGRLELGGPNSSSTALNHWNEVCNSPRRQIAEWHKL 472          
BLAST of Synaptotagmin 16 vs. Ensembl Fly
Match: Syt7 (gene:FBgn0039900 transcript:FBtr0089139)

HSP 1 Score: 62.3882 bits (150), Expect = 1.370e-10
Identity = 36/129 (27.91%), Postives = 68/129 (52.71%), Query Frame = 1
Query:  391 YHPNNGKLSVNVIKGNYIQSAE--EKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYN-SSEDQLSHWNRVLNETGNEVVRWHKF 768
            YHP+N  L++ +IK   +++ +   K D Y+K+ +      ++    T +    ++P FNE F FN+P  +I+  +L +      N+ +NE+IG I +   N S   +  HW  ++++    VV+WH+ 
Sbjct:  153 YHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDK-RVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECSLDVMVMDFDNIGRNELIGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRL 280          
BLAST of Synaptotagmin 16 vs. Ensembl Zebrafish
Match: syt14a (synaptotagmin XIVa [Source:ZFIN;Acc:ZDB-GENE-090313-200])

HSP 1 Score: 114.775 bits (286), Expect = 1.567e-27
Identity = 54/152 (35.53%), Postives = 89/152 (58.55%), Query Frame = 1
Query:  325 ESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            E+A     +   S P I +GL Y+   G+LSV VIKG++ +  +A +  + Y+KL +    G ++S   T V   + +P + E F F +  FQ+  VTL++S Y K+++ + EMIGWI++G  +S E++L+HW  +    G +V RWH  L+
Sbjct:  391 ETASSYPSAAQGSAPEILLGLVYNATTGRLSVEVIKGSHFKNLAANKPPNTYVKLTLLNSMGQEMSKCKTSVCRGQPNPTYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELTHWTEMKESKGQQVCRWHSLLE 542          
BLAST of Synaptotagmin 16 vs. Ensembl Zebrafish
Match: syt16 (synaptotagmin XVI [Source:ZFIN;Acc:ZDB-GENE-090313-210])

HSP 1 Score: 104.375 bits (259), Expect = 2.928e-26
Identity = 51/140 (36.43%), Postives = 84/140 (60.00%), Query Frame = 1
Query:  361 SDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGN-EVVRWHKFL 771
             +P + +GL Y+   G+LSV +IKG++ +  +     D + KL +    G ++S   T +  ++ +P F E F F +  FQ+  VTLM+S Y ++N+ + EMIGW+A+G  +S E++L HW   + E+GN +V RWH  L
Sbjct:   24 GNPELLLGLSYNATTGRLSVEIIKGSHFRNFAVNRPPDTFGKLTLLNSMGQEISRCKTSIRRSQPNPVFKETFVFQVALFQLSDVTLMVSIYNRRNMKRKEMIGWVALGQNSSGEEELLHWQD-MKESGNQQVCRWHTLL 162          
BLAST of Synaptotagmin 16 vs. Ensembl Zebrafish
Match: syt14a (synaptotagmin XIVa [Source:ZFIN;Acc:ZDB-GENE-090313-200])

HSP 1 Score: 105.916 bits (263), Expect = 1.621e-24
Identity = 56/171 (32.75%), Postives = 89/171 (52.05%), Query Frame = 1
Query:  325 ESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQS-AEEKI--------------------DCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            E+A     +   S P I +GL Y+   G+LSV VIKG++ ++ A  K                     D Y+KL +    G ++S   T V   + +P + E F F +  FQ+  VTL++S Y K+++ + EMIGWI++G  +S E++L+HW  +    G +V RWH  L+
Sbjct:  329 ETASSYPSAAQGSAPEILLGLVYNATTGRLSVEVIKGSHFKNLAANKPPNGLFCCLKHLIGGQVYIIRDTYVKLTLLNSMGQEMSKCKTSVCRGQPNPTYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELTHWTEMKESKGQQVCRWHSLLE 499          
BLAST of Synaptotagmin 16 vs. Ensembl Zebrafish
Match: syt14a (synaptotagmin XIVa [Source:ZFIN;Acc:ZDB-GENE-090313-200])

HSP 1 Score: 105.916 bits (263), Expect = 1.751e-24
Identity = 56/171 (32.75%), Postives = 89/171 (52.05%), Query Frame = 1
Query:  325 ESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQS-AEEKI--------------------DCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            E+A     +   S P I +GL Y+   G+LSV VIKG++ ++ A  K                     D Y+KL +    G ++S   T V   + +P + E F F +  FQ+  VTL++S Y K+++ + EMIGWI++G  +S E++L+HW  +    G +V RWH  L+
Sbjct:  389 ETASSYPSAAQGSAPEILLGLVYNATTGRLSVEVIKGSHFKNLAANKPPNGLFCCLKHLIGGQVYIIRDTYVKLTLLNSMGQEMSKCKTSVCRGQPNPTYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELTHWTEMKESKGQQVCRWHSLLE 559          
BLAST of Synaptotagmin 16 vs. Ensembl Zebrafish
Match: syt14a (synaptotagmin XIVa [Source:ZFIN;Acc:ZDB-GENE-090313-200])

HSP 1 Score: 105.916 bits (263), Expect = 1.869e-24
Identity = 56/171 (32.75%), Postives = 89/171 (52.05%), Query Frame = 1
Query:  325 ESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQS-AEEKI--------------------DCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            E+A     +   S P I +GL Y+   G+LSV VIKG++ ++ A  K                     D Y+KL +    G ++S   T V   + +P + E F F +  FQ+  VTL++S Y K+++ + EMIGWI++G  +S E++L+HW  +    G +V RWH  L+
Sbjct:  406 ETASSYPSAAQGSAPEILLGLVYNATTGRLSVEVIKGSHFKNLAANKPPNGLFCCLKHLIGGQVYIIRDTYVKLTLLNSMGQEMSKCKTSVCRGQPNPTYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELTHWTEMKESKGQQVCRWHSLLE 576          
BLAST of Synaptotagmin 16 vs. Ensembl Xenopus
Match: SYT14 (synaptotagmin 14 [Source:NCBI gene;Acc:100491102])

HSP 1 Score: 108.227 bits (269), Expect = 4.077e-25
Identity = 50/140 (35.71%), Postives = 83/140 (59.29%), Query Frame = 1
Query:  361 SDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            S P I +GL Y+   G+LS  VIKG++ +  SA    + Y+KL +    G ++S   T +   + +P + E F F +  FQ+  VTL++S Y K+++ + E+IGWI++G  +S ++QL+HW  +    G +V RWH  L+
Sbjct:  366 SVPEILIGLLYNATTGRLSAEVIKGSHFKNLSANRPPNTYVKLTLMNSMGQEMSKCKTSIRRGQSNPLYKETFIFQVALFQLSEVTLILSVYNKRSMKRKELIGWISLGLNSSGDEQLNHWTEMKESKGQQVCRWHTLLE 505          
BLAST of Synaptotagmin 16 vs. Ensembl Xenopus
Match: SYT14 (synaptotagmin 14 [Source:NCBI gene;Acc:100491102])

HSP 1 Score: 107.842 bits (268), Expect = 5.142e-25
Identity = 50/140 (35.71%), Postives = 83/140 (59.29%), Query Frame = 1
Query:  361 SDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            S P I +GL Y+   G+LS  VIKG++ +  SA    + Y+KL +    G ++S   T +   + +P + E F F +  FQ+  VTL++S Y K+++ + E+IGWI++G  +S ++QL+HW  +    G +V RWH  L+
Sbjct:  406 SVPEILIGLLYNATTGRLSAEVIKGSHFKNLSANRPPNTYVKLTLMNSMGQEMSKCKTSIRRGQSNPLYKETFIFQVALFQLSEVTLILSVYNKRSMKRKELIGWISLGLNSSGDEQLNHWTEMKESKGQQVCRWHTLLE 545          
BLAST of Synaptotagmin 16 vs. Ensembl Xenopus
Match: SYT14 (synaptotagmin 14 [Source:NCBI gene;Acc:100491102])

HSP 1 Score: 107.842 bits (268), Expect = 5.302e-25
Identity = 50/140 (35.71%), Postives = 83/140 (59.29%), Query Frame = 1
Query:  361 SDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            S P I +GL Y+   G+LS  VIKG++ +  SA    + Y+KL +    G ++S   T +   + +P + E F F +  FQ+  VTL++S Y K+++ + E+IGWI++G  +S ++QL+HW  +    G +V RWH  L+
Sbjct:  390 SVPEILIGLLYNATTGRLSAEVIKGSHFKNLSANRPPNTYVKLTLMNSMGQEMSKCKTSIRRGQSNPLYKETFIFQVALFQLSEVTLILSVYNKRSMKRKELIGWISLGLNSSGDEQLNHWTEMKESKGQQVCRWHTLLE 529          
BLAST of Synaptotagmin 16 vs. Ensembl Xenopus
Match: SYT14 (synaptotagmin 14 [Source:NCBI gene;Acc:100491102])

HSP 1 Score: 107.071 bits (266), Expect = 1.836e-24
Identity = 49/138 (35.51%), Postives = 82/138 (59.42%), Query Frame = 1
Query:  367 PTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            P I +GL Y+   G+LS  VIKG++ +  SA    + Y+KL +    G ++S   T +   + +P + E F F +  FQ+  VTL++S Y K+++ + E+IGWI++G  +S ++QL+HW  +    G +V RWH  L+
Sbjct:  655 PEILIGLLYNATTGRLSAEVIKGSHFKNLSANRPPNTYVKLTLMNSMGQEMSKCKTSIRRGQSNPLYKETFIFQVALFQLSEVTLILSVYNKRSMKRKELIGWISLGLNSSGDEQLNHWTEMKESKGQQVCRWHTLLE 792          
BLAST of Synaptotagmin 16 vs. Ensembl Xenopus
Match: tjp1 (tight junction protein 1 [Source:Xenbase;Acc:XB-GENE-490684])

HSP 1 Score: 78.1814 bits (191), Expect = 4.452e-17
Identity = 38/119 (31.93%), Postives = 67/119 (56.30%), Query Frame = 1
Query:  424 VIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            +IKG++ +  +     D Y KL +    G+++S   T V   + +P + E F F +  FQ+   TLM+S Y ++++ + EMIGWI++G  +S E++ +HW  +    G +V  WH  L+
Sbjct:    1 MIKGSHFRNLAINRPPDTYGKLSLLDSVGHEISRCKTSVRRGQPNPVYKETFIFQVALFQLTDFTLMISIYNRRSMKRKEMIGWISLGKNSSGEEEQNHWLEMKESKGQQVCHWHTLLE 119          
BLAST of Synaptotagmin 16 vs. Ensembl Mouse
Match: Syt14 (synaptotagmin XIV [Source:MGI Symbol;Acc:MGI:2444490])

HSP 1 Score: 105.531 bits (262), Expect = 3.169e-24
Identity = 49/140 (35.00%), Postives = 81/140 (57.86%), Query Frame = 1
Query:  361 SDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            S P I +GL Y+   G+LS  VIKG++ +  +A    + Y+KL +    G ++S   T     + +P + E F F +  FQ+  VTL++S Y ++++ + EMIGWI++G  +S E++L HW  +    G +V RWH  L+
Sbjct:  415 SVPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNTYVKLTLLNSMGQEMSKCKTSTRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNRRSMKRKEMIGWISLGLNSSGEEELRHWTAMKESKGQQVCRWHALLE 554          
BLAST of Synaptotagmin 16 vs. Ensembl Mouse
Match: Syt14 (synaptotagmin XIV [Source:MGI Symbol;Acc:MGI:2444490])

HSP 1 Score: 105.916 bits (263), Expect = 3.387e-24
Identity = 48/138 (34.78%), Postives = 80/138 (57.97%), Query Frame = 1
Query:  367 PTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            P I +GL Y+   G+LS  VIKG++ +  +A    + Y+KL +    G ++S   T     + +P + E F F +  FQ+  VTL++S Y ++++ + EMIGWI++G  +S E++L HW  +    G +V RWH  L+
Sbjct:  700 PEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNTYVKLTLLNSMGQEMSKCKTSTRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNRRSMKRKEMIGWISLGLNSSGEEELRHWTAMKESKGQQVCRWHALLE 837          
BLAST of Synaptotagmin 16 vs. Ensembl Mouse
Match: Syt14 (synaptotagmin XIV [Source:MGI Symbol;Acc:MGI:2444490])

HSP 1 Score: 96.2857 bits (238), Expect = 3.423e-21
Identity = 49/159 (30.82%), Postives = 80/159 (50.31%), Query Frame = 1
Query:  361 SDPTIQVGLRYHPNNGKLSVNVIKGNYIQSAEEKI---------------------DCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            S P I +GL Y+   G+LS  VIKG++ ++                          D Y+KL +    G ++S   T     + +P + E F F +  FQ+  VTL++S Y ++++ + EMIGWI++G  +S E++L HW  +    G +V RWH  L+
Sbjct:  415 SVPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNGLFCCLKHLIGGQVYIIRDTYVKLTLLNSMGQEMSKCKTSTRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNRRSMKRKEMIGWISLGLNSSGEEELRHWTAMKESKGQQVCRWHALLE 573          
BLAST of Synaptotagmin 16 vs. Ensembl Mouse
Match: Syt16 (synaptotagmin XVI [Source:MGI Symbol;Acc:MGI:2673872])

HSP 1 Score: 93.2041 bits (230), Expect = 4.555e-20
Identity = 48/138 (34.78%), Postives = 78/138 (56.52%), Query Frame = 1
Query:  367 PTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            P + VGL Y+   G+LSV +IKG++ +  +A    D Y KL +    G ++S   T +   + +P + E F F +  FQ+  VTLM+S Y ++ + + EMIGW+A+G  +S E++  HW  +    G +  RWH  L+
Sbjct:  501 PELLVGLSYNATTGRLSVEMIKGSHFRNLAANRAPDTYGKLFLLNCVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISIYSRRTMKRKEMIGWVALGQNSSGEEEQEHWEEMKESKGQQTCRWHTLLE 638          
BLAST of Synaptotagmin 16 vs. Ensembl Mouse
Match: Syt16 (synaptotagmin XVI [Source:MGI Symbol;Acc:MGI:2673872])

HSP 1 Score: 92.8189 bits (229), Expect = 4.691e-20
Identity = 48/138 (34.78%), Postives = 78/138 (56.52%), Query Frame = 1
Query:  367 PTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            P + VGL Y+   G+LSV +IKG++ +  +A    D Y KL +    G ++S   T +   + +P + E F F +  FQ+  VTLM+S Y ++ + + EMIGW+A+G  +S E++  HW  +    G +  RWH  L+
Sbjct:  411 PELLVGLSYNATTGRLSVEMIKGSHFRNLAANRAPDTYGKLFLLNCVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISIYSRRTMKRKEMIGWVALGQNSSGEEEQEHWEEMKESKGQQTCRWHTLLE 548          
BLAST of Synaptotagmin 16 vs. UniProt/SwissProt
Match: sp|Q8NB59|SYT14_HUMAN (Synaptotagmin-14 OS=Homo sapiens OX=9606 GN=SYT14 PE=1 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 1.546e-24
Identity = 53/152 (34.87%), Postives = 86/152 (56.58%), Query Frame = 1
Query:  325 ESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            ES       E  S P I +GL Y+   G+LS  VIKG++ +  +A    + Y+KL +    G ++S   T +   + +P + E F F +  FQ+  VTL++S Y K+++ + EMIGWI++G  +S E++L+HW  +    G +V RWH  L+
Sbjct:  403 ESTSSCQSLEHGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNTYVKLTLLNSMGQEMSKCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELNHWTEMKESKGQQVCRWHALLE 554          
BLAST of Synaptotagmin 16 vs. UniProt/SwissProt
Match: sp|Q17RD7|SYT16_HUMAN (Synaptotagmin-16 OS=Homo sapiens OX=9606 GN=SYT16 PE=1 SV=2)

HSP 1 Score: 106.301 bits (264), Expect = 1.529e-23
Identity = 48/138 (34.78%), Postives = 78/138 (56.52%), Query Frame = 1
Query:  367 PTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            P + VGL Y+   G+LSV +IKG++ +  +     D Y KL +    G ++S   T +   + +P + E F F +  FQ+  VTLM+S Y ++ + + EMIGWIA+G  +S E++  HW  +    G ++ RWH  L+
Sbjct:  507 PELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKLFLLNSVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISVYNRRTMKRKEMIGWIALGQNSSGEEEQDHWEEMKETKGQQICRWHTLLE 644          
BLAST of Synaptotagmin 16 vs. UniProt/SwissProt
Match: sp|Q7TN84|SYT14_MOUSE (Synaptotagmin-14 OS=Mus musculus OX=10090 GN=Syt14 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.217e-23
Identity = 49/140 (35.00%), Postives = 81/140 (57.86%), Query Frame = 1
Query:  361 SDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            S P I +GL Y+   G+LS  VIKG++ +  +A    + Y+KL +    G ++S   T     + +P + E F F +  FQ+  VTL++S Y ++++ + EMIGWI++G  +S E++L HW  +    G +V RWH  L+
Sbjct:  415 SVPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNTYVKLTLLNSMGQEMSKCKTSTRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNRRSMKRKEMIGWISLGLNSSGEEELRHWTAMKESKGQQVCRWHALLE 554          
BLAST of Synaptotagmin 16 vs. UniProt/SwissProt
Match: sp|Q58G82|SY14L_HUMAN (Putative synaptotagmin-14-like protein OS=Homo sapiens OX=9606 GN=SYT14P1 PE=5 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 9.945e-21
Identity = 49/140 (35.00%), Postives = 79/140 (56.43%), Query Frame = 1
Query:  361 SDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            S P I + L Y+  NG+LS  VIKG++++  +A    + Y+KL +   T  ++S     +     +P + E F F +  FQ+  VTLM+S Y K + ++ +MIGWI +G  NSS ++L+HW  +    G +V RW   L+
Sbjct:   49 SVPEILISLLYNATNGRLSAEVIKGSHLKNWAANRPPNTYVKLTLRKSTDQEMSKCKISIRRGRPNPVYKETFVFKVTLFQLSHVTLMLSVYNKSS-MRRKMIGWIYLG-LNSSGEELNHWTEMKESKGRQVRRWQALLE 186          
BLAST of Synaptotagmin 16 vs. UniProt/SwissProt
Match: sp|Q7TN83|SYT16_MOUSE (Synaptotagmin-16 OS=Mus musculus OX=10090 GN=Syt16 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 3.186e-19
Identity = 48/138 (34.78%), Postives = 78/138 (56.52%), Query Frame = 1
Query:  367 PTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            P + VGL Y+   G+LSV +IKG++ +  +A    D Y KL +    G ++S   T +   + +P + E F F +  FQ+  VTLM+S Y ++ + + EMIGW+A+G  +S E++  HW  +    G +  RWH  L+
Sbjct:  501 PELLVGLSYNATTGRLSVEMIKGSHFRNLAANRAPDTYGKLFLLNCVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISIYSRRTMKRKEMIGWVALGQNSSGEEEQEHWEEMKESKGQQTCRWHTLLE 638          
BLAST of Synaptotagmin 16 vs. TrEMBL
Match: A0A2G8LPX1 (Putative synaptotagmin-14 isoform X4 OS=Stichopus japonicus OX=307972 GN=BSL78_00740 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.625e-25
Identity = 52/138 (37.68%), Postives = 85/138 (61.59%), Query Frame = 1
Query:  367 PTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            P +  GL Y+   G+L+V++IKG++ +  +A    D Y+K+ V + +GY++S   + V   + +P F E F F I QFQ+  VTLM + Y KK + +   IGW ++G  N+SE++L+HWN + +  G +V RWH  L+
Sbjct:  312 PELLTGLTYNTTTGRLAVDIIKGSHFKQLAAGRAPDSYVKVAVMSSSGYEMSKSKSSVRRGQPNPTFKETFIFQIAQFQLNEVTLMFTVYNKKGIKRKNAIGWFSMGLSNTSEEELAHWNEMQSSNGQQVCRWHALLE 449          
BLAST of Synaptotagmin 16 vs. TrEMBL
Match: G3VBN6 (C2 domain-containing protein OS=Sarcophilus harrisii OX=9305 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.717e-25
Identity = 54/152 (35.53%), Postives = 86/152 (56.58%), Query Frame = 1
Query:  325 ESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            ES       E  S P I +GL Y+   G+LS  VIKG++ +  +A    + Y+KL +    G ++S   T +   + +P + E F F +  FQ+  VTL++S Y K+++ + EMIGWI++G  +S ED+L+HW  +    G +V RWH  L+
Sbjct:   14 ESTSSCQSLEHGSTPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNTYVKLTLLNSMGQEMSKCKTSIRRGQPNPIYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEDELNHWTEMKESKGQQVCRWHSLLE 165          
BLAST of Synaptotagmin 16 vs. TrEMBL
Match: A0A4W6DIX9 (Synaptotagmin XIVa OS=Lates calcarifer OX=8187 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 2.283e-25
Identity = 55/152 (36.18%), Postives = 89/152 (58.55%), Query Frame = 1
Query:  325 ESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            ESA         S P I VGL Y+   G+LSV VIKG + +  +A +  + Y+KL +    G+++S   T +   + +P + E F F +  FQ+  VTL++S Y K+++ + EMIGWI++G  +S E++L+HW ++    G +V RWH  L+
Sbjct:  242 ESASSFQSVSQTSTPEILVGLVYNATTGRLSVEVIKGIHFKNLAANKPPNTYVKLTLLNSMGHEMSKCKTSICRGQPNPTYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELTHWTQMKESKGQQVCRWHSLLE 393          
BLAST of Synaptotagmin 16 vs. TrEMBL
Match: A0A2P4SNG7 (C2 domain-containing protein OS=Bambusicola thoracicus OX=9083 GN=CIB84_010636 PE=4 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 3.942e-25
Identity = 52/140 (37.14%), Postives = 83/140 (59.29%), Query Frame = 1
Query:  361 SDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            S P I VGL Y+   G+LS  VIKG++ +  +A    + Y+KL +    G ++S   T +   + +P + E F F +  FQ+  VTL++S Y K+++ + EMIGWI++G  +S ED+L+HW  +    G +V RWH  L+
Sbjct:   22 SAPEILVGLLYNATTGRLSAEVIKGSHFKNLAANRPPNTYVKLTLLNSMGQEMSKCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEDELNHWTEMKESKGQQVCRWHTLLE 161          
BLAST of Synaptotagmin 16 vs. TrEMBL
Match: Q4SK27 (Chromosome 10 SCAF14571, whole genome shotgun sequence (Fragment) OS=Tetraodon nigroviridis OX=99883 GN=GSTENG00016925001 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 4.023e-25
Identity = 56/152 (36.84%), Postives = 89/152 (58.55%), Query Frame = 1
Query:  325 ESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            ESA         S P I VGL Y+   G+LSV +IKG + +  +A +  + Y+KL +    G+++S   T V   + +P F E F F +  FQ+  VTL++S Y K+++ + EMIGWI++G  +S E++L+HW ++    G +V RWH  L+
Sbjct:  406 ESASSFQSVGQSSTPEILVGLVYNATTGRLSVEIIKGIHFKNLAANKPPNTYVKLTLLNSMGHEMSKCKTSVCRGQPNPTFKETFVFQVALFQLSDVTLILSVYSKRSMKRKEMIGWISLGLNSSGEEELTHWTQMKESKGQQVCRWHSLLE 557          
BLAST of Synaptotagmin 16 vs. Ensembl Cavefish
Match: syt14a (synaptotagmin-14 [Source:NCBI gene;Acc:103044022])

HSP 1 Score: 113.62 bits (283), Expect = 5.051e-27
Identity = 52/152 (34.21%), Postives = 90/152 (59.21%), Query Frame = 1
Query:  325 ESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            ++A     +   S P I +GL Y+   G+LSV VIKG++ +  +A +  + Y+KL +    G ++S   T +   + +P + E F F +  FQ+  VTL++S Y K+++ + EMIGWI++G  +S E++L+HW ++    G +V RWH  L+
Sbjct:  455 DTASTFQSAAQGSAPEILLGLVYNATTGRLSVEVIKGSHFKNLAANKPPNTYVKLTLLNSMGQEMSKCKTSICRGQPNPTYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELTHWTQMKESKGQQVCRWHSLLE 606          
BLAST of Synaptotagmin 16 vs. Ensembl Cavefish
Match: syt14a (synaptotagmin-14 [Source:NCBI gene;Acc:103044022])

HSP 1 Score: 105.145 bits (261), Expect = 2.848e-24
Identity = 53/163 (32.52%), Postives = 89/163 (54.60%), Query Frame = 1
Query:  325 ESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQS-AEEKIDC------------YIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            ++A     +   S P I +GL Y+   G+LSV VIKG++ ++ A  K               Y+KL +    G ++S   T +   + +P + E F F +  FQ+  VTL++S Y K+++ + EMIGWI++G  +S E++L+HW ++    G +V RWH  L+
Sbjct:  393 DTASTFQSAAQGSAPEILLGLVYNATTGRLSVEVIKGSHFKNLAANKPPSKYFHNFTTDSYTYVKLTLLNSMGQEMSKCKTSICRGQPNPTYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELTHWTQMKESKGQQVCRWHSLLE 555          
BLAST of Synaptotagmin 16 vs. Ensembl Cavefish
Match: syt16 (synaptotagmin XVI [Source:ZFIN;Acc:ZDB-GENE-090313-210])

HSP 1 Score: 97.4413 bits (241), Expect = 1.266e-21
Identity = 50/148 (33.78%), Postives = 82/148 (55.41%), Query Frame = 1
Query:  367 PTIQVGLRYHPNNGKLSVNVIKGNYIQS-----------AEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGN-EVVRWHKFLK 774
            P + +GL Y+   G+LSV +IKG++ ++                + Y KL +    G ++S   T V   + +P F E F F +  FQ+  VTLM++ Y ++N+ + EMIGW+A+G  +S E++  HW   + E+GN +V RWH  L+
Sbjct:  390 PELLLGLAYNATTGRLSVEIIKGSHFRNLALNRPPGNNNYNNNNNTYGKLTLLNSMGQEISRCKTSVRRGQPNPVFKETFVFQVALFQLSDVTLMVAVYNRRNMKRKEMIGWLALGQNSSGEEEALHWQD-MKESGNQQVCRWHTLLE 536          
BLAST of Synaptotagmin 16 vs. Ensembl Cavefish
Match: syt14b (synaptotagmin-14-like [Source:NCBI gene;Acc:103040669])

HSP 1 Score: 84.3445 bits (207), Expect = 3.169e-17
Identity = 40/140 (28.57%), Postives = 81/140 (57.86%), Query Frame = 1
Query:  361 SDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEM-IGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFL 771
            S P + +GL Y+ + G+L+  VIKG++ +  + ++  + Y+KL++    G ++S   T V   + +P + E F F +  FQ+  VTL +  Y +++ ++    +GW+++G  +++E+Q  HW ++    G +V +WH  L
Sbjct:  575 STPELLLGLLYNSSTGRLAAEVIKGSHFKNSATDQPPNTYVKLVMLDSKGKEMSKCKTSVCRGQPNPTYKETFMFQVALFQLSEVTLQVMVYSRRSSMRRRERVGWVSLGLNSTTEEQEEHWAQMKEAEGRQVCQWHTLL 714          
BLAST of Synaptotagmin 16 vs. Ensembl Cavefish
Match: syt14b (synaptotagmin-14-like [Source:NCBI gene;Acc:103040669])

HSP 1 Score: 77.411 bits (189), Expect = 5.251e-15
Identity = 44/159 (27.67%), Postives = 83/159 (52.20%), Query Frame = 1
Query:  361 SDPTIQVGLRYHPNNGKLSVNVIKGNYIQ-SAEEKI--------------------DCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAY-KKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFL 771
            S P + +GL Y+ + G+L+  VIKG++ + SA ++                     D Y+KL++    G ++S   T V   + +P + E F F +  FQ+  VTL +  Y ++ ++ + E +GW+++G  +++E+Q  HW ++    G +V +WH  L
Sbjct:  575 STPELLLGLLYNSSTGRLAAEVIKGSHFKNSATDQPPSGLFCCIKRFIGGQLYIMRDTYVKLVMLDSKGKEMSKCKTSVCRGQPNPTYKETFMFQVALFQLSEVTLQVMVYSRRSSMRRRERVGWVSLGLNSTTEEQEEHWAQMKEAEGRQVCQWHTLL 733          
BLAST of Synaptotagmin 16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006908.1 (pep scaffold:Pmarinus_7.0:GL476344:649897:653668:1 gene:ENSPMAG00000006246.1 transcript:ENSPMAT00000006908.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 1.626e-10
Identity = 36/128 (28.12%), Postives = 63/128 (49.22%), Query Frame = 1
Query:  385 LRYHPNNGKLSVNVIKGN--YIQSAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWH 762
            LRY P+ GKL++ +++     +       D Y+K+ V  + G +L    T V    ++P FNE F F+IP   I+ + L+ S     +L +N+ IG + +G   +      HW+ +L      + +WH
Sbjct:   17 LRYIPSTGKLTIVILEATNLKVMDVSGASDPYVKIQV-MEGGIRLKKKKTTVKKKALNPYFNEAFSFDIPFENIEKIQLVFSVMDYDSLSRNDAIGKVYVGCGAAGAGH-RHWSDMLANPRRPITQWH 142          
BLAST of Synaptotagmin 16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000226.1 (pep scaffold:Pmarinus_7.0:GL478944:1404:4221:1 gene:ENSPMAG00000000205.1 transcript:ENSPMAT00000000226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 9.668e-9
Identity = 32/135 (23.70%), Postives = 62/135 (45.93%), Query Frame = 1
Query:  373 IQVGLRYHPNNGKLSVNVIKGNYIQSAE---EKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKF 768
            I V L YHP   +L+V V+K  ++   +     +D Y+K+ + +    + +   T V    ++P FNE F F +P+  +  + + ++        ++E+IG +A+G          HW  V      ++ +WH  
Sbjct:    8 ILVSLCYHPAASRLTVVVLKARHLPKTDIVGLSVDPYVKVNIYSGK-RRFAKKKTHVKKCTLNPVFNESFVFELPEEGLSDLAVELTVVDFDRTTKDEVIGRLALGPGT------EHWREVCENPRRQIAKWHPL 135          
BLAST of Synaptotagmin 16 vs. Ensembl Nematostella
Match: EDO41224 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4W3])

HSP 1 Score: 93.9745 bits (232), Expect = 1.011e-21
Identity = 47/141 (33.33%), Postives = 76/141 (53.90%), Query Frame = 1
Query:  367 PTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLKLEY 783
            P + V L Y    G+L+V V+K + ++  + +   D Y+K+ +    G QLS   T +  +   P FNE F F I +F++  V+LM S    K + + E++GW ++G  N+ ED+ SHW  ++   G  V RWH    +EY
Sbjct:  171 PELLVSLCYQSLTGRLTVEVLKASNLRNVAMQRAPDTYVKVSMFNSIGQQLSKSKTSIRRSMYDPEFNETFVFQIIEFELPSVSLMFSVVNIKKMRRKEIMGWFSMGRDNTGEDEESHWKEMIEGKGKAVKRWHVLSAVEY 311          
BLAST of Synaptotagmin 16 vs. Ensembl Nematostella
Match: EDO43704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXY7])

HSP 1 Score: 65.4698 bits (158), Expect = 4.309e-12
Identity = 36/134 (26.87%), Postives = 67/134 (50.00%), Query Frame = 1
Query:  373 IQVGLRYHPNNGKLSVNVIKGNYIQSAE--EKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKF 768
            + V L Y P N ++ V V+K N +++ +     D Y+K+ +      +L    T +      P +NE F F++P  +I+ +T + +      + QNE+IG + +G Y ++   L HW  ++N     V +WH+ 
Sbjct:  138 LLVSLMYQPTNNRIIVVVMKANKLKAMDLTGSSDPYVKMYIM-HKDRRLDKKKTTIKRRTRDPVWNESFIFDVPLDKIRDLTFVFNVMDYDRITQNELIGQVILG-YRTTGSSLRHWTEMMNNPRKPVAQWHRL 269          
BLAST of Synaptotagmin 16 vs. Ensembl Nematostella
Match: EDO31747 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX18])

HSP 1 Score: 63.1586 bits (152), Expect = 4.306e-11
Identity = 42/138 (30.43%), Postives = 69/138 (50.00%), Query Frame = 1
Query:  379 VGLRYHPNNGKLSVNVIKGNYI-------QSAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMS-AYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKF 768
            V L Y P   +LSV ++K   +        S    I  ++K+++  D G ++    T     E +P +NE   F+IP   +  V L++S A K  +  ++++IG + IGS +S E  LSHWN++L      +  WHK 
Sbjct:  221 VSLSYMPTAERLSVVIMKARNLNPPFSEWSSQPRDISPFVKVVLLFD-GQKVKKKKTSTRKQEKNPVYNESMLFDIPPHFLHRVILLISVADKPSDSRRSDIIGRVVIGSPSSGE-ALSHWNQMLVSPRRPIAAWHKL 356          
BLAST of Synaptotagmin 16 vs. Ensembl Nematostella
Match: EDO47875 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL62])

HSP 1 Score: 61.6178 bits (148), Expect = 7.807e-11
Identity = 43/172 (25.00%), Postives = 82/172 (47.67%), Query Frame = 1
Query:  271 PVTVDVRKVEQFKLDATKESAV---DITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYK-KKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKF 768
            PV VD++    +  +    + +   ++  SE E  P I + L Y    GKL + VIK   +   +  +  + Y+ + +    G  +S   T    + + P +NE F F++P+ ++  VT++++     K L +   +G +A+G   SSE++  HW  +       +VRWH+ 
Sbjct:  100 PVAVDLQPPGSYVPEGASGAIMYEGELAISE-EDRPEILISLEYRRLTGKLLLEVIKTRNLGMLTDSKAKEMYVSVKLIGSNGELISKGRTTPRRHMIDPEYNEMFLFHVPEQELNSVTVLIALTSVSKTLGRKLKVGQLALGQNYSSEEEYRHWFEMTRSKEKSIVRWHRI 270          
BLAST of Synaptotagmin 16 vs. Ensembl Nematostella
Match: EDO31639 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXC9])

HSP 1 Score: 61.2326 bits (147), Expect = 1.491e-10
Identity = 43/143 (30.07%), Postives = 69/143 (48.25%), Query Frame = 1
Query:  358 ESDPT----IQVGLRYHPNNGKLSVNVIKGNYIQSAEEKI-DCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFL 771
            +SDP     + V L + P +G+L V V K   +      + D YIKL +  D G +LS  +T+V    ++P +NEKF FN+   QI   T+ +     +    +  +G + +G YNS       W+ +L      + +WHK L
Sbjct:  158 KSDPVDLGEVCVSLCFRPFSGRLIVTVTKIQGLSKVACLVSDPYIKLSLYCD-GVRLSKANTRVKRRTLNPIYNEKFNFNVTADQISHTTVALRVANHRE-AHSPSLGLVLLG-YNSRGSGQEQWHGMLESPSRHIEKWHKIL 297          
BLAST of Synaptotagmin 16 vs. Ensembl Medaka
Match: syt14a (synaptotagmin 14 [Source:NCBI gene;Acc:101155984])

HSP 1 Score: 112.849 bits (281), Expect = 5.788e-27
Identity = 53/152 (34.87%), Postives = 88/152 (57.89%), Query Frame = 1
Query:  325 ESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            ESA         S P I VGL Y+   G+LSV +IKG + +  +A +  + Y+KL +    G+++S   T +   + +P + E F F +  FQ+  VTL++S Y K+++ + EMIGWI++G  +S E++L+HW ++    G +V  WH  L+
Sbjct:  389 ESASSFQSVSQASTPEILVGLVYNATTGRLSVEIIKGIHFKNLAANKPPNTYVKLTLLNSMGHEMSKCKTSICRGQPNPTYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELTHWTQMKESKGQQVCHWHSLLE 540          
BLAST of Synaptotagmin 16 vs. Ensembl Medaka
Match: ENSORLT00000022607.2 (synaptotagmin 16 [Source:NCBI gene;Acc:101173827])

HSP 1 Score: 92.8189 bits (229), Expect = 4.260e-20
Identity = 47/162 (29.01%), Postives = 85/162 (52.47%), Query Frame = 1
Query:  301 QFKLDATKESAV-DITDSEMESD-PTIQVGLRYHPNNGKLSVNVIKGNYIQ--SAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            Q  L A  +S +   T S      P + +GL Y+   G++SV +I+G+  +  +     D Y +L +    G +++   T V   + +P + E F F +  FQ+  VTL++S   ++++ + EM+GWIA+G  +S +++  HW  +    G +V RWH  L+
Sbjct:  397 QLSLSAASQSDIASFTQSLTHGGVPELLLGLSYNATTGRMSVELIRGSLFRNLAVSRPPDTYGRLTLLNSVGQEIARCKTSVRRGQPNPVYKETFVFQVALFQLSDVTLLVSINTRRSMKRKEMVGWIALGQNSSGKEEQLHWQVMKESRGQQVCRWHVLLE 558          
BLAST of Synaptotagmin 16 vs. Ensembl Medaka
Match: syt14b (synaptotagmin-14 [Source:NCBI gene;Acc:101173829])

HSP 1 Score: 85.1149 bits (209), Expect = 1.476e-17
Identity = 43/159 (27.04%), Postives = 77/159 (48.43%), Query Frame = 1
Query:  358 ESDPTIQVGLRYHPNNGKLSVNVIKGNYIQSAEEK---------------------IDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAY-KKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKF 768
            +S P I +GL Y+   G+LS  VI+GN+ ++A                         D Y+KL +    G ++S   T       +P + E F F +  FQ+  V+L++S + ++ ++   E +GW+++G  ++SE+QL HW  +    G ++  WH  
Sbjct:  361 DSLPEILLGLIYNSATGRLSAEVIQGNHFKTAASDKPISDLFCCVKHFVGGQLYIMRDTYVKLTMLDSKGKEMSKCKTATCRGHPNPTYKETFVFQVALFQLSEVSLVVSVFCRRSSMRPRERLGWVSLGLNSTSEEQLVHWTEMREAEGQQICHWHTL 519          
BLAST of Synaptotagmin 16 vs. Ensembl Medaka
Match: syt14b (synaptotagmin-14 [Source:NCBI gene;Acc:101173829])

HSP 1 Score: 84.3445 bits (207), Expect = 2.971e-17
Identity = 44/162 (27.16%), Postives = 78/162 (48.15%), Query Frame = 1
Query:  349 SEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQSAEEK---------------------IDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAY-KKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKF 768
            S  +S P I +GL Y+   G+LS  VI+GN+ ++A                         D Y+KL +    G ++S   T       +P + E F F +  FQ+  V+L++S + ++ ++   E +GW+++G  ++SE+QL HW  +    G ++  WH  
Sbjct:  570 STEDSLPEILLGLIYNSATGRLSAEVIQGNHFKTAASDKPISDLFCCVKHFVGGQLYIMRDTYVKLTMLDSKGKEMSKCKTATCRGHPNPTYKETFVFQVALFQLSEVSLVVSVFCRRSSMRPRERLGWVSLGLNSTSEEQLVHWTEMREAEGQQICHWHTL 731          
BLAST of Synaptotagmin 16 vs. Ensembl Medaka
Match: syt5a (synaptotagmin-1 [Source:NCBI gene;Acc:101166053])

HSP 1 Score: 74.3294 bits (181), Expect = 2.705e-14
Identity = 49/145 (33.79%), Postives = 73/145 (50.34%), Query Frame = 1
Query:  352 EMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQSAEEK--IDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLKLE 780
            E E    I + LRY P  GKL+VN+++   ++  +     D ++K+ V    G +L    T V  N ++P FNE F F IP  QI+ V ++++ Y    L  N+ IG   IG Y +S   L HW+ +L      V +WH  L  E
Sbjct:  243 EQEKLGDICISLRYVPTAGKLTVNIMEAKNLKKMDVGGLSDPFVKV-VLQHNGKRLKKKKTSVKQNTLNPYFNESFSFEIPFSQIQKVQVLITVYDYDKLGSNDPIGKCWIG-YGASGVGLRHWSDMLANPRRPVAQWHTLLPEE 385          
BLAST of Synaptotagmin 16 vs. Planmine SMEST
Match: SMESG000006557.1 (SMESG000006557.1)

HSP 1 Score: 508.064 bits (1307), Expect = 0.000e+0
Identity = 254/256 (99.22%), Postives = 255/256 (99.61%), Query Frame = 1
Query:   31 MSNIEKIPQPAVVFLLCITAXXXXXXXXXXYVKQIACCRYLPTPLCFSERSKAQNMDDSDEEIFDKFEDLMNCCHEKYENPVTVDVRKVEQFKLDATKESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQSAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLKLEYLKTII 798
            MSNIEKIPQPAVVFLLCITAVLFLMVLFLLYVKQIACCRYLPTPLCFSERSKAQNMDDSDEEIFDKFEDLMNCCHEKYENPVTVDVRKVEQFKLDATKESAVDITDSEMESDPTIQVGLRYHPNNGKLSVN+IKGNYIQSAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQ EMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLKLEYLKTII
Sbjct:    1 MSNIEKIPQPAVVFLLCITAVLFLMVLFLLYVKQIACCRYLPTPLCFSERSKAQNMDDSDEEIFDKFEDLMNCCHEKYENPVTVDVRKVEQFKLDATKESAVDITDSEMESDPTIQVGLRYHPNNGKLSVNIIKGNYIQSAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQKEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLKLEYLKTII 256          
BLAST of Synaptotagmin 16 vs. Planmine SMEST
Match: SMESG000051011.1 (SMESG000051011.1)

HSP 1 Score: 112.849 bits (281), Expect = 1.833e-27
Identity = 54/163 (33.13%), Postives = 96/163 (58.90%), Query Frame = 1
Query:  313 DATKESAVDITDSEMES-----------DPTIQVGLRYHPNNGKLSVNVIKGNYIQSAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKF 768
            D      + +T SE+ S           +P + +GL ++ N+G+L+V +I+G+ + S E+  D Y+KL + +  G +LSH  T +  N + P F E F F +  FQ+K VTLM+S   KK++ + E++GW+A+G  +S E++L+HW+ ++    +EV+  H+ 
Sbjct:  255 DVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSL-SKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 416          
BLAST of Synaptotagmin 16 vs. Planmine SMEST
Match: SMESG000051011.1 (SMESG000051011.1)

HSP 1 Score: 112.849 bits (281), Expect = 3.037e-27
Identity = 54/163 (33.13%), Postives = 96/163 (58.90%), Query Frame = 1
Query:  313 DATKESAVDITDSEMES-----------DPTIQVGLRYHPNNGKLSVNVIKGNYIQSAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKF 768
            D      + +T SE+ S           +P + +GL ++ N+G+L+V +I+G+ + S E+  D Y+KL + +  G +LSH  T +  N + P F E F F +  FQ+K VTLM+S   KK++ + E++GW+A+G  +S E++L+HW+ ++    +EV+  H+ 
Sbjct:  286 DVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSL-SKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 447          
BLAST of Synaptotagmin 16 vs. Planmine SMEST
Match: SMESG000051011.1 (SMESG000051011.1)

HSP 1 Score: 112.464 bits (280), Expect = 3.978e-27
Identity = 54/163 (33.13%), Postives = 96/163 (58.90%), Query Frame = 1
Query:  313 DATKESAVDITDSEMES-----------DPTIQVGLRYHPNNGKLSVNVIKGNYIQSAEEKIDCYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKF 768
            D      + +T SE+ S           +P + +GL ++ N+G+L+V +I+G+ + S E+  D Y+KL + +  G +LSH  T +  N + P F E F F +  FQ+K VTLM+S   KK++ + E++GW+A+G  +S E++L+HW+ ++    +EV+  H+ 
Sbjct:  301 DVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSL-SKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 462          
BLAST of Synaptotagmin 16 vs. Planmine SMEST
Match: SMESG000024484.1 (SMESG000024484.1)

HSP 1 Score: 111.309 bits (277), Expect = 6.705e-27
Identity = 60/196 (30.61%), Postives = 102/196 (52.04%), Query Frame = 1
Query:  280 VDVRKVEQFKLDATKESAVDITDS--------------EMESDPTIQV------------GLRYHPNNGKLSVNVIKGNYIQSAEEKID-----CYIKLLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAYKKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLK 774
            VD++K EQ++L   K + +   D               EM    TIQV            GL Y+P  G+L+V ++KGN  ++   + D      ++K+ +  +   +++   T++  N+ +P F EKF F +PQFQ+  +T++   Y +K+  + E+IGW +IG  NSS ++LSHW  +    G EV +WH+ L+
Sbjct:  223 VDLKKQEQYRLKMEKRAELKHLDKKNIEMGDDENNFAKEMSKKATIQVEETIGVEAEMLLGLAYNPITGRLTVEIVKGNAFKNPLSRNDDKLPNSFVKVTLSAENNQEITRSKTELRRNQANPLFKEKFMFQVPQFQLNEITIIFGVYHRKSAHRKEIIGWFSIGLNNSSPEELSHWKNMQQSNGEEVFQWHELLQ 418          
The following BLAST results are available for this feature:
BLAST of Synaptotagmin 16 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT161.075e-2534.78synaptotagmin 16 [Source:HGNC Symbol;Acc:HGNC:2314... [more]
SYT142.733e-2534.87synaptotagmin 14 [Source:HGNC Symbol;Acc:HGNC:2314... [more]
SYT142.733e-2534.87synaptotagmin 14 [Source:HGNC Symbol;Acc:HGNC:2314... [more]
SYT143.220e-2534.87synaptotagmin 14 [Source:HGNC Symbol;Acc:HGNC:2314... [more]
SYT163.183e-2434.78synaptotagmin 16 [Source:HGNC Symbol;Acc:HGNC:2314... [more]
back to top
BLAST of Synaptotagmin 16 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snt-61.037e-1230.88SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:A0A0S4... [more]
snt-61.037e-1230.88SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:A0A0S4... [more]
snt-61.683e-1230.88SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:A0A0S4... [more]
snt-63.144e-1230.88SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:A0A0S4... [more]
snt-13.321e-1029.10Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
back to top
BLAST of Synaptotagmin 16 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt143.189e-2232.24gene:FBgn0261086 transcript:FBtr0339551[more]
Syt143.720e-2232.24gene:FBgn0261086 transcript:FBtr0336485[more]
Syt143.720e-2232.24gene:FBgn0261086 transcript:FBtr0078957[more]
Syt48.833e-1225.29gene:FBgn0028400 transcript:FBtr0081578[more]
Syt71.370e-1027.91gene:FBgn0039900 transcript:FBtr0089139[more]
back to top
BLAST of Synaptotagmin 16 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt14a1.567e-2735.53synaptotagmin XIVa [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
syt162.928e-2636.43synaptotagmin XVI [Source:ZFIN;Acc:ZDB-GENE-090313... [more]
syt14a1.621e-2432.75synaptotagmin XIVa [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
syt14a1.751e-2432.75synaptotagmin XIVa [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
syt14a1.869e-2432.75synaptotagmin XIVa [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
back to top
BLAST of Synaptotagmin 16 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT144.077e-2535.71synaptotagmin 14 [Source:NCBI gene;Acc:100491102][more]
SYT145.142e-2535.71synaptotagmin 14 [Source:NCBI gene;Acc:100491102][more]
SYT145.302e-2535.71synaptotagmin 14 [Source:NCBI gene;Acc:100491102][more]
SYT141.836e-2435.51synaptotagmin 14 [Source:NCBI gene;Acc:100491102][more]
tjp14.452e-1731.93tight junction protein 1 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Synaptotagmin 16 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt143.169e-2435.00synaptotagmin XIV [Source:MGI Symbol;Acc:MGI:24444... [more]
Syt143.387e-2434.78synaptotagmin XIV [Source:MGI Symbol;Acc:MGI:24444... [more]
Syt143.423e-2130.82synaptotagmin XIV [Source:MGI Symbol;Acc:MGI:24444... [more]
Syt164.555e-2034.78synaptotagmin XVI [Source:MGI Symbol;Acc:MGI:26738... [more]
Syt164.691e-2034.78synaptotagmin XVI [Source:MGI Symbol;Acc:MGI:26738... [more]
back to top
BLAST of Synaptotagmin 16 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NB59|SYT14_HUMAN1.546e-2434.87Synaptotagmin-14 OS=Homo sapiens OX=9606 GN=SYT14 ... [more]
sp|Q17RD7|SYT16_HUMAN1.529e-2334.78Synaptotagmin-16 OS=Homo sapiens OX=9606 GN=SYT16 ... [more]
sp|Q7TN84|SYT14_MOUSE2.217e-2335.00Synaptotagmin-14 OS=Mus musculus OX=10090 GN=Syt14... [more]
sp|Q58G82|SY14L_HUMAN9.945e-2135.00Putative synaptotagmin-14-like protein OS=Homo sap... [more]
sp|Q7TN83|SYT16_MOUSE3.186e-1934.78Synaptotagmin-16 OS=Mus musculus OX=10090 GN=Syt16... [more]
back to top
BLAST of Synaptotagmin 16 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2G8LPX11.625e-2537.68Putative synaptotagmin-14 isoform X4 OS=Stichopus ... [more]
G3VBN61.717e-2535.53C2 domain-containing protein OS=Sarcophilus harris... [more]
A0A4W6DIX92.283e-2536.18Synaptotagmin XIVa OS=Lates calcarifer OX=8187 PE=... [more]
A0A2P4SNG73.942e-2537.14C2 domain-containing protein OS=Bambusicola thorac... [more]
Q4SK274.023e-2536.84Chromosome 10 SCAF14571, whole genome shotgun sequ... [more]
back to top
BLAST of Synaptotagmin 16 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt14a5.051e-2734.21synaptotagmin-14 [Source:NCBI gene;Acc:103044022][more]
syt14a2.848e-2432.52synaptotagmin-14 [Source:NCBI gene;Acc:103044022][more]
syt161.266e-2133.78synaptotagmin XVI [Source:ZFIN;Acc:ZDB-GENE-090313... [more]
syt14b3.169e-1728.57synaptotagmin-14-like [Source:NCBI gene;Acc:103040... [more]
syt14b5.251e-1527.67synaptotagmin-14-like [Source:NCBI gene;Acc:103040... [more]
back to top
BLAST of Synaptotagmin 16 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000006908.11.626e-1028.13pep scaffold:Pmarinus_7.0:GL476344:649897:653668:1... [more]
ENSPMAT00000000226.19.668e-923.70pep scaffold:Pmarinus_7.0:GL478944:1404:4221:1 gen... [more]
back to top
BLAST of Synaptotagmin 16 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptotagmin 16 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO412241.011e-2133.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437044.309e-1226.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317474.306e-1130.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478757.807e-1125.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316391.491e-1030.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synaptotagmin 16 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt14a5.788e-2734.87synaptotagmin 14 [Source:NCBI gene;Acc:101155984][more]
ENSORLT00000022607.24.260e-2029.01synaptotagmin 16 [Source:NCBI gene;Acc:101173827][more]
syt14b1.476e-1727.04synaptotagmin-14 [Source:NCBI gene;Acc:101173829][more]
syt14b2.971e-1727.16synaptotagmin-14 [Source:NCBI gene;Acc:101173829][more]
syt5a2.705e-1433.79synaptotagmin-1 [Source:NCBI gene;Acc:101166053][more]
back to top
BLAST of Synaptotagmin 16 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006557.10.000e+099.22SMESG000006557.1[more]
SMESG000051011.11.833e-2733.13SMESG000051011.1[more]
SMESG000051011.13.037e-2733.13SMESG000051011.1[more]
SMESG000051011.13.978e-2733.13SMESG000051011.1[more]
SMESG000024484.16.705e-2730.61SMESG000024484.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004667 ID=SMED30004667|Name=Synaptotagmin 16|organism=Schmidtea mediterranea sexual|type=transcript|length=1164bp
TAGCAAACAACTGTATGTTAAATTTATTTAATGAGCAATATAGAAAAAAT
TCCACAGCCTGCAGTTGTTTTTCTATTATGCATAACGGCAGTGCTATTTC
TGATGGTATTATTTCTTTTATATGTTAAACAAATCGCTTGCTGTCGGTAT
TTACCAACTCCATTATGTTTTTCGGAAAGATCCAAGGCTCAAAATATGGA
TGACAGTGATGAAGAAATCTTTGACAAATTTGAAGATTTGATGAATTGTT
GTCATGAAAAATATGAAAATCCAGTCACTGTTGATGTGAGAAAGGTAGAG
CAATTCAAACTGGACGCAACGAAAGAAAGTGCAGTCGATATAACTGATTC
TGAAATGGAGTCAGATCCAACAATTCAGGTTGGCCTGCGCTATCATCCAA
ACAATGGAAAGCTTTCGGTTAATGTAATTAAAGGAAATTATATTCAATCA
GCGGAAGAAAAGATCGATTGCTACATTAAATTATTGGTCTGCACTGATAC
CGGTTACCAATTGTCCCATGTTGATACTAAAGTCGTCGGAAATGAAATGC
ATCCTAATTTCAATGAGAAATTCGAATTTAACATTCCTCAGTTTCAGATT
AAAATGGTGACTCTCATGATGTCGGCTTATAAGAAAAAAAATTTGTTGCA
GAACGAAATGATTGGTTGGATCGCTATTGGAAGCTATAACAGTAGCGAAG
ACCAATTATCCCATTGGAACAGAGTACTGAATGAGACTGGAAATGAAGTC
GTCAGATGGCATAAATTTCTTAAATTGGAATATTTGAAAACTATTATTTG
AATCAAATATAAATTTCCCAATATTTCTGTTTGTATTTCAGCAAGAATAT
TTTTTTATTTGTTTGAATTTAGTCAAAAATTTGTAAAAAAAATAATTTGT
AATTTGATTGAATTTCAGTTGAATATATGTTGTAAAAGATTTTTGTAAAT
TTTGCACATTACTTTGTTTTTCGCTTGTTCTTCTTTTATACATTTTCCTG
GTGTTTTTTTTATTATTTAGAATTTTTGTGATAATTATTTATAATCTATT
ATGTTGTGGTTTTTGGGGTAAAAATTTGTCTATCCTCCACCACCGACGCT
TACAACAGCGGTTTATTGATAGTTTTTACTCTAATTTTGAAAATAATAAA
TTGTTAATTTTTTC
back to top

protein sequence of SMED30004667-orf-1

>SMED30004667-orf-1 ID=SMED30004667-orf-1|Name=SMED30004667-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=257bp
MSNIEKIPQPAVVFLLCITAVLFLMVLFLLYVKQIACCRYLPTPLCFSER
SKAQNMDDSDEEIFDKFEDLMNCCHEKYENPVTVDVRKVEQFKLDATKES
AVDITDSEMESDPTIQVGLRYHPNNGKLSVNVIKGNYIQSAEEKIDCYIK
LLVCTDTGYQLSHVDTKVVGNEMHPNFNEKFEFNIPQFQIKMVTLMMSAY
KKKNLLQNEMIGWIAIGSYNSSEDQLSHWNRVLNETGNEVVRWHKFLKLE
YLKTII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR000008C2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
GO:0019905syntaxin binding
GO:0030276clathrin binding
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006906vesicle fusion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainSMARTSM00239C2_3ccoord: 127..241
e-value: 0.0025
score: 27.0
IPR000008C2 domainPFAMPF00168C2coord: 126..229
e-value: 4.7E-8
score: 33.2
IPR000008C2 domainPROSITEPS50004C2coord: 127..215
score: 9.805
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 99..247
e-value: 2.1E-24
score: 87.7
NoneNo IPR availablePANTHERPTHR46129FAMILY NOT NAMEDcoord: 98..248
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 108..236
NoneNo IPR availableTMHMMTMhelixcoord: 10..32