ATP-dependent zinc metalloprotease FtsH

Overview
NameATP-dependent zinc metalloprotease FtsH
Smed IDSMED30004666
Length (bp)3214
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent zinc metalloprotease FtsH (SMED30004666) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent zinc metalloprotease FtsH (SMED30004666) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent zinc metalloprotease FtsH (SMED30004666) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent zinc metalloprotease FtsH (SMED30004666) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004666

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 32

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30004666h1SMcG0014206 SmedASXL_010833SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30004666h1SMcG0014207 SmedASXL_010833SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30004666h1SMcG0014206 SmedASXL_010833SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30004666h1SMcG0014207 SmedASXL_010833SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30004666h1SMcG0014206 Contig38668newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004666h1SMcG0014206 Contig38668uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30004666h1SMcG0014207 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004666h1SMcG0014207 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004666h1SMcG0014207 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004666h1SMcG0014207 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004666h1SMcG0014207 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004666h1SMcG0014207 Contig38668newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004666h1SMcG0014207 Contig38668uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30004666h1SMcG0014206 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004666h1SMcG0014206 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004666h1SMcG0014206 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004666h1SMcG0014206 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004666h1SMcG0014206 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004666h1SMcG0014206 Contig38668newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004666h1SMcG0014206 Contig38668uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30004666h1SMcG0014207 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004666h1SMcG0014207 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004666h1SMcG0014207 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004666h1SMcG0014207 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004666h1SMcG0014207 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004666h1SMcG0014207 Contig38668newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004666h1SMcG0014207 Contig38668uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30004666h1SMcG0014206 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004666h1SMcG0014206 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004666h1SMcG0014206 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004666h1SMcG0014206 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004666h1SMcG0014206 dd_Smed_v4_1250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Human
Match: AFG3L2 (AFG3 like matrix AAA peptidase subunit 2 [Source:HGNC Symbol;Acc:HGNC:315])

HSP 1 Score: 787.334 bits (2032), Expect = 0.000e+0
Identity = 392/642 (61.06%), Postives = 494/642 (76.95%), Query Frame = 1
Query:  265 GYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFL-YLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIK--TNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWN 2181
            G  +Y +       + W+ FVNN++ KG++  +E++NK + R+    TP K            P +   +   WFN+G+VDTFE  L  L+ ELGI  ++++P+VY  E   S L S++  +  I FL Y I R         +G  G F  G++T KV+ K EI  KF DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GAIL GPPGTGKTLLAKATAGEANVPF+++SGSEFLE+FVGVGP+RVRD+F+ AR +APCILF+DEIDA+GRKR   +FGG SEQE+TLNQLLVEMDGF T  NVV+LA TNR DILDPALLRPGRFDRQ+++  P+IKGRAS+FKVHL P+K  + ++K++ +RKLA+ TPGFSGADVANVCNEAALIAAR  ++ +  KHF+ AIERVI GLE+KTQVLQP+EKK VAYHEAGHAVAGW+L H DPLLKVSIIPRGK LGYAQY+P++ YL T++Q+LD M MTL GR SE+IFF +  +GAQDDL+KVT++AY+QIVQ G +EKVG +SFDLP+  D  + KPYSE TA+LID+E R+++  +Y+R + LL  KK  VEKVAL LL+KE ++K+D++ELLGPRPFAEK+TYE+FVEGTGS +E+T LPEGLKDWN
Sbjct:  156 GVMFYLLLKRSGREITWKDFVNNYLSKGVVDRLEVVNKRFVRVTF--TPGK-----------TPVDGQYV---WFNIGSVDTFERNLETLQQELGIEGENRVPVVYIAESDGSFLLSMLPTVLIIAFLLYTIRRGPAGIGRTGRGMGGLFSVGETTAKVL-KDEIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVSGSEFLEMFVGVGPARVRDLFALARKNAPCILFIDEIDAVGRKRGRGNFGGQSEQENTLNQLLVEMDGFNTTTNVVILAGTNRPDILDPALLRPGRFDRQIFIGPPDIKGRASIFKVHLRPLKLDSTLEKDKLARKLASLTPGFSGADVANVCNEAALIAARHLSDSINQKHFEQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQIVQFGMNEKVGQISFDLPRQGDMVLEKPYSEATARLIDDEVRILINDAYKRTVALLTEKKADVEKVALLLLEKEVLDKNDMVELLGPRPFAEKSTYEEFVEGTGSLDEDTSLPEGLKDWN 780          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Human
Match: SPG7 (SPG7 matrix AAA peptidase subunit, paraplegin [Source:HGNC Symbol;Acc:HGNC:11237])

HSP 1 Score: 501.13 bits (1289), Expect = 3.092e-164
Identity = 264/625 (42.24%), Postives = 394/625 (63.04%), Query Frame = 1
Query:  247 LIGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLK-TYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYK-TEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFG-GHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPR-GKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMS---KPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEK 2100
            L+ +++  +  N  ++   ++ W  FV+  + KG +  ++++ +        S   +    P   V   P    RL   Y   + N+D FE  LR  EDEL I  KD+IP+ YK T +  ++L S+      +  L+ ++R    +      +            V GK      F DVAG  EAK+E+ EFV++LK+P+++  LGAK+P+GA+L GPPG GKTLLAKA A EA VPFL+++G EF+E+  G+G +RVR +F +ARA APCI+++DEIDA+G+KRS    G  ++E+E TLNQLLVEMDG  T ++V+VLA+TNR DILD AL+RPGR DR V++ LP ++ R  +F+ HL  +K        S++LA  TPGFSGAD+AN+CNEAAL AARE    V   +F+ A+ERV+AG  +K+++L  +E+K+VA+HE+GHA+ GW L H + ++KVSI PR   +LG+AQ +PRD +L T++Q+ + M M L GRASE + F +  SGAQDDL+KVT+ AYS + Q G +  +G +SF  P++++  M    +P+S+   Q++D EARL+V ++Y    ++L+   D ++ +A  LL+KE I   D+  L+GP P   K
Sbjct:    9 LLVIAVVMSLLNALSTSGGSISWNDFVHEMLAKGEVQRVQVVPE--------SDVVEVYLHPGAVVFGRP----RLALMYRMQVANIDKFEEKLRAAEDELNIEAKDRIPVSYKRTGFFGNALYSVGMTAVGLAILWYVFRLAGMTGREGGFSAFNQLKMARFTIVDGKMGKGVSFKDVAGMHEAKLEVREFVDYLKSPERFLQLGAKVPKGALLLGPPGCGKTLLAKAVATEAQVPFLAMAGPEFVEVIGGLGAARVRSLFKEARARAPCIVYIDEIDAVGKKRSTTMSGFSNTEEEQTLNQLLVEMDGMGTTDHVIVLASTNRADILDGALMRPGRLDRHVFIDLPTLQERREIFEQHLKSLKLTQSSTFYSQRLAELTPGFSGADIANICNEAALHAAREGHTSVHTLNFEYAVERVLAGTAKKSKILSKEEQKVVAFHESGHALVGWMLEHTEAVMKVSITPRTNAALGFAQMLPRDQHLFTKEQLFERMCMALGGRASEALSFNEVTSGAQDDLRKVTRIAYSMVKQFGMAPGIGPISF--PEAQEGLMGIGRRPFSQGLQQMMDHEARLLVAKAYRHTEKVLQDNLDKLQALANALLEKEVINYEDIEALIGPPPHGPK 619          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Human
Match: SPG7 (SPG7 matrix AAA peptidase subunit, paraplegin [Source:HGNC Symbol;Acc:HGNC:11237])

HSP 1 Score: 499.204 bits (1284), Expect = 3.160e-163
Identity = 267/626 (42.65%), Postives = 400/626 (63.90%), Query Frame = 1
Query:  247 LIGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEII-NKEYARLILNSTPSKFSSMPDEEVLQAPANINRLK-TYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYK-TEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFG-GHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPR-GKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMS---KPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEK 2100
            L+ +++  +  N  ++   ++ W  FV+  + KG +  ++++   +   + L+         P   V   P    RL   Y   + N+D FE  LR  EDEL I  KD+IP+ YK T +  ++L S+      +  L+ ++R +   +    G   F    + T+ V GK      F DVAG  EAK+E+ EFV++LK+P+++  LGAK+P+GA+L GPPG GKTLLAKA A EA VPFL+++G EF+E+  G+G +RVR +F +ARA APCI+++DEIDA+G+KRS    G  ++E+E TLNQLLVEMDG  T ++V+VLA+TNR DILD AL+RPGR DR V++ LP ++ R  +F+ HL  +K        S++LA  TPGFSGAD+AN+CNEAAL AARE    V   +F+ A+ERV+AG  +K+++L  +E+K+VA+HE+GHA+ GW L H + ++KVSI PR   +LG+AQ +PRD +L T++Q+ + M M L GRASE + F +  SGAQDDL+KVT+ AYS + Q G +  +G +SF  P++++  M    +P+S+   Q++D EARL+V ++Y    ++L+   D ++ +A  LL+KE I   D+  L+GP P   K
Sbjct:   33 LLVIAVVMSLLNALSTSGGSISWNDFVHEMLAKGEVQRVQVVPESDVVEVYLH---------PGAVVFGRP----RLALMYRMQVANIDKFEEKLRAAEDELNIEAKDRIPVSYKRTGFFGNALYSVGMTAVGLAILWYVFR-LAGMTGREGGFSAFLKMARFTI-VDGKMGKGVSFKDVAGMHEAKLEVREFVDYLKSPERFLQLGAKVPKGALLLGPPGCGKTLLAKAVATEAQVPFLAMAGPEFVEVIGGLGAARVRSLFKEARARAPCIVYIDEIDAVGKKRSTTMSGFSNTEEEQTLNQLLVEMDGMGTTDHVIVLASTNRADILDGALMRPGRLDRHVFIDLPTLQERREIFEQHLKSLKLTQSSTFYSQRLAELTPGFSGADIANICNEAALHAAREGHTSVHTLNFEYAVERVLAGTAKKSKILSKEEQKVVAFHESGHALVGWMLEHTEAVMKVSITPRTNAALGFAQMLPRDQHLFTKEQLFERMCMALGGRASEALSFNEVTSGAQDDLRKVTRIAYSMVKQFGMAPGIGPISF--PEAQEGLMGIGRRPFSQGLQQMMDHEARLLVAKAYRHTEKVLQDNLDKLQALANALLEKEVINYEDIEALIGPPPHGPK 641          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Human
Match: SPG7 (SPG7 matrix AAA peptidase subunit, paraplegin [Source:HGNC Symbol;Acc:HGNC:11237])

HSP 1 Score: 499.975 bits (1286), Expect = 1.135e-162
Identity = 264/626 (42.17%), Postives = 395/626 (63.10%), Query Frame = 1
Query:  247 LIGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEII-NKEYARLILNSTPSKFSSMPDEEVLQAPANINRLK-TYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYK-TEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFG-GHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPR-GKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMS---KPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEK 2100
            L+ +++  +  N  ++   ++ W  FV+  + KG +  ++++   +   + L+         P   V   P    RL   Y   + N+D FE  LR  EDEL I  KD+IP+ YK T +  ++L S+      +  L+ ++R    +      +            V GK      F DVAG  EAK+E+ EFV++LK+P+++  LGAK+P+GA+L GPPG GKTLLAKA A EA VPFL+++G EF+E+  G+G +RVR +F +ARA APCI+++DEIDA+G+KRS    G  ++E+E TLNQLLVEMDG  T ++V+VLA+TNR DILD AL+RPGR DR V++ LP ++ R  +F+ HL  +K        S++LA  TPGFSGAD+AN+CNEAAL AARE    V   +F+ A+ERV+AG  +K+++L  +E+K+VA+HE+GHA+ GW L H + ++KVSI PR   +LG+AQ +PRD +L T++Q+ + M M L GRASE + F +  SGAQDDL+KVT+ AYS + Q G +  +G +SF  P++++  M    +P+S+   Q++D EARL+V ++Y    ++L+   D ++ +A  LL+KE I   D+  L+GP P   K
Sbjct:  101 LLVIAVVMSLLNALSTSGGSISWNDFVHEMLAKGEVQRVQVVPESDVVEVYLH---------PGAVVFGRP----RLALMYRMQVANIDKFEEKLRAAEDELNIEAKDRIPVSYKRTGFFGNALYSVGMTAVGLAILWYVFRLAGMTGREGGFSAFNQLKMARFTIVDGKMGKGVSFKDVAGMHEAKLEVREFVDYLKSPERFLQLGAKVPKGALLLGPPGCGKTLLAKAVATEAQVPFLAMAGPEFVEVIGGLGAARVRSLFKEARARAPCIVYIDEIDAVGKKRSTTMSGFSNTEEEQTLNQLLVEMDGMGTTDHVIVLASTNRADILDGALMRPGRLDRHVFIDLPTLQERREIFEQHLKSLKLTQSSTFYSQRLAELTPGFSGADIANICNEAALHAAREGHTSVHTLNFEYAVERVLAGTAKKSKILSKEEQKVVAFHESGHALVGWMLEHTEAVMKVSITPRTNAALGFAQMLPRDQHLFTKEQLFERMCMALGGRASEALSFNEVTSGAQDDLRKVTRIAYSMVKQFGMAPGIGPISF--PEAQEGLMGIGRRPFSQGLQQMMDHEARLLVAKAYRHTEKVLQDNLDKLQALANALLEKEVINYEDIEALIGPPPHGPK 711          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Human
Match: SPG7 (SPG7 matrix AAA peptidase subunit, paraplegin [Source:HGNC Symbol;Acc:HGNC:11237])

HSP 1 Score: 499.204 bits (1284), Expect = 8.494e-162
Identity = 264/626 (42.17%), Postives = 395/626 (63.10%), Query Frame = 1
Query:  247 LIGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEII-NKEYARLILNSTPSKFSSMPDEEVLQAPANINRLK-TYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYK-TEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFG-GHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPR-GKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMS---KPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEK 2100
            L+ +++  +  N  ++   ++ W  FV+  + KG +  ++++   +   + L+         P   V   P    RL   Y   + N+D FE  LR  EDEL I  KD+IP+ YK T +  ++L S+      +  L+ ++R    +      +            V GK      F DVAG  EAK+E+ EFV++LK+P+++  LGAK+P+GA+L GPPG GKTLLAKA A EA VPFL+++G EF+E+  G+G +RVR +F +ARA APCI+++DEIDA+G+KRS    G  ++E+E TLNQLLVEMDG  T ++V+VLA+TNR DILD AL+RPGR DR V++ LP ++ R  +F+ HL  +K        S++LA  TPGFSGAD+AN+CNEAAL AARE    V   +F+ A+ERV+AG  +K+++L  +E+K+VA+HE+GHA+ GW L H + ++KVSI PR   +LG+AQ +PRD +L T++Q+ + M M L GRASE + F +  SGAQDDL+KVT+ AYS + Q G +  +G +SF  P++++  M    +P+S+   Q++D EARL+V ++Y    ++L+   D ++ +A  LL+KE I   D+  L+GP P   K
Sbjct:  145 LLVIAVVMSLLNALSTSGGSISWNDFVHEMLAKGEVQRVQVVPESDVVEVYLH---------PGAVVFGRP----RLALMYRMQVANIDKFEEKLRAAEDELNIEAKDRIPVSYKRTGFFGNALYSVGMTAVGLAILWYVFRLAGMTGREGGFSAFNQLKMARFTIVDGKMGKGVSFKDVAGMHEAKLEVREFVDYLKSPERFLQLGAKVPKGALLLGPPGCGKTLLAKAVATEAQVPFLAMAGPEFVEVIGGLGAARVRSLFKEARARAPCIVYIDEIDAVGKKRSTTMSGFSNTEEEQTLNQLLVEMDGMGTTDHVIVLASTNRADILDGALMRPGRLDRHVFIDLPTLQERREIFEQHLKSLKLTQSSTFYSQRLAELTPGFSGADIANICNEAALHAAREGHTSVHTLNFEYAVERVLAGTAKKSKILSKEEQKVVAFHESGHALVGWMLEHTEAVMKVSITPRTNAALGFAQMLPRDQHLFTKEQLFERMCMALGGRASEALSFNEVTSGAQDDLRKVTRIAYSMVKQFGMAPGIGPISF--PEAQEGLMGIGRRPFSQGLQQMMDHEARLLVAKAYRHTEKVLQDNLDKLQALANALLEKEVINYEDIEALIGPPPHGPK 755          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Celegans
Match: spg-7 (AFG3-like protein spg-7 [Source:UniProtKB/Swiss-Prot;Acc:Q9N3T5])

HSP 1 Score: 739.184 bits (1907), Expect = 0.000e+0
Identity = 371/654 (56.73%), Postives = 489/654 (74.77%), Query Frame = 1
Query:  250 IGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFS-SLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXX--------QSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGG-HSEQESTLNQLLVEMDGFKTCEN-VVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDW 2178
            +G+ +    +  Y S Y  + W+ F ++F++ G++  +E+++K + R++  S+  K++                 +T +FN+G+VD+FE +L   +  L      QIP++YK+E++F   + +L+ + +P+ F Y IYR +K   +     R   G          QST +VI + +IK KF+DVAGCEEAKIEI+EFVNFLKNP +Y  LGAKIP+GAIL GPPGTGKTLLAKATAGEANVPF+++SGSEFLE+FVGVGP+RVRDMFS AR ++PCILF+DEIDA+GRKR GK   G HSEQE+TLNQLLVEMDGF T E+ V+V+AATNR+DILD ALLRPGRFDRQ+YV +P+IKGRAS+F+VHL P++T++DK   SRKLAA TPGFSGAD++NVCNEAALIAAR+    ++ KHF+ AIERV+AG+E+KTQVLQ +EKK VAYHEAGHA+AGWFL+H DPLLKVSIIPRGK LGYAQY+P++ YL ++DQ+LD M MTL GR +E+IFF +  +GAQDDLQKVT+ AYSQ+V+ G SEKVG LSF+ P   +    KPYSE TAQLID+E R +V  +  R  +LL  K+  +E+VALRLL+KE + + D++EL+G RPF EK TYE+ V GTG  +E  +LP+GL++W
Sbjct:  130 VGILLALYAFMDYQS-YREISWKEFYSDFLEAGLVERLEVVDKRWVRIV--SSSGKYAG----------------QTCYFNIGSVDSFERSLGAAQHHLQYDADRQIPVLYKSEFNFKREIPNLISVAFPLLFGYYIYRMLKGGGAAGGAGRAGGGGLGGMFGGFGQSTARVINREDIKVKFADVAGCEEAKIEIMEFVNFLKNPQQYKDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVSGSEFLEMFVGVGPARVRDMFSMARKNSPCILFIDEIDAVGRKRGGKGGMGGHSEQENTLNQLLVEMDGFTTDESSVIVIAATNRVDILDSALLRPGRFDRQIYVPVPDIKGRASIFRVHLGPLRTSLDKTVLSRKLAAHTPGFSGADISNVCNEAALIAARDANHEISNKHFEQAIERVVAGMEKKTQVLQKEEKKTVAYHEAGHAIAGWFLQHADPLLKVSIIPRGKGLGYAQYLPKEQYLYSKDQLLDRMCMTLGGRVAEEIFFGRITTGAQDDLQKVTQMAYSQVVKFGMSEKVGPLSFETPAPGEMAFDKPYSEATAQLIDQEVRDLVMNALRRTRDLLLEKRSDIERVALRLLEKEILNREDMIELVGKRPFVEKNTYEEMVSGTGGLDENVELPKGLENW 764          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Celegans
Match: ppgn-1 (ParaPleGiN AAA protease family; Paraplegin [Source:UniProtKB/TrEMBL;Acc:G5EDB6])

HSP 1 Score: 470.7 bits (1210), Expect = 7.479e-152
Identity = 266/625 (42.56%), Postives = 383/625 (61.28%), Query Frame = 1
Query:  301 ETLPWQSFVNNFVKKGMIAEIEII-NKEYARLIL------NSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTV---KVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQE------STLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPR-GKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVE 2124
            + + W  F+N  +  G +  I I+  K+ A L        NS   K +SM                 Y   + +V  FE  +R  E  LG+  +    I Y+   + +   +++ +   +   ++++R  K S + S           + +    V GK ++K KF DVAGC EAK+EI EFV++LKNP ++  LGAK+PRGA+L GPPG GKTLLAKA A E+ VPF+S++GSEF+E+  G+G SR+R +F +AR+ APCI+++DEIDAIGRKRS  +  G            TLNQLLVEMDG  +   VVVLA+TNR D+LD ALLRPGRFDR + + LP +  R  +F++++  IK +    E S++LAA TPGF+GAD+ NVCNE+A+ AA      VT K  + A++RV+AG E++++ L  +E+++VAYHEAGHA+ GW L H D LLKV+IIPR   +LG+AQY PRD +L ++D++ D M M L GR +E + F +  SGAQDDLQKVTK+AY+Q+   G S  VG LSF  P +  + + KPYS++ A   D+EA L+V ++ E   +L+K+  D +E +A  LL +E +   D+ +L+G   F +K    D VE
Sbjct:  136 DKISWSEFINELLPTGQVYRIIILPEKDVAYLYCYDTGAKNSRGEKLASM-----------------YRVGIPSVARFETEVRAAEAALGLPPEHWTQIEYRRSENVAQWFTIIVLGGLLLGGFVLFRKFKGSFNMSDMMSNMTKGKFTIIDPHSVEGKKQLKIKFKDVAGCSEAKVEIREFVDYLKNPGRFTKLGAKLPRGALLTGPPGCGKTLLAKALAAESTVPFISMNGSEFVEVIGGLGASRIRGLFKEARSRAPCIIYIDEIDAIGRKRSEGAGAGGGFGGGSGEEEQTLNQLLVEMDGMGSGNGVVVLASTNRADVLDKALLRPGRFDRHISIDLPTVLERKDMFELYMRKIKLDHAPQEYSQRLAALTPGFTGADIMNVCNESAIRAASNKCHVVTHKDMEYALDRVLAGSEKRSRSLVEEEREVVAYHEAGHALVGWMLEHTDALLKVTIIPRTSAALGFAQYSPRDKHLFSKDELFDRMCMMLGGRCAENLKFGRATSGAQDDLQKVTKSAYAQVKLYGMSSIVGPLSF--PNTEGFQI-KPYSKKFASTFDQEATLIVAKANEATTDLIKNNMDKLETIAQALLKREVLNYEDVKKLIGTPKFGDKHVI-DMVE 739          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Celegans
Match: ppgn-1 (ParaPleGiN AAA protease family; Paraplegin [Source:UniProtKB/TrEMBL;Acc:G5EDB6])

HSP 1 Score: 470.7 bits (1210), Expect = 7.479e-152
Identity = 266/625 (42.56%), Postives = 383/625 (61.28%), Query Frame = 1
Query:  301 ETLPWQSFVNNFVKKGMIAEIEII-NKEYARLIL------NSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTV---KVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQE------STLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPR-GKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVE 2124
            + + W  F+N  +  G +  I I+  K+ A L        NS   K +SM                 Y   + +V  FE  +R  E  LG+  +    I Y+   + +   +++ +   +   ++++R  K S + S           + +    V GK ++K KF DVAGC EAK+EI EFV++LKNP ++  LGAK+PRGA+L GPPG GKTLLAKA A E+ VPF+S++GSEF+E+  G+G SR+R +F +AR+ APCI+++DEIDAIGRKRS  +  G            TLNQLLVEMDG  +   VVVLA+TNR D+LD ALLRPGRFDR + + LP +  R  +F++++  IK +    E S++LAA TPGF+GAD+ NVCNE+A+ AA      VT K  + A++RV+AG E++++ L  +E+++VAYHEAGHA+ GW L H D LLKV+IIPR   +LG+AQY PRD +L ++D++ D M M L GR +E + F +  SGAQDDLQKVTK+AY+Q+   G S  VG LSF  P +  + + KPYS++ A   D+EA L+V ++ E   +L+K+  D +E +A  LL +E +   D+ +L+G   F +K    D VE
Sbjct:  136 DKISWSEFINELLPTGQVYRIIILPEKDVAYLYCYDTGAKNSRGEKLASM-----------------YRVGIPSVARFETEVRAAEAALGLPPEHWTQIEYRRSENVAQWFTIIVLGGLLLGGFVLFRKFKGSFNMSDMMSNMTKGKFTIIDPHSVEGKKQLKIKFKDVAGCSEAKVEIREFVDYLKNPGRFTKLGAKLPRGALLTGPPGCGKTLLAKALAAESTVPFISMNGSEFVEVIGGLGASRIRGLFKEARSRAPCIIYIDEIDAIGRKRSEGAGAGGGFGGGSGEEEQTLNQLLVEMDGMGSGNGVVVLASTNRADVLDKALLRPGRFDRHISIDLPTVLERKDMFELYMRKIKLDHAPQEYSQRLAALTPGFTGADIMNVCNESAIRAASNKCHVVTHKDMEYALDRVLAGSEKRSRSLVEEEREVVAYHEAGHALVGWMLEHTDALLKVTIIPRTSAALGFAQYSPRDKHLFSKDELFDRMCMMLGGRCAENLKFGRATSGAQDDLQKVTKSAYAQVKLYGMSSIVGPLSF--PNTEGFQI-KPYSKKFASTFDQEATLIVAKANEATTDLIKNNMDKLETIAQALLKREVLNYEDVKKLIGTPKFGDKHVI-DMVE 739          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Celegans
Match: ymel-1 (ATP-dependent zinc metalloprotease YME1 homolog [Source:UniProtKB/Swiss-Prot;Acc:P54813])

HSP 1 Score: 363.614 bits (932), Expect = 1.384e-111
Identity = 202/469 (43.07%), Postives = 297/469 (63.33%), Query Frame = 1
Query:  751 EIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPI--KTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEK--KIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMP-RDVYLMTQDQMLDSMGMTLAGRASEQIFF--EKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSK--PYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLG------PRPFAEKTTYE 2112
            +++  F DV G +EAK+E+ E V++LK+P+KY+ LG ++P+G +L GPPGTGKTLLA+A AGEA VPF   +GSEF E+ VG G  RVRD+F +A+A APCI+F+DEID++G KR   S   ++ Q  T+NQLL EMDGF   E ++V+AATNR+D LD ALLRPGRFD +V V  P++ GR  +F  +L+ I     +D     + LA  + GF+GAD+ N+ N+AAL AA +NA  VT  + D A +RV+ G   +T    PDE+  +  AYHEAGH +   + +   PL KV+IIPRG+SLG+   +P +D Y +T+ QML ++ + + GR +E++ F  +K  +GA DDL K T+ A   +   G S+KVG   F   Q  +  + K    + QTA+LID E   ++++SY+R   +L++KK   + +A  LL+ E +   ++  ++       P P A K + E
Sbjct:  242 DVQVTFDDVRGMDEAKLEVEEIVDYLKDPEKYSRLGGRLPKGVLLVGPPGTGKTLLARAIAGEAQVPFFHTAGSEFDEVLVGQGARRVRDLFDKAKARAPCIIFIDEIDSVGSKRVSNSIHPYANQ--TINQLLSEMDGFTRNEGIIVIAATNRVDDLDKALLRPGRFDVRVTVPKPDLAGRVDIFNFYLSKIVHSGGID----PKVLAKGSTGFTGADIENMVNQAALKAATDNAVEVTMAYLDEARDRVLMG-PARTGGRIPDEEANRNTAYHEAGHTLVSLYTKDATPLHKVTIIPRGQSLGHTAMLPEKDSYQLTKAQMLATLDVMMGGRVAEELIFGDDKVTTGAADDLSKATQLAVQMVKVFGMSDKVGLRDF-TAQDNESALVKVSDLAPQTAELIDAEINRVLQESYKRAKVILETKKKEHQLLAEALLEYETLSADEVKRVISGQKIKRPTPAAVKKSNE 702          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Celegans
Match: ymel-1 (ATP-dependent zinc metalloprotease YME1 homolog [Source:UniProtKB/Swiss-Prot;Acc:P54813])

HSP 1 Score: 363.614 bits (932), Expect = 1.384e-111
Identity = 202/469 (43.07%), Postives = 297/469 (63.33%), Query Frame = 1
Query:  751 EIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPI--KTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEK--KIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMP-RDVYLMTQDQMLDSMGMTLAGRASEQIFF--EKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSK--PYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLG------PRPFAEKTTYE 2112
            +++  F DV G +EAK+E+ E V++LK+P+KY+ LG ++P+G +L GPPGTGKTLLA+A AGEA VPF   +GSEF E+ VG G  RVRD+F +A+A APCI+F+DEID++G KR   S   ++ Q  T+NQLL EMDGF   E ++V+AATNR+D LD ALLRPGRFD +V V  P++ GR  +F  +L+ I     +D     + LA  + GF+GAD+ N+ N+AAL AA +NA  VT  + D A +RV+ G   +T    PDE+  +  AYHEAGH +   + +   PL KV+IIPRG+SLG+   +P +D Y +T+ QML ++ + + GR +E++ F  +K  +GA DDL K T+ A   +   G S+KVG   F   Q  +  + K    + QTA+LID E   ++++SY+R   +L++KK   + +A  LL+ E +   ++  ++       P P A K + E
Sbjct:  242 DVQVTFDDVRGMDEAKLEVEEIVDYLKDPEKYSRLGGRLPKGVLLVGPPGTGKTLLARAIAGEAQVPFFHTAGSEFDEVLVGQGARRVRDLFDKAKARAPCIIFIDEIDSVGSKRVSNSIHPYANQ--TINQLLSEMDGFTRNEGIIVIAATNRVDDLDKALLRPGRFDVRVTVPKPDLAGRVDIFNFYLSKIVHSGGID----PKVLAKGSTGFTGADIENMVNQAALKAATDNAVEVTMAYLDEARDRVLMG-PARTGGRIPDEEANRNTAYHEAGHTLVSLYTKDATPLHKVTIIPRGQSLGHTAMLPEKDSYQLTKAQMLATLDVMMGGRVAEELIFGDDKVTTGAADDLSKATQLAVQMVKVFGMSDKVGLRDF-TAQDNESALVKVSDLAPQTAELIDAEINRVLQESYKRAKVILETKKKEHQLLAEALLEYETLSADEVKRVISGQKIKRPTPAAVKKSNE 702          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Fly
Match: CG6512 (gene:FBgn0036702 transcript:FBtr0075252)

HSP 1 Score: 798.89 bits (2062), Expect = 0.000e+0
Identity = 394/679 (58.03%), Postives = 502/679 (73.93%), Query Frame = 1
Query:  187 NSRPGGPLDPR----KKENIVGVLLIGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFL-YLIYRS--MKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKEVPKPE 2202
            NS  G PL        +E  + +  IG  +    +  +   Y+ + W+ FVN+++ KG++ ++E++NK++ R+ L    +  S +                  WFN+G+VD+FE  L   + E G    + +P++Y+ E   +SL+ L+  +  IGFL Y++ +S  M     G KG   F G  QST K+    EI   F DVAGCEEAKIEI+EFVNFLKNP +Y  LGAKIP+GA+L GPPGTGKTLLAKATAGEANVPF+++SGSEFLE+FVGVGPSRVRDMF+ AR HAPCILF+DEIDA+GRKR GK+FGGHSEQE+TLNQLLVEMDGF T  NVVVLAATNR+DILD AL+RPGRFDRQ+YV  P+IKGRAS+FKVHL  +KT++DKNE SRK+AA TPGF+GAD+ANVCNEAALIAAR++ + +  KHF+ AIERVIAG+E+KT VL P+EK+ VA+HEAGHAVAGWFL H DPLLKVSIIPRGK LGYAQY+P+D YL++++Q+ D M MTL GR +E++FF +  +GAQDDL+K+T  AYSQ+V+ G +EKVG +SFD+ Q+ D   SKPYSE TAQLID E R ++K ++E    LL   K+ V+KVA RLL  E + + D++ELLGPRPF EK+TYE+FVEGTGSFEE+T LPEGLK WNKE  + E
Sbjct:   15 NSLGGRPLGENGGGGDRERWILLGAIGAVVLVGSFAFFEMGYKEISWKEFVNSYLSKGVVEKLEVVNKKWVRVRLQQNSNSGSGV-----------------LWFNIGSVDSFERNLEAAQTEQGTESINFVPVIYRNEVEAASLTGLLPTLLIIGFLVYMMRKSADMMGGGRGRKGGGLFGGVMQSTAKLTNPNEIGVGFKDVAGCEEAKIEIMEFVNFLKNPQQYIDLGAKIPKGAMLTGPPGTGKTLLAKATAGEANVPFITVSGSEFLEMFVGVGPSRVRDMFAMARKHAPCILFIDEIDAVGRKRGGKTFGGHSEQENTLNQLLVEMDGFNTTTNVVVLAATNRVDILDKALMRPGRFDRQIYVPAPDIKGRASIFKVHLGNLKTSLDKNELSRKMAALTPGFTGADIANVCNEAALIAARDSKDSIVLKHFEQAIERVIAGMEKKTNVLAPEEKRTVAHHEAGHAVAGWFLEHADPLLKVSIIPRGKGLGYAQYLPKDHYLLSKEQLFDRMCMTLGGRVAEELFFNRITTGAQDDLKKITDIAYSQVVRFGMNEKVGQVSFDVGQAGDPVFSKPYSEDTAQLIDNEVRSIIKCAHEATTSLLTKHKENVQKVAERLLQNEVLSRDDMIELLGPRPFKEKSTYEEFVEGTGSFEEDTTLPEGLKSWNKEKERTE 676          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Fly
Match: CG6512 (gene:FBgn0036702 transcript:FBtr0075251)

HSP 1 Score: 798.505 bits (2061), Expect = 0.000e+0
Identity = 388/654 (59.33%), Postives = 493/654 (75.38%), Query Frame = 1
Query:  250 IGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFL-YLIYRS--MKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKEVPKPE 2202
            IG  +    +  +   Y+ + W+ FVN+++ KG++ ++E++NK++ R+ L    +  S +                  WFN+G+VD+FE  L   + E G    + +P++Y+ E   +SL+ L+  +  IGFL Y++ +S  M     G KG   F G  QST K+    EI   F DVAGCEEAKIEI+EFVNFLKNP +Y  LGAKIP+GA+L GPPGTGKTLLAKATAGEANVPF+++SGSEFLE+FVGVGPSRVRDMF+ AR HAPCILF+DEIDA+GRKR GK+FGGHSEQE+TLNQLLVEMDGF T  NVVVLAATNR+DILD AL+RPGRFDRQ+YV  P+IKGRAS+FKVHL  +KT++DKNE SRK+AA TPGF+GAD+ANVCNEAALIAAR++ + +  KHF+ AIERVIAG+E+KT VL P+EK+ VA+HEAGHAVAGWFL H DPLLKVSIIPRGK LGYAQY+P+D YL++++Q+ D M MTL GR +E++FF +  +GAQDDL+K+T  AYSQ+V+ G +EKVG +SFD+ Q+ D   SKPYSE TAQLID E R ++K ++E    LL   K+ V+KVA RLL  E + + D++ELLGPRPF EK+TYE+FVEGTGSFEE+T LPEGLK WNKE  + E
Sbjct:  169 IGAVVLVGSFAFFEMGYKEISWKEFVNSYLSKGVVEKLEVVNKKWVRVRLQQNSNSGSGV-----------------LWFNIGSVDSFERNLEAAQTEQGTESINFVPVIYRNEVEAASLTGLLPTLLIIGFLVYMMRKSADMMGGGRGRKGGGLFGGVMQSTAKLTNPNEIGVGFKDVAGCEEAKIEIMEFVNFLKNPQQYIDLGAKIPKGAMLTGPPGTGKTLLAKATAGEANVPFITVSGSEFLEMFVGVGPSRVRDMFAMARKHAPCILFIDEIDAVGRKRGGKTFGGHSEQENTLNQLLVEMDGFNTTTNVVVLAATNRVDILDKALMRPGRFDRQIYVPAPDIKGRASIFKVHLGNLKTSLDKNELSRKMAALTPGFTGADIANVCNEAALIAARDSKDSIVLKHFEQAIERVIAGMEKKTNVLAPEEKRTVAHHEAGHAVAGWFLEHADPLLKVSIIPRGKGLGYAQYLPKDHYLLSKEQLFDRMCMTLGGRVAEELFFNRITTGAQDDLKKITDIAYSQVVRFGMNEKVGQVSFDVGQAGDPVFSKPYSEDTAQLIDNEVRSIIKCAHEATTSLLTKHKENVQKVAERLLQNEVLSRDDMIELLGPRPFKEKSTYEEFVEGTGSFEEDTTLPEGLKSWNKEKERTE 805          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Fly
Match: Spg7 (gene:FBgn0024992 transcript:FBtr0070502)

HSP 1 Score: 456.062 bits (1172), Expect = 3.178e-145
Identity = 255/610 (41.80%), Postives = 372/610 (60.98%), Query Frame = 1
Query:  313 WQSFVNNFVKKGMIAEIEII-NKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDT--FENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVI----GKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSF---GGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGK-SLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHL------SFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPF 2091
            W  FV++ +  G + E+ I  + E   +IL+          +  V++      ++ +  F++   D   FE  LR +E  LGI  KD +P+ Y  +    +   ++ ++     L  I   MKS  S                 V     G+G +   F DVAG  EAK E+ EFV++LK+P+KY  LGAK+PRGA+L GPPG GKTLLAKA A EA VPFLS++GSEF+E+  G+G +RVRD+F + +  APCI+++DEIDAIGR+RSG      G   E E TLNQLLVEMDG  T E V++LA+TNR DILD ALLRPGRFDR + + LP +  R  +F+ HL+ +K        S++LA  TPGFSGAD+ANVCNEAAL AAR     V+ K+ + A+ER++ G E+++  L   E+K++AYHE+GHA+ GW L + D LLKV+I+PR   +LG+AQY P + +L +++++ D M M L GRA+E + F +  +GAQ+DL+KVTK AYSQI + G ++ +G +        +   +      KP+S     +ID EAR +V  +Y+    +L + +D +EK+A  LL+KE ++   +++L+GP P+
Sbjct:  203 WNEFVHHMLAVGEVKELIIRPDMEMVTIILH----------EGAVIKG----RKVSSTIFHMAVADANKFEEKLRDVEKRLGI--KDGVPVTY--DRQTDTTGRILMLLLVCALLMSIATRMKSIKSPLSMDSFNQMGRAKFTLVDPFDGGRGVL---FRDVAGLSEAKQEVKEFVDYLKSPEKYQRLGAKVPRGALLLGPPGCGKTLLAKAVATEAQVPFLSMNGSEFIEMIGGLGAARVRDLFKEGKKRAPCIIYIDEIDAIGRQRSGTESMGQGSSGESEQTLNQLLVEMDGMATKEGVLMLASTNRADILDKALLRPGRFDRHILIDLPTLAERKEIFEKHLSSVKLESPPTTFSQRLARLTPGFSGADIANVCNEAALHAARNTQMEVSSKNLEYAVERLVGGTEKRSHALSLAERKVIAYHESGHALVGWMLPNSDILLKVTIVPRTSLALGFAQYTPSEQHLYSKEELFDKMCMALGGRAAENLVFNRITTGAQNDLEKVTKIAYSQIKKFGMNDTLGPIYVRDADETEGGGAMGSGGKKPFSRAMESMIDNEARHVVASAYQTTEGILTTHRDKLEKLAEALLEKETLDYDQVVQLIGPPPY 791          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Fly
Match: Spg7 (gene:FBgn0024992 transcript:FBtr0345716)

HSP 1 Score: 456.062 bits (1172), Expect = 3.178e-145
Identity = 255/610 (41.80%), Postives = 372/610 (60.98%), Query Frame = 1
Query:  313 WQSFVNNFVKKGMIAEIEII-NKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDT--FENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVI----GKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSF---GGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGK-SLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHL------SFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPF 2091
            W  FV++ +  G + E+ I  + E   +IL+          +  V++      ++ +  F++   D   FE  LR +E  LGI  KD +P+ Y  +    +   ++ ++     L  I   MKS  S                 V     G+G +   F DVAG  EAK E+ EFV++LK+P+KY  LGAK+PRGA+L GPPG GKTLLAKA A EA VPFLS++GSEF+E+  G+G +RVRD+F + +  APCI+++DEIDAIGR+RSG      G   E E TLNQLLVEMDG  T E V++LA+TNR DILD ALLRPGRFDR + + LP +  R  +F+ HL+ +K        S++LA  TPGFSGAD+ANVCNEAAL AAR     V+ K+ + A+ER++ G E+++  L   E+K++AYHE+GHA+ GW L + D LLKV+I+PR   +LG+AQY P + +L +++++ D M M L GRA+E + F +  +GAQ+DL+KVTK AYSQI + G ++ +G +        +   +      KP+S     +ID EAR +V  +Y+    +L + +D +EK+A  LL+KE ++   +++L+GP P+
Sbjct:  203 WNEFVHHMLAVGEVKELIIRPDMEMVTIILH----------EGAVIKG----RKVSSTIFHMAVADANKFEEKLRDVEKRLGI--KDGVPVTY--DRQTDTTGRILMLLLVCALLMSIATRMKSIKSPLSMDSFNQMGRAKFTLVDPFDGGRGVL---FRDVAGLSEAKQEVKEFVDYLKSPEKYQRLGAKVPRGALLLGPPGCGKTLLAKAVATEAQVPFLSMNGSEFIEMIGGLGAARVRDLFKEGKKRAPCIIYIDEIDAIGRQRSGTESMGQGSSGESEQTLNQLLVEMDGMATKEGVLMLASTNRADILDKALLRPGRFDRHILIDLPTLAERKEIFEKHLSSVKLESPPTTFSQRLARLTPGFSGADIANVCNEAALHAARNTQMEVSSKNLEYAVERLVGGTEKRSHALSLAERKVIAYHESGHALVGWMLPNSDILLKVTIVPRTSLALGFAQYTPSEQHLYSKEELFDKMCMALGGRAAENLVFNRITTGAQNDLEKVTKIAYSQIKKFGMNDTLGPIYVRDADETEGGGAMGSGGKKPFSRAMESMIDNEARHVVASAYQTTEGILTTHRDKLEKLAEALLEKETLDYDQVVQLIGPPPY 791          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Fly
Match: YME1L (gene:FBgn0034792 transcript:FBtr0332910)

HSP 1 Score: 357.066 bits (915), Expect = 6.435e-109
Identity = 191/446 (42.83%), Postives = 275/446 (61.66%), Query Frame = 1
Query:  751 EIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAAR-TPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMP-RDVYLMTQDQMLDSMGMTLAGRASEQIFF--EKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELL 2076
            EI   F DV GC+EAK E+ E V FLK+P+K++ LG K+P+G +L GPPGTGKTLLA+A AGEA VPF   +G EF E+ VG G  RVRD+F  A+A APC++F+DEID++G KR+      ++ Q  T+NQLL EMDGF     V+VL ATNR D LD ALLRPGRFD +V VS P+  GR  +  ++L    T +  +E    + AR T GF+GAD+ N+ N+AAL AA + AE V+ KH + A ++V+ G E+K ++   +   I AYHE GHA+  ++ +   PL KV+I+PRG SLG+  Y+P ++ Y +T+ Q+L  M   + GRA+E++ F  +K  SGA  DL++ T  A   +   G S+KVG  + +   S+           T + +D E + ++  SYER   +L+      + +A  LL  E ++  D+  +L
Sbjct:  297 EINVTFEDVKGCDEAKQELKEVVEFLKSPEKFSNLGGKLPKGVLLVGPPGTGKTLLARAVAGEAKVPFFHAAGPEFDEVLVGQGARRVRDLFKAAKARAPCVIFIDEIDSVGAKRTNSVLHPYANQ--TINQLLSEMDGFHQNAGVIVLGATNRRDDLDQALLRPGRFDVEVMVSTPDFTGRKEILSLYL----TKILHDEIDLDMLARGTSGFTGADLENMINQAALRAAIDGAETVSMKHLETARDKVLMGPERKARLPDEEANTITAYHEGGHAIVAFYTKESHPLHKVTIMPRGPSLGHTAYIPEKERYHVTKAQLLAMMDTMMGGRAAEELVFGTDKITSGASSDLKQATSIATHMVRDWGMSDKVGLRTIE--ASKGLGTGDTLGPNTIEAVDAEIKRILSDSYERAKAILRKHTREHKALAEALLKYETLDADDIKAIL 734          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Zebrafish
Match: afg3l2 (AFG3-like AAA ATPase 2 [Source:ZFIN;Acc:ZDB-GENE-070912-46])

HSP 1 Score: 785.408 bits (2027), Expect = 0.000e+0
Identity = 393/647 (60.74%), Postives = 498/647 (76.97%), Query Frame = 1
Query:  256 LSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFL-YLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIK--TNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKE 2187
            L++GY ++ + +   E + W+ FVN+++ KG++  +E++NK Y ++I   TP K            P +   +   WFN+G+VDTFE  L   + ELGI  ++++P+VY  E   S L S++  +  IGFL +++ R    +    +G  G F   ++T KV+ + EI  KF DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GAIL GPPGTGKTLLAKATAGEANVPF++++GSEFLE+FVGVGP+RVRD+F  AR +APCILF+DEIDA+GRKR   +FGG SEQE+TLNQLLVEMDGF T  NVVVLA TNR DILDPAL+RPGRFDRQ+Y+  P+IKGRAS+FKVHL P+K    +DK   +RK+AA TPGFSGAD+ANVCNEAALIAAR  ++ +  KHF+ AIERVI GLE+KTQVLQP+EKK VAYHEAGHAVAGWFL H DPLLKVSIIPRGK LGYAQY+P++ YL T++Q+LD M MTL GR SE+IFF +  +GAQDDL+KVT++AY+QIVQ G +EKVG +SFDLP+  +  + KPYSE TA+LID E R ++  +YER  +LL  KK  VEKVALRLL+KE ++K+D++ELLG RPFAEK+TYE+FVEGTGS +E+T LPEGLKDWNKE
Sbjct:  150 LAMGYYFF-IRDGGRE-VTWKDFVNSYLAKGVVDRLEVVNKRYVKVIF--TPGK-----------TPVDGQYV---WFNIGSVDTFERNLETAQLELGIEGENRLPVVYSAESDGSFLLSMLPTVLIIGFLLFMLRRGPAGAGRPGRGMGGLFSVSETTAKVL-RDEIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVNGSEFLEMFVGVGPARVRDLFVLARKNAPCILFIDEIDAVGRKRGRGNFGGQSEQENTLNQLLVEMDGFNTATNVVVLAGTNRPDILDPALMRPGRFDRQIYIGPPDIKGRASIFKVHLRPLKLEAELDKEALARKMAALTPGFSGADIANVCNEAALIAARHLSDAINQKHFEQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWFLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLKKVTQSAYAQIVQFGMNEKVGQVSFDLPRQGELVLEKPYSEATARLIDTEVRNLISTAYERTQQLLSDKKPEVEKVALRLLEKEVLDKNDMVELLGKRPFAEKSTYEEFVEGTGSVDEDTSLPEGLKDWNKE 777          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Zebrafish
Match: si:ch1073-174d20.2 (si:ch1073-174d20.2 [Source:ZFIN;Acc:ZDB-GENE-121214-51])

HSP 1 Score: 773.467 bits (1996), Expect = 0.000e+0
Identity = 377/639 (59.00%), Postives = 482/639 (75.43%), Query Frame = 1
Query:  277 YNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTN--VDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKE 2187
            Y ++    + + W+ FV+ ++ +G++  +E++NK++ R+IL                +  A+ N     WFN+G+VDTFE  L     ELG+    +  +VY +E   S L S +  +  IGFL    R             G FG  +ST K++ K  I+ KF DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GA+L GPPGTGKTLLAKATAGEANVPF++++GSEFLE+FVGVGP+RVRDMF+ AR +APCILF+DEIDA+G+KR G +FGG+SEQE+TLNQLLVEMDGF +  NVVVLA TNR D+LDPAL+RPGRFDRQ+Y+  P+IKGRAS+FKVHL P+K +  VD++  +RK+AA TPGF+GAD+ANVCNEAALIAAR   E V+ KHF+ AI+RVI GLE+KTQVLQP EKK VAYHEAGHAV GWFL+H DPLLKVSIIPRGK LGYAQY+P++ YL T++Q+ D M M L GR +EQ+FF K  +GA DDL+KVT++AY+QIVQ G SE+VG +SFDLP+  +  + KPYSE TA+LIDEE R +V ++Y R LEL+  K++ V+ V  RLL+KE ++K+D+LELLG RPF EK+TYE+FVEGTGSFEE+T LPEGLKDWN+E
Sbjct:  113 YLLFRDPGKEITWKDFVHRYLDRGLVERLEVVNKQFVRVIL----------------ERDADANEGSYVWFNIGSVDTFERNLEAAHYELGLEPSHRAAVVYTSESDGSFLMSFIPTLLLIGFLLFTLRRGPMGGGMGGRRGGLFGMSESTAKMM-KDSIEVKFKDVAGCEEAKVEIMEFVNFLKNPQQYQDLGAKIPKGAVLSGPPGTGKTLLAKATAGEANVPFITVNGSEFLEMFVGVGPARVRDMFALARKNAPCILFIDEIDAVGKKRGGGNFGGNSEQENTLNQLLVEMDGFNSSTNVVVLAGTNRPDVLDPALMRPGRFDRQIYLGPPDIKGRASIFKVHLRPLKLDPSVDRDAIARKMAAATPGFTGADIANVCNEAALIAARYLNESVSVKHFEQAIDRVIGGLEKKTQVLQPTEKKTVAYHEAGHAVVGWFLQHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTREQLFDRMCMMLGGRVAEQVFFNKITTGAHDDLKKVTQSAYAQIVQFGMSERVGQVSFDLPRQGETVLEKPYSEATAELIDEEVRDLVDRAYRRTLELVTEKREQVDMVGKRLLEKEVLDKADMLELLGARPFEEKSTYEEFVEGTGSFEEDTSLPEGLKDWNQE 734          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Zebrafish
Match: AL954648.3 (SPG7 matrix AAA peptidase subunit, paraplegin [Source:NCBI gene;Acc:794740])

HSP 1 Score: 503.056 bits (1294), Expect = 7.655e-165
Identity = 263/619 (42.49%), Postives = 389/619 (62.84%), Query Frame = 1
Query:  256 LSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLK-TYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYK-TEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFG-GHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPR-GKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEK 2100
            +++  +  N  N+    + W  FVN  + KG ++ ++++ +        S   +    P   +   P    RL   Y   + N+D FE  LR  E+EL I  KD+IP+ YK T +  ++L +L      +  L+ I+R           +            V GK      F DVAG  EAK+E+ EFV++LKNPD+Y  LGAK+P+G++L GPPG GKTLLAKA A EA VPFL+++GSEF+E+  G+G +RVR +F +ARA APCI+++DEIDA+G+KRS    G  ++E+E TLNQLLVEMDG  T ++V+VLA+TNR DILD AL+RPGR DR +++ LP ++ R  +F+ HL  +K     +  S +LA  TPGFSGAD+AN+CNEAAL AARE  + +    F+ A+ERVIAG  +K+++L  +E+++VA+HE+GHA+ GW L H + ++KVSI PR   +LG+AQ +PRD +L T++Q+ + M M L GRASE I F K  +GAQDDL+KVT+ AYS + Q G  + VG +SF   +++     +P+S+   Q +D EA++++ ++Y    +LL   +D +  +A  LL++E +  +D+  LLGP PF  K
Sbjct:   40 IAVIMSLLNSINTSGGNISWNDFVNEMLAKGEVSRVQVVPE--------SDIVEIYLHPGAVIFGRP----RLALMYRMQVANIDKFEEKLRAAEEELNIDAKDRIPVTYKRTGFFGNALYALGMAAIGVAILWYIFRLAGMGGRDGGFSAFNQLKMAKFTIVDGKSGKGVSFKDVAGMREAKMEVKEFVDYLKNPDRYLQLGAKVPKGSLLLGPPGCGKTLLAKAVATEAQVPFLAMAGSEFVEVIGGLGAARVRSLFKEARARAPCIVYIDEIDAVGKKRSTNMSGFSNTEEEQTLNQLLVEMDGMGTTDHVIVLASTNRADILDNALMRPGRLDRHIFIDLPTLQERKEIFEQHLKILKLTQPADFYSLRLAELTPGFSGADIANICNEAALHAAREGFKSIDTFSFEYAVERVIAGSVKKSKILSKEEQRVVAFHESGHALVGWLLEHTEAVMKVSIAPRTNAALGFAQILPRDQFLFTKEQLFERMCMALGGRASEAITFNKVTTGAQDDLRKVTRVAYSMVKQYGMVDSVGQVSFPDSENQSGIGRRPFSQGLQQQMDLEAKMLIAKAYRHTEKLLLDNRDKLILLANALLEREVVNYNDIEALLGPPPFGPK 646          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Zebrafish
Match: AL954648.2 (SPG7 matrix AAA peptidase subunit, paraplegin [Source:NCBI gene;Acc:794740])

HSP 1 Score: 503.056 bits (1294), Expect = 7.655e-165
Identity = 263/619 (42.49%), Postives = 389/619 (62.84%), Query Frame = 1
Query:  256 LSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLK-TYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYK-TEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFG-GHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPR-GKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEK 2100
            +++  +  N  N+    + W  FVN  + KG ++ ++++ +        S   +    P   +   P    RL   Y   + N+D FE  LR  E+EL I  KD+IP+ YK T +  ++L +L      +  L+ I+R           +            V GK      F DVAG  EAK+E+ EFV++LKNPD+Y  LGAK+P+G++L GPPG GKTLLAKA A EA VPFL+++GSEF+E+  G+G +RVR +F +ARA APCI+++DEIDA+G+KRS    G  ++E+E TLNQLLVEMDG  T ++V+VLA+TNR DILD AL+RPGR DR +++ LP ++ R  +F+ HL  +K     +  S +LA  TPGFSGAD+AN+CNEAAL AARE  + +    F+ A+ERVIAG  +K+++L  +E+++VA+HE+GHA+ GW L H + ++KVSI PR   +LG+AQ +PRD +L T++Q+ + M M L GRASE I F K  +GAQDDL+KVT+ AYS + Q G  + VG +SF   +++     +P+S+   Q +D EA++++ ++Y    +LL   +D +  +A  LL++E +  +D+  LLGP PF  K
Sbjct:   40 IAVIMSLLNSINTSGGNISWNDFVNEMLAKGEVSRVQVVPE--------SDIVEIYLHPGAVIFGRP----RLALMYRMQVANIDKFEEKLRAAEEELNIDAKDRIPVTYKRTGFFGNALYALGMAAIGVAILWYIFRLAGMGGRDGGFSAFNQLKMAKFTIVDGKSGKGVSFKDVAGMREAKMEVKEFVDYLKNPDRYLQLGAKVPKGSLLLGPPGCGKTLLAKAVATEAQVPFLAMAGSEFVEVIGGLGAARVRSLFKEARARAPCIVYIDEIDAVGKKRSTNMSGFSNTEEEQTLNQLLVEMDGMGTTDHVIVLASTNRADILDNALMRPGRLDRHIFIDLPTLQERKEIFEQHLKILKLTQPADFYSLRLAELTPGFSGADIANICNEAALHAAREGFKSIDTFSFEYAVERVIAGSVKKSKILSKEEQRVVAFHESGHALVGWLLEHTEAVMKVSIAPRTNAALGFAQILPRDQFLFTKEQLFERMCMALGGRASEAITFNKVTTGAQDDLRKVTRVAYSMVKQYGMVDSVGQVSFPDSENQSGIGRRPFSQGLQQQMDLEAKMLIAKAYRHTEKLLLDNRDKLILLANALLEREVVNYNDIEALLGPPPFGPK 646          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Zebrafish
Match: spg7 (SPG7 matrix AAA peptidase subunit, paraplegin [Source:ZFIN;Acc:ZDB-GENE-030131-5391])

HSP 1 Score: 502.286 bits (1292), Expect = 3.322e-163
Identity = 263/620 (42.42%), Postives = 390/620 (62.90%), Query Frame = 1
Query:  256 LSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEII-NKEYARLILNSTPSKFSSMPDEEVLQAPANINRLK-TYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYK-TEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFG-GHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPR-GKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEK 2100
            +++  +  N  N+    + W  FVN  + KG ++ ++++   +   + L+         P   +   P    RL   Y   + N+D FE  LR  E+EL I  KD+IP+ YK T +  ++L +L      +  L+ I+R           +            V GK      F DVAG  EAK+E+ EFV++LKNPD+Y  LGAK+P+G++L GPPG GKTLLAKA A EA VPFL+++GSEF+E+  G+G +RVR +F +ARA APCI+++DEIDA+G+KRS    G  ++E+E TLNQLLVEMDG  T ++V+VLA+TNR DILD AL+RPGR DR +++ LP ++ R  +F+ HL  +K     +  S +LA  TPGFSGAD+AN+CNEAAL AARE  + +    F+ A+ERVIAG  +K+++L  +E+++VA+HE+GHA+ GW L H + ++KVSI PR   +LG+AQ +PRD +L T++Q+ + M M L GRASE I F K  +GAQDDL+KVT+ AYS + Q G  + VG +SF   +++     +P+S+   Q +D EA++++ ++Y    +LL   +D +  +A  LL++E +  +D+  LLGP PF  K
Sbjct:  139 IAVIMSLLNSINTSGGNISWNDFVNEMLAKGEVSRVQVVPESDIVEIYLH---------PGAVIFGRP----RLALMYRMQVANIDKFEEKLRAAEEELNIDAKDRIPVTYKRTGFFGNALYALGMAAIGVAILWYIFRLAGMGGRDGGFSAFNQLKMAKFTIVDGKSGKGVSFKDVAGMREAKMEVKEFVDYLKNPDRYLQLGAKVPKGSLLLGPPGCGKTLLAKAVATEAQVPFLAMAGSEFVEVIGGLGAARVRSLFKEARARAPCIVYIDEIDAVGKKRSTNMSGFSNTEEEQTLNQLLVEMDGMGTTDHVIVLASTNRADILDNALMRPGRLDRHIFIDLPTLQERKEIFEQHLKILKLTQPADFYSLRLAELTPGFSGADIANICNEAALHAAREGFKSIDTFSFEYAVERVIAGSVKKSKILSKEEQRVVAFHESGHALVGWLLEHTEAVMKVSIAPRTNAALGFAQILPRDQFLFTKEQLFERMCMALGGRASEAITFNKVTTGAQDDLRKVTRVAYSMVKQYGMVDSVGQVSFPDSENQSGIGRRPFSQGLQQQMDLEAKMLIAKAYRHTEKLLLDNRDKLILLANALLEREVVNYNDIEALLGPPPFGPK 745          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Xenopus
Match: afg3l2 (AFG3-like AAA ATPase 2 [Source:NCBI gene;Acc:780216])

HSP 1 Score: 800.431 bits (2066), Expect = 0.000e+0
Identity = 397/650 (61.08%), Postives = 498/650 (76.62%), Query Frame = 1
Query:  253 GLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTN--VDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKEVPK 2196
            G     T+Y  + +    + W+ F NN++ K M+  +E++NK + R+I   TP K           +P +    +  WFN+G+VDTFE  L  ++ ELGI  +++IP+VY +E   S L S++  +  IGFL    R   + +   +G  G F  G++T KV+ K EI  KF DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GA+L GPPGTGKTLLAKATAGEANVPF++++GSEFLE+FVGVGP+RVRD+F  AR +APCILF+DEIDA+GRKR   +FGG SEQE+TLNQLLVEMDGF T  NVVVLA TNR DILDPALLRPGRFDRQ+Y+  P+IKGRAS+FKVHL P+K +  ++K   +RKLAA TPGFSGAD+ANVCNEAALIAAR  ++ +  KHF+ AIERVI GLE+KTQVLQP+EKK VAYHEAGHAVAGWFL H DPLLKVSIIPRGK LGYAQY+P++ YL T++Q+LD M MTL GR SEQIFF +  +GAQDDL+KVT++AY+QIVQ G +EKVG +SFDLP+  D  + KPYSE TA+LID+E R+++  +YER L LL  KK  +EK+ALRLL+KE ++KSD++ELLG RPFAEK+TYE+FVEGTGS +E+T LPEGLKDWNK+  K
Sbjct:  155 GFWASVTYYFFFRNSGREITWKDFFNNYLSKDMVDRLEVVNKRFVRVIF--TPGK-----------SPVDG---RYVWFNIGSVDTFERNLETVQQELGIEGENRIPVVYSSESDGSFLLSMLPTVLIIGFLLYTLRRGPAGARQGRGMGGLFSVGETTAKVL-KDEIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAVLTGPPGTGKTLLAKATAGEANVPFITVNGSEFLEMFVGVGPARVRDLFVLARKNAPCILFIDEIDAVGRKRGRGNFGGQSEQENTLNQLLVEMDGFNTTTNVVVLAGTNRPDILDPALLRPGRFDRQIYIGPPDIKGRASIFKVHLRPLKLDGAIEKESLARKLAALTPGFSGADIANVCNEAALIAARHLSDAINQKHFEHAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWFLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEQIFFGRITTGAQDDLKKVTQSAYAQIVQFGMNEKVGQVSFDLPRQGDMVLEKPYSEATARLIDDEVRVLINTAYERTLTLLTEKKADIEKIALRLLEKEVLDKSDMVELLGKRPFAEKSTYEEFVEGTGSLDEDTSLPEGLKDWNKDREK 787          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Xenopus
Match: afg3l2 (AFG3-like AAA ATPase 2 [Source:NCBI gene;Acc:780216])

HSP 1 Score: 800.431 bits (2066), Expect = 0.000e+0
Identity = 397/650 (61.08%), Postives = 498/650 (76.62%), Query Frame = 1
Query:  253 GLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTN--VDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKEVPK 2196
            G     T+Y  + +    + W+ F NN++ K M+  +E++NK + R+I   TP K           +P +    +  WFN+G+VDTFE  L  ++ ELGI  +++IP+VY +E   S L S++  +  IGFL    R   + +   +G  G F  G++T KV+ K EI  KF DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GA+L GPPGTGKTLLAKATAGEANVPF++++GSEFLE+FVGVGP+RVRD+F  AR +APCILF+DEIDA+GRKR   +FGG SEQE+TLNQLLVEMDGF T  NVVVLA TNR DILDPALLRPGRFDRQ+Y+  P+IKGRAS+FKVHL P+K +  ++K   +RKLAA TPGFSGAD+ANVCNEAALIAAR  ++ +  KHF+ AIERVI GLE+KTQVLQP+EKK VAYHEAGHAVAGWFL H DPLLKVSIIPRGK LGYAQY+P++ YL T++Q+LD M MTL GR SEQIFF +  +GAQDDL+KVT++AY+QIVQ G +EKVG +SFDLP+  D  + KPYSE TA+LID+E R+++  +YER L LL  KK  +EK+ALRLL+KE ++KSD++ELLG RPFAEK+TYE+FVEGTGS +E+T LPEGLKDWNK+  K
Sbjct:   75 GFWASVTYYFFFRNSGREITWKDFFNNYLSKDMVDRLEVVNKRFVRVIF--TPGK-----------SPVDG---RYVWFNIGSVDTFERNLETVQQELGIEGENRIPVVYSSESDGSFLLSMLPTVLIIGFLLYTLRRGPAGARQGRGMGGLFSVGETTAKVL-KDEIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAVLTGPPGTGKTLLAKATAGEANVPFITVNGSEFLEMFVGVGPARVRDLFVLARKNAPCILFIDEIDAVGRKRGRGNFGGQSEQENTLNQLLVEMDGFNTTTNVVVLAGTNRPDILDPALLRPGRFDRQIYIGPPDIKGRASIFKVHLRPLKLDGAIEKESLARKLAALTPGFSGADIANVCNEAALIAARHLSDAINQKHFEHAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWFLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEQIFFGRITTGAQDDLKKVTQSAYAQIVQFGMNEKVGQVSFDLPRQGDMVLEKPYSEATARLIDDEVRVLINTAYERTLTLLTEKKADIEKIALRLLEKEVLDKSDMVELLGKRPFAEKSTYEEFVEGTGSLDEDTSLPEGLKDWNKDREK 707          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Xenopus
Match: afg3l2 (AFG3-like AAA ATPase 2 [Source:NCBI gene;Acc:780216])

HSP 1 Score: 799.66 bits (2064), Expect = 0.000e+0
Identity = 397/650 (61.08%), Postives = 498/650 (76.62%), Query Frame = 1
Query:  253 GLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTN--VDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKEVPK 2196
            G     T+Y  + +    + W+ F NN++ K M+  +E++NK + R+I   TP K           +P +    +  WFN+G+VDTFE  L  ++ ELGI  +++IP+VY +E   S L S++  +  IGFL    R   + +   +G  G F  G++T KV+ K EI  KF DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GA+L GPPGTGKTLLAKATAGEANVPF++++GSEFLE+FVGVGP+RVRD+F  AR +APCILF+DEIDA+GRKR   +FGG SEQE+TLNQLLVEMDGF T  NVVVLA TNR DILDPALLRPGRFDRQ+Y+  P+IKGRAS+FKVHL P+K +  ++K   +RKLAA TPGFSGAD+ANVCNEAALIAAR  ++ +  KHF+ AIERVI GLE+KTQVLQP+EKK VAYHEAGHAVAGWFL H DPLLKVSIIPRGK LGYAQY+P++ YL T++Q+LD M MTL GR SEQIFF +  +GAQDDL+KVT++AY+QIVQ G +EKVG +SFDLP+  D  + KPYSE TA+LID+E R+++  +YER L LL  KK  +EK+ALRLL+KE ++KSD++ELLG RPFAEK+TYE+FVEGTGS +E+T LPEGLKDWNK+  K
Sbjct:  155 GFWASVTYYFFFRNSGREITWKDFFNNYLSKDMVDRLEVVNKRFVRVIF--TPGK-----------SPVDG---RYVWFNIGSVDTFERNLETVQQELGIEGENRIPVVYSSESDGSFLLSMLPTVLIIGFLLYTLRRGPAGARQGRGMGGLFSVGETTAKVL-KDEIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAVLTGPPGTGKTLLAKATAGEANVPFITVNGSEFLEMFVGVGPARVRDLFVLARKNAPCILFIDEIDAVGRKRGRGNFGGQSEQENTLNQLLVEMDGFNTTTNVVVLAGTNRPDILDPALLRPGRFDRQIYIGPPDIKGRASIFKVHLRPLKLDGAIEKESLARKLAALTPGFSGADIANVCNEAALIAARHLSDAINQKHFEHAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWFLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEQIFFGRITTGAQDDLKKVTQSAYAQIVQFGMNEKVGQVSFDLPRQGDMVLEKPYSEATARLIDDEVRVLINTAYERTLTLLTEKKADIEKIALRLLEKEVLDKSDMVELLGKRPFAEKSTYEEFVEGTGSLDEDTSLPEGLKDWNKDREK 787          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Xenopus
Match: fut1 (fucosyltransferase 1 (H blood group) [Source:Xenbase;Acc:XB-GENE-986117])

HSP 1 Score: 779.63 bits (2012), Expect = 0.000e+0
Identity = 391/663 (58.97%), Postives = 495/663 (74.66%), Query Frame = 1
Query:  205 PLDPRKKENIVGVLLIGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTN--VDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKE 2187
            P D +   N+  +L  G++ G+ ++ + +   E + W+ FV+ ++ +G++  +E++NK++ R+I    P+              A     K  WFN+G+VD+FE  L   +DELGI    ++ ++Y +E   S L SL+  +  +GFL    R             G FG G++T K++ KG I  KF DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIPRGA+L GPPGTGKTLLAKATAGEANVPF++++GSEFLE+FVGVGP+RVRDMF+ AR +APCILF+DEIDA+GRKR   +FGG SEQE+TLNQLLVEMDGF +  NVV+LA TNR DILDPAL+RPGRFDRQ+Y+  P+IKGRAS+FKVHL P+K +  V K   SRKLAA TPGF+GAD+ANVCNEAALIAAR   + V  KHF  AIERVI GLE+KTQVLQP+EKK VAYHEAGHAV GW+L+H DPLLKVSIIPRGK LGYAQY+P++ YL T++Q+ D M M L GR SEQ+FF +  +GAQDDL+KVT++AY+QIVQ G SEK+G +SFDLP+  +    KPYSE TA+LID+EAR ++  +YER LELL   KD VEKVA RLL+KE +EKSD++ELLG RPF EK++YE+FVEGTGS EE+T LPEGLKDWN+E
Sbjct:  130 PWDDKDFRNL-AILAAGIASGFLFFYLRDPGRE-INWKEFVHLYLARGVVDRLEVVNKQFVRVI----PT--------------AGTTSEKYVWFNIGSVDSFERNLENAQDELGIEPAQRVSVIYSSESDGSFLMSLIPTLLLVGFLLFSLRRGAMGPGRGGRGGGLFGVGETTAKML-KGNIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPRGAMLTGPPGTGKTLLAKATAGEANVPFITVNGSEFLEMFVGVGPARVRDMFAMARKNAPCILFIDEIDAVGRKRGRGNFGGQSEQENTLNQLLVEMDGFNSSTNVVILAGTNRPDILDPALMRPGRFDRQIYIGPPDIKGRASIFKVHLRPLKLDESVSKEALSRKLAALTPGFTGADIANVCNEAALIAARYLKDYVVEKHFVQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVVGWYLQHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTREQLFDRMCMMLGGRVSEQLFFSRITTGAQDDLKKVTQSAYAQIVQFGMSEKLGQVSFDLPRQGEMLAEKPYSEATAELIDQEARNLINSAYERTLELLTRCKDQVEKVAKRLLEKEVLEKSDMIELLGARPFPEKSSYEEFVEGTGSLEEDTSLPEGLKDWNQE 771          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Xenopus
Match: fut1 (fucosyltransferase 1 (H blood group) [Source:Xenbase;Acc:XB-GENE-986117])

HSP 1 Score: 779.63 bits (2012), Expect = 0.000e+0
Identity = 391/663 (58.97%), Postives = 495/663 (74.66%), Query Frame = 1
Query:  205 PLDPRKKENIVGVLLIGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTN--VDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKE 2187
            P D +   N+  +L  G++ G+ ++ + +   E + W+ FV+ ++ +G++  +E++NK++ R+I    P+              A     K  WFN+G+VD+FE  L   +DELGI    ++ ++Y +E   S L SL+  +  +GFL    R             G FG G++T K++ KG I  KF DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIPRGA+L GPPGTGKTLLAKATAGEANVPF++++GSEFLE+FVGVGP+RVRDMF+ AR +APCILF+DEIDA+GRKR   +FGG SEQE+TLNQLLVEMDGF +  NVV+LA TNR DILDPAL+RPGRFDRQ+Y+  P+IKGRAS+FKVHL P+K +  V K   SRKLAA TPGF+GAD+ANVCNEAALIAAR   + V  KHF  AIERVI GLE+KTQVLQP+EKK VAYHEAGHAV GW+L+H DPLLKVSIIPRGK LGYAQY+P++ YL T++Q+ D M M L GR SEQ+FF +  +GAQDDL+KVT++AY+QIVQ G SEK+G +SFDLP+  +    KPYSE TA+LID+EAR ++  +YER LELL   KD VEKVA RLL+KE +EKSD++ELLG RPF EK++YE+FVEGTGS EE+T LPEGLKDWN+E
Sbjct:  123 PWDDKDFRNLA-ILAAGIASGFLFFYLRDPGRE-INWKEFVHLYLARGVVDRLEVVNKQFVRVI----PT--------------AGTTSEKYVWFNIGSVDSFERNLENAQDELGIEPAQRVSVIYSSESDGSFLMSLIPTLLLVGFLLFSLRRGAMGPGRGGRGGGLFGVGETTAKML-KGNIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPRGAMLTGPPGTGKTLLAKATAGEANVPFITVNGSEFLEMFVGVGPARVRDMFAMARKNAPCILFIDEIDAVGRKRGRGNFGGQSEQENTLNQLLVEMDGFNSSTNVVILAGTNRPDILDPALMRPGRFDRQIYIGPPDIKGRASIFKVHLRPLKLDESVSKEALSRKLAALTPGFTGADIANVCNEAALIAARYLKDYVVEKHFVQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVVGWYLQHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTREQLFDRMCMMLGGRVSEQLFFSRITTGAQDDLKKVTQSAYAQIVQFGMSEKLGQVSFDLPRQGEMLAEKPYSEATAELIDQEARNLINSAYERTLELLTRCKDQVEKVAKRLLEKEVLEKSDMIELLGARPFPEKSSYEEFVEGTGSLEEDTSLPEGLKDWNQE 764          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Mouse
Match: Afg3l2 (AFG3-like AAA ATPase 2 [Source:MGI Symbol;Acc:MGI:1916847])

HSP 1 Score: 784.637 bits (2025), Expect = 0.000e+0
Identity = 390/642 (60.75%), Postives = 493/642 (76.79%), Query Frame = 1
Query:  265 GYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFL-YLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTN--VDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWN 2181
            G   Y V+ S    + W+ FVNN++ KG++  +E++NK + R+    TP K            P +   +   WFN+G+VDTFE  L  L+ ELGI  ++++P+VY  E   S L S++  +  I FL Y I R         +G  G F  G++T KV+ K EI  KF DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GAIL GPPGTGKTLLAKATAGEANVPF+++SGSEFLE+FVGVGP+RVRD+F+ AR +APCILF+DEIDA+GRKR   +FGG SEQE+TLNQLLVEMDGF T  NVV+LA TNR DILDPALLRPGRFDRQ+++  P+IKGRAS+FKVHL P+K +  ++K++ +RKLA+ TPGFSGADVANVCNEAALIAAR  ++ +  KHF+ AIERVI GLE+KTQVLQP+EKK VAYHEAGHAVAGW+L H DPLLKVSIIPRGK LGYAQY+P++ YL T++Q+LD M MTL GR SE+IFF +  +GAQDDL+KVT++AY+QIVQ G +EKVG +SFDLP+  D  + KPYSE TA++ID+E R+++  +Y R + LL  KK  VEKVAL LL+KE ++K+D+++LLGPRPF EK+TYE+FVEGTGS +E+T LPEGL+DWN
Sbjct:  155 GVMIYFVFKSSGREITWKDFVNNYLSKGVVDRLEVVNKRFVRVTF--TPGK-----------TPVDGQYV---WFNIGSVDTFERNLETLQQELGIEGENRVPVVYIAESDGSFLLSMLPTVLIIAFLLYTIRRGPAGIGRTGRGMGGLFSVGETTAKVL-KDEIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVSGSEFLEMFVGVGPARVRDLFALARKNAPCILFIDEIDAVGRKRGRGNFGGQSEQENTLNQLLVEMDGFNTTTNVVILAGTNRPDILDPALLRPGRFDRQIFIGPPDIKGRASIFKVHLRPLKLDSALEKDKLARKLASLTPGFSGADVANVCNEAALIAARHLSDAINEKHFEQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQIVQFGMNEKVGQISFDLPRQGDMVLEKPYSEATARMIDDEVRILISDAYRRTVALLTEKKADVEKVALLLLEKEVLDKNDMVQLLGPRPFTEKSTYEEFVEGTGSLDEDTSLPEGLQDWN 779          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Mouse
Match: Afg3l1 (AFG3-like AAA ATPase 1 [Source:MGI Symbol;Acc:MGI:1928277])

HSP 1 Score: 763.837 bits (1971), Expect = 0.000e+0
Identity = 380/652 (58.28%), Postives = 480/652 (73.62%), Query Frame = 1
Query:  235 VGVLLIGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTN--VDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNK 2184
            + VL  G++ G+ ++   +   E + W+ FV  ++ +G++  +E++NK++ R+I    P   S                 +  WFN+G+VDTFE  L   + ELGI   +Q  +VY TE   S L SL+  +  +  L    R     +       G F  G++T K++ K  I  +F+DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GA+L GPPGTGKTLLAKATAGEANVPF++++GSEFLE+FVGVGP+RVRDMF+ AR HAPCILF+DEIDAIGRKR     GG SEQE+TLNQ+LVEMDGF +  NVVVLA TNR DILDPAL RPGRFDRQ+Y+  P+IKGR+S+FKVHL P+K +  + K+  SRKLAA TPGF+GAD++NVCNEAALIAAR  +  V  +HF+ AIERVI GLE+KTQVLQP EK  VAYHEAGHAV GWFL H DPLLKVSIIPRGK LGYAQY+PR+ +L T++Q+ D M M L GR +EQ+FF +  +GAQDDL+KVT++AY+QIVQ G SEK+G +SFD P+  +  + KPYSE TAQLIDEE R +V+ +Y R LELL   ++ VEKV  RLL+KE +EK+D++ELLGPRPFAEK+TYE+FVEGTGS EE+T LPEGLKDWNK
Sbjct:  142 LAVLGAGVAAGFLYFYFRDPGKE-ITWKHFVQYYLARGLVDRLEVVNKQFVRVI--PVPGTTSE----------------RFVWFNIGSVDTFERNLESAQWELGIEPTNQAAVVYTTESDGSFLRSLVPTLVLVSILLYAMRRGPMGTGRGGRGGGLFSVGETTAKIL-KNNIDVRFADVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAMLTGPPGTGKTLLAKATAGEANVPFITVNGSEFLEMFVGVGPARVRDMFAMARKHAPCILFIDEIDAIGRKRGRGHLGGQSEQENTLNQMLVEMDGFNSSTNVVVLAGTNRPDILDPALTRPGRFDRQIYIGPPDIKGRSSIFKVHLRPLKLDGSLSKDALSRKLAALTPGFTGADISNVCNEAALIAARHLSPSVQERHFEQAIERVIGGLEKKTQVLQPSEKTTVAYHEAGHAVVGWFLEHADPLLKVSIIPRGKGLGYAQYLPREQFLYTREQLFDRMCMMLGGRVAEQLFFGQITTGAQDDLRKVTQSAYAQIVQFGMSEKLGQVSFDFPRQGETMVEKPYSEATAQLIDEEVRCLVRSAYNRTLELLTQCREQVEKVGRRLLEKEVLEKADMIELLGPRPFAEKSTYEEFVEGTGSLEEDTSLPEGLKDWNK 773          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Mouse
Match: Spg7 (SPG7, paraplegin matrix AAA peptidase subunit [Source:MGI Symbol;Acc:MGI:2385906])

HSP 1 Score: 497.664 bits (1280), Expect = 6.809e-163
Identity = 265/634 (41.80%), Postives = 398/634 (62.78%), Query Frame = 1
Query:  223 KENIVGVLLIGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEII-NKEYARLILNSTPSKFSSMPDEEVLQAPANINRLK-TYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYK-TEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFG-GHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPR-GKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMS---KPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEK 2100
            +E +  + +I L +  +  N  ++   ++ W  FVN  + KG +  ++++   +   + L+         P   V   P    RL   Y   + N+D FE  LR  EDEL I  KD+IP+ YK T +  ++L +L      +  L+ ++R    +      +            V GK      F DVAG  EAK+E+ EFV++LK+P+++  LGAK+P+GA+L GPPG GKTLLAKA A EA VPFL+++G EF+E+  G+G +RVR +F +ARA APCI+++DEIDA+G+KRS    G  ++E+E TLNQLLVEMDG  T ++V+VLA+TNR D+LD AL+RPGR DR V++ LP ++ R  +F+ HL  +K     +  S++LA  TPGFSGAD+AN+CNEAAL AARE    V   +F+ A+ERVIAG  +K+++L  +E+++VA+HE+GHA+ GW L H + ++KVSI PR   +LG++Q +PRD YL T++Q+ + M M L GRA+E I F +  SGAQDDL+KVT+ AYS + Q G +  +G +SF  P++++  M    +P+S+   Q++D EA+L+V ++Y    ++L    D ++ +A  LL+KE I   D+  L+GP P   K
Sbjct:   34 RERLRTLFIIALVM--SLLNSLSTSGGSISWADFVNEMLAKGEVQRVQVVPESDVVEVYLH---------PGAVVFGRP----RLALMYRMQVANIDKFEEKLRAAEDELNIESKDRIPVSYKRTGFFGNALYALGMTAVGLAILWYVFRLAGMTGREGGFSAFNQLKMARFTIVDGKTGKGVSFQDVAGMHEAKLEVREFVDYLKSPERFLQLGAKVPKGALLLGPPGCGKTLLAKAVATEAQVPFLAMAGPEFVEVIGGLGAARVRSLFKEARARAPCIVYIDEIDAVGKKRSTSMSGFSNTEEEQTLNQLLVEMDGMGTTDHVIVLASTNRADVLDNALMRPGRLDRHVFIDLPTLQERREIFEQHLKGLKLTQPSSFYSQRLAELTPGFSGADIANICNEAALHAAREGHTSVHTFNFEYAVERVIAGTAKKSKILSKEEQRVVAFHESGHALVGWLLEHTEAVMKVSIAPRTNAALGFSQMLPRDQYLFTKEQLFERMCMALGGRAAEAISFSRVTSGAQDDLRKVTRIAYSMVKQFGMAPSIGPVSF--PEAQEGLMGIGRRPFSQGLQQMMDHEAKLLVAKAYRHTEKVLLDNLDKLQALANALLEKEVINYEDIEALIGPPPHGPK 650          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Mouse
Match: Spg7 (SPG7, paraplegin matrix AAA peptidase subunit [Source:MGI Symbol;Acc:MGI:2385906])

HSP 1 Score: 496.508 bits (1277), Expect = 5.047e-161
Identity = 265/634 (41.80%), Postives = 398/634 (62.78%), Query Frame = 1
Query:  223 KENIVGVLLIGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEII-NKEYARLILNSTPSKFSSMPDEEVLQAPANINRLK-TYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYK-TEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFG-GHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPR-GKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMS---KPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEK 2100
            +E +  + +I L +  +  N  ++   ++ W  FVN  + KG +  ++++   +   + L+         P   V   P    RL   Y   + N+D FE  LR  EDEL I  KD+IP+ YK T +  ++L +L      +  L+ ++R    +      +            V GK      F DVAG  EAK+E+ EFV++LK+P+++  LGAK+P+GA+L GPPG GKTLLAKA A EA VPFL+++G EF+E+  G+G +RVR +F +ARA APCI+++DEIDA+G+KRS    G  ++E+E TLNQLLVEMDG  T ++V+VLA+TNR D+LD AL+RPGR DR V++ LP ++ R  +F+ HL  +K     +  S++LA  TPGFSGAD+AN+CNEAAL AARE    V   +F+ A+ERVIAG  +K+++L  +E+++VA+HE+GHA+ GW L H + ++KVSI PR   +LG++Q +PRD YL T++Q+ + M M L GRA+E I F +  SGAQDDL+KVT+ AYS + Q G +  +G +SF  P++++  M    +P+S+   Q++D EA+L+V ++Y    ++L    D ++ +A  LL+KE I   D+  L+GP P   K
Sbjct:  139 RERLRTLFIIALVM--SLLNSLSTSGGSISWADFVNEMLAKGEVQRVQVVPESDVVEVYLH---------PGAVVFGRP----RLALMYRMQVANIDKFEEKLRAAEDELNIESKDRIPVSYKRTGFFGNALYALGMTAVGLAILWYVFRLAGMTGREGGFSAFNQLKMARFTIVDGKTGKGVSFQDVAGMHEAKLEVREFVDYLKSPERFLQLGAKVPKGALLLGPPGCGKTLLAKAVATEAQVPFLAMAGPEFVEVIGGLGAARVRSLFKEARARAPCIVYIDEIDAVGKKRSTSMSGFSNTEEEQTLNQLLVEMDGMGTTDHVIVLASTNRADVLDNALMRPGRLDRHVFIDLPTLQERREIFEQHLKGLKLTQPSSFYSQRLAELTPGFSGADIANICNEAALHAAREGHTSVHTFNFEYAVERVIAGTAKKSKILSKEEQRVVAFHESGHALVGWLLEHTEAVMKVSIAPRTNAALGFSQMLPRDQYLFTKEQLFERMCMALGGRAAEAISFSRVTSGAQDDLRKVTRIAYSMVKQFGMAPSIGPVSF--PEAQEGLMGIGRRPFSQGLQQMMDHEAKLLVAKAYRHTEKVLLDNLDKLQALANALLEKEVINYEDIEALIGPPPHGPK 755          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Mouse
Match: Afg3l1 (AFG3-like AAA ATPase 1 [Source:MGI Symbol;Acc:MGI:1928277])

HSP 1 Score: 442.965 bits (1138), Expect = 3.712e-143
Identity = 229/432 (53.01%), Postives = 299/432 (69.21%), Query Frame = 1
Query:  235 VGVLLIGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTN--VDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQ 1524
            + VL  G++ G+ ++   +   E + W+ FV  ++ +G++  +E++NK++ R+I    P   S                 +  WFN+G+VDTFE  L   + ELGI   +Q  +VY TE   S L SL+  +  +  L    R     +       G F  G++T K++ K  I  +F+DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GA+L GPPGTGKTLLAKATAGEANVPF++++GSEFLE+FVGVGP+RVRDMF+ AR HAPCILF+DEIDAIGRKR     GG SEQE+TLNQ+LVEMDGF +  NVVVLA TNR DILDPAL RPGRFDRQ+Y+  P+IKGR+S+FKVHL P+K +  + K+  SRKLAA TPGF+GAD++NVCNEAALIAAR  +  V  +HF+ AIERVI G+   ++
Sbjct:  142 LAVLGAGVAAGFLYFYFRDPGKE-ITWKHFVQYYLARGLVDRLEVVNKQFVRVI--PVPGTTSE----------------RFVWFNIGSVDTFERNLESAQWELGIEPTNQAAVVYTTESDGSFLRSLVPTLVLVSILLYAMRRGPMGTGRGGRGGGLFSVGETTAKIL-KNNIDVRFADVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAMLTGPPGTGKTLLAKATAGEANVPFITVNGSEFLEMFVGVGPARVRDMFAMARKHAPCILFIDEIDAIGRKRGRGHLGGQSEQENTLNQMLVEMDGFNSSTNVVVLAGTNRPDILDPALTRPGRFDRQIYIGPPDIKGRSSIFKVHLRPLKLDGSLSKDALSRKLAALTPGFTGADISNVCNEAALIAARHLSPSVQERHFEQAIERVIGGVHHTSR 553          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. UniProt/SwissProt
Match: sp|Q2KJI7|AFG32_BOVIN (AFG3-like protein 2 OS=Bos taurus OX=9913 GN=AFG3L2 PE=2 SV=1)

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 393/644 (61.02%), Postives = 497/644 (77.17%), Query Frame = 1
Query:  265 GYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFL-YLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIK--TNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKE 2187
            G+ +Y ++ S    + W+ F NN++ KG++  +E++NK + R+    TP K            P +   +   WFN+G+VDTFE  L  L+ ELGI  ++++P+VY  E   S L S++  +  I FL Y I R         +G  G F  G++T KV+ K EI  KF DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GAIL GPPGTGKTLLAKATAGEANVPF+++SGSEFLE+FVGVGP+RVRD+F+ AR +APCILF+DEIDA+GRKR   +FGG SEQE+TLNQLLVEMDGF T  NVV+LA TNR DILDPAL+RPGRFDRQ+++  P+IKGRAS+FKVHL P+K  + ++K + +RKLA+ TPGFSGADVANVCNEAALIAAR  ++ +  KHF+ AIERVI GLE+KTQVLQP+EKK VAYHEAGHAVAGW+L H DPLLKVSIIPRGK LGYAQY+PR+ YL T++Q+LD M MTL GR SE+IFF +  +GAQDDL+KVT++AY+QIVQ G +EKVG +SFDLP+  D  + KPYSE TA+LID+E R+++  +Y+R + LL  KK  VEKVAL LL+KE ++K+D++ELLGPRPFAEK+TYE+FVEGTGS +E+T LPEGLKDWN+E
Sbjct:  157 GFLFYFLFKSSGREITWKDFANNYLSKGVVDRLEVVNKRFVRVTF--TPGK-----------TPVDGQYV---WFNIGSVDTFERNLETLQQELGIEGENRVPVVYIAESDGSFLLSMLPTVLIIAFLLYTIRRGPAGIGRTGRGMGGLFSVGETTAKVL-KDEIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVSGSEFLEMFVGVGPARVRDLFALARKNAPCILFIDEIDAVGRKRGRGNFGGQSEQENTLNQLLVEMDGFNTTTNVVILAGTNRPDILDPALMRPGRFDRQIFIGPPDIKGRASIFKVHLRPLKLDSTLEKEKLARKLASLTPGFSGADVANVCNEAALIAARHLSDSINQKHFEQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQYLPREQYLYTREQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQIVQFGMNEKVGQISFDLPRQGDMVLEKPYSEATARLIDDEVRILINDAYKRTVALLTEKKADVEKVALLLLEKEVLDKNDMVELLGPRPFAEKSTYEEFVEGTGSLDEDTSLPEGLKDWNRE 783          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. UniProt/SwissProt
Match: sp|Q9Y4W6|AFG32_HUMAN (AFG3-like protein 2 OS=Homo sapiens OX=9606 GN=AFG3L2 PE=1 SV=2)

HSP 1 Score: 787.334 bits (2032), Expect = 0.000e+0
Identity = 392/642 (61.06%), Postives = 494/642 (76.95%), Query Frame = 1
Query:  265 GYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFL-YLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIK--TNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWN 2181
            G  +Y +       + W+ FVNN++ KG++  +E++NK + R+    TP K            P +   +   WFN+G+VDTFE  L  L+ ELGI  ++++P+VY  E   S L S++  +  I FL Y I R         +G  G F  G++T KV+ K EI  KF DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GAIL GPPGTGKTLLAKATAGEANVPF+++SGSEFLE+FVGVGP+RVRD+F+ AR +APCILF+DEIDA+GRKR   +FGG SEQE+TLNQLLVEMDGF T  NVV+LA TNR DILDPALLRPGRFDRQ+++  P+IKGRAS+FKVHL P+K  + ++K++ +RKLA+ TPGFSGADVANVCNEAALIAAR  ++ +  KHF+ AIERVI GLE+KTQVLQP+EKK VAYHEAGHAVAGW+L H DPLLKVSIIPRGK LGYAQY+P++ YL T++Q+LD M MTL GR SE+IFF +  +GAQDDL+KVT++AY+QIVQ G +EKVG +SFDLP+  D  + KPYSE TA+LID+E R+++  +Y+R + LL  KK  VEKVAL LL+KE ++K+D++ELLGPRPFAEK+TYE+FVEGTGS +E+T LPEGLKDWN
Sbjct:  156 GVMFYLLLKRSGREITWKDFVNNYLSKGVVDRLEVVNKRFVRVTF--TPGK-----------TPVDGQYV---WFNIGSVDTFERNLETLQQELGIEGENRVPVVYIAESDGSFLLSMLPTVLIIAFLLYTIRRGPAGIGRTGRGMGGLFSVGETTAKVL-KDEIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVSGSEFLEMFVGVGPARVRDLFALARKNAPCILFIDEIDAVGRKRGRGNFGGQSEQENTLNQLLVEMDGFNTTTNVVILAGTNRPDILDPALLRPGRFDRQIFIGPPDIKGRASIFKVHLRPLKLDSTLEKDKLARKLASLTPGFSGADVANVCNEAALIAARHLSDSINQKHFEQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQIVQFGMNEKVGQISFDLPRQGDMVLEKPYSEATARLIDDEVRILINDAYKRTVALLTEKKADVEKVALLLLEKEVLDKNDMVELLGPRPFAEKSTYEEFVEGTGSLDEDTSLPEGLKDWN 780          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. UniProt/SwissProt
Match: sp|Q8JZQ2|AFG32_MOUSE (AFG3-like protein 2 OS=Mus musculus OX=10090 GN=Afg3l2 PE=1 SV=1)

HSP 1 Score: 784.637 bits (2025), Expect = 0.000e+0
Identity = 390/642 (60.75%), Postives = 493/642 (76.79%), Query Frame = 1
Query:  265 GYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFL-YLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTN--VDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWN 2181
            G   Y V+ S    + W+ FVNN++ KG++  +E++NK + R+    TP K            P +   +   WFN+G+VDTFE  L  L+ ELGI  ++++P+VY  E   S L S++  +  I FL Y I R         +G  G F  G++T KV+ K EI  KF DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GAIL GPPGTGKTLLAKATAGEANVPF+++SGSEFLE+FVGVGP+RVRD+F+ AR +APCILF+DEIDA+GRKR   +FGG SEQE+TLNQLLVEMDGF T  NVV+LA TNR DILDPALLRPGRFDRQ+++  P+IKGRAS+FKVHL P+K +  ++K++ +RKLA+ TPGFSGADVANVCNEAALIAAR  ++ +  KHF+ AIERVI GLE+KTQVLQP+EKK VAYHEAGHAVAGW+L H DPLLKVSIIPRGK LGYAQY+P++ YL T++Q+LD M MTL GR SE+IFF +  +GAQDDL+KVT++AY+QIVQ G +EKVG +SFDLP+  D  + KPYSE TA++ID+E R+++  +Y R + LL  KK  VEKVAL LL+KE ++K+D+++LLGPRPF EK+TYE+FVEGTGS +E+T LPEGL+DWN
Sbjct:  155 GVMIYFVFKSSGREITWKDFVNNYLSKGVVDRLEVVNKRFVRVTF--TPGK-----------TPVDGQYV---WFNIGSVDTFERNLETLQQELGIEGENRVPVVYIAESDGSFLLSMLPTVLIIAFLLYTIRRGPAGIGRTGRGMGGLFSVGETTAKVL-KDEIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVSGSEFLEMFVGVGPARVRDLFALARKNAPCILFIDEIDAVGRKRGRGNFGGQSEQENTLNQLLVEMDGFNTTTNVVILAGTNRPDILDPALLRPGRFDRQIFIGPPDIKGRASIFKVHLRPLKLDSALEKDKLARKLASLTPGFSGADVANVCNEAALIAARHLSDAINEKHFEQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQIVQFGMNEKVGQISFDLPRQGDMVLEKPYSEATARMIDDEVRILISDAYRRTVALLTEKKADVEKVALLLLEKEVLDKNDMVQLLGPRPFTEKSTYEEFVEGTGSLDEDTSLPEGLQDWN 779          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. UniProt/SwissProt
Match: sp|Q920A7|AFG31_MOUSE (AFG3-like protein 1 OS=Mus musculus OX=10090 GN=Afg3l1 PE=1 SV=2)

HSP 1 Score: 763.837 bits (1971), Expect = 0.000e+0
Identity = 380/652 (58.28%), Postives = 480/652 (73.62%), Query Frame = 1
Query:  235 VGVLLIGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTN--VDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNK 2184
            + VL  G++ G+ ++   +   E + W+ FV  ++ +G++  +E++NK++ R+I    P   S                 +  WFN+G+VDTFE  L   + ELGI   +Q  +VY TE   S L SL+  +  +  L    R     +       G F  G++T K++ K  I  +F+DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GA+L GPPGTGKTLLAKATAGEANVPF++++GSEFLE+FVGVGP+RVRDMF+ AR HAPCILF+DEIDAIGRKR     GG SEQE+TLNQ+LVEMDGF +  NVVVLA TNR DILDPAL RPGRFDRQ+Y+  P+IKGR+S+FKVHL P+K +  + K+  SRKLAA TPGF+GAD++NVCNEAALIAAR  +  V  +HF+ AIERVI GLE+KTQVLQP EK  VAYHEAGHAV GWFL H DPLLKVSIIPRGK LGYAQY+PR+ +L T++Q+ D M M L GR +EQ+FF +  +GAQDDL+KVT++AY+QIVQ G SEK+G +SFD P+  +  + KPYSE TAQLIDEE R +V+ +Y R LELL   ++ VEKV  RLL+KE +EK+D++ELLGPRPFAEK+TYE+FVEGTGS EE+T LPEGLKDWNK
Sbjct:  142 LAVLGAGVAAGFLYFYFRDPGKE-ITWKHFVQYYLARGLVDRLEVVNKQFVRVI--PVPGTTSE----------------RFVWFNIGSVDTFERNLESAQWELGIEPTNQAAVVYTTESDGSFLRSLVPTLVLVSILLYAMRRGPMGTGRGGRGGGLFSVGETTAKIL-KNNIDVRFADVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAMLTGPPGTGKTLLAKATAGEANVPFITVNGSEFLEMFVGVGPARVRDMFAMARKHAPCILFIDEIDAIGRKRGRGHLGGQSEQENTLNQMLVEMDGFNSSTNVVVLAGTNRPDILDPALTRPGRFDRQIYIGPPDIKGRSSIFKVHLRPLKLDGSLSKDALSRKLAALTPGFTGADISNVCNEAALIAARHLSPSVQERHFEQAIERVIGGLEKKTQVLQPSEKTTVAYHEAGHAVVGWFLEHADPLLKVSIIPRGKGLGYAQYLPREQFLYTREQLFDRMCMMLGGRVAEQLFFGQITTGAQDDLRKVTQSAYAQIVQFGMSEKLGQVSFDFPRQGETMVEKPYSEATAQLIDEEVRCLVRSAYNRTLELLTQCREQVEKVGRRLLEKEVLEKADMIELLGPRPFAEKSTYEEFVEGTGSLEEDTSLPEGLKDWNK 773          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. UniProt/SwissProt
Match: sp|Q9N3T5|AFG3_CAEEL (AFG3-like protein spg-7 OS=Caenorhabditis elegans OX=6239 GN=spg-7 PE=3 SV=2)

HSP 1 Score: 739.184 bits (1907), Expect = 0.000e+0
Identity = 371/654 (56.73%), Postives = 489/654 (74.77%), Query Frame = 1
Query:  250 IGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFS-SLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXX--------QSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGG-HSEQESTLNQLLVEMDGFKTCEN-VVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDW 2178
            +G+ +    +  Y S Y  + W+ F ++F++ G++  +E+++K + R++  S+  K++                 +T +FN+G+VD+FE +L   +  L      QIP++YK+E++F   + +L+ + +P+ F Y IYR +K   +     R   G          QST +VI + +IK KF+DVAGCEEAKIEI+EFVNFLKNP +Y  LGAKIP+GAIL GPPGTGKTLLAKATAGEANVPF+++SGSEFLE+FVGVGP+RVRDMFS AR ++PCILF+DEIDA+GRKR GK   G HSEQE+TLNQLLVEMDGF T E+ V+V+AATNR+DILD ALLRPGRFDRQ+YV +P+IKGRAS+F+VHL P++T++DK   SRKLAA TPGFSGAD++NVCNEAALIAAR+    ++ KHF+ AIERV+AG+E+KTQVLQ +EKK VAYHEAGHA+AGWFL+H DPLLKVSIIPRGK LGYAQY+P++ YL ++DQ+LD M MTL GR +E+IFF +  +GAQDDLQKVT+ AYSQ+V+ G SEKVG LSF+ P   +    KPYSE TAQLID+E R +V  +  R  +LL  K+  +E+VALRLL+KE + + D++EL+G RPF EK TYE+ V GTG  +E  +LP+GL++W
Sbjct:  130 VGILLALYAFMDYQS-YREISWKEFYSDFLEAGLVERLEVVDKRWVRIV--SSSGKYAG----------------QTCYFNIGSVDSFERSLGAAQHHLQYDADRQIPVLYKSEFNFKREIPNLISVAFPLLFGYYIYRMLKGGGAAGGAGRAGGGGLGGMFGGFGQSTARVINREDIKVKFADVAGCEEAKIEIMEFVNFLKNPQQYKDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVSGSEFLEMFVGVGPARVRDMFSMARKNSPCILFIDEIDAVGRKRGGKGGMGGHSEQENTLNQLLVEMDGFTTDESSVIVIAATNRVDILDSALLRPGRFDRQIYVPVPDIKGRASIFRVHLGPLRTSLDKTVLSRKLAAHTPGFSGADISNVCNEAALIAARDANHEISNKHFEQAIERVVAGMEKKTQVLQKEEKKTVAYHEAGHAIAGWFLQHADPLLKVSIIPRGKGLGYAQYLPKEQYLYSKDQLLDRMCMTLGGRVAEEIFFGRITTGAQDDLQKVTQMAYSQVVKFGMSEKVGPLSFETPAPGEMAFDKPYSEATAQLIDQEVRDLVMNALRRTRDLLLEKRSDIERVALRLLEKEILNREDMIELVGKRPFVEKNTYEEMVSGTGGLDENVELPKGLENW 764          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. TrEMBL
Match: A0A0R3TJS3 (AAA domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS7354 PE=3 SV=1)

HSP 1 Score: 844.729 bits (2181), Expect = 0.000e+0
Identity = 420/665 (63.16%), Postives = 516/665 (77.59%), Query Frame = 1
Query:  232 IVGVLLIGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLK-------TYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXX-XQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKEVPKPE 2202
            I  ++  G  +GY       S Y  + W+ F  NF+K G I  +E++NKE+ R+ +   P   + + D E   A  N+N +         YWF +G VDTFE +LR+LE  LG+   +++P+ Y++++  +    + +    IG  +  ++S         G        GQS V++I K +I   F+DVAGCEEAK+EIIEFVNFLKNP +Y ALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLS+SGSEFLE+FVGVGP RVRDMF+QAR+ APCILF+DEIDAIG KRSG SFG H E+E+TLNQLLVEMDGF T ENVVVLAATNRIDILDPALLRPGRFDRQ+YVSLP+IKGRAS+FKVHL P+K+ +DK E +R++AARTPGFSGAD+A+VCNEAALIAARE+A+ V+ KHFDAAI+RVIAGLE+K+QVLQP+EKK VAYHEAGHA  GWFL HC+PLLKVSIIPRGK+LGYAQYMPRD YL TQDQ+LD M + L GRASEQ+FF K GSGA DDLQ+VT++AY+QIVQLGFS KVG+LSFDLPQ  +  M+KPYSEQTAQLIDEE R +V ++Y+R ++L++  K+ VE +ALRLLDKEQ++K DL+E+LGPRPF EK TYE+ V G+G  +E+T LP GLKDWNKE P+PE
Sbjct:  103 IAAIVGGGALVGYN-----ASKYHKITWKEFAENFLKTGRIHHLEVVNKEWVRVYVQ--PLGAARVRDGESGDAYGNVNTVNLTSGNEPIYWFEIGAVDTFERSLRELEANLGVEPINRVPVNYRSQFRPTDFIYMAFYAALIGAAFYSFKSTSGGVVRKPGMGSSLFNFGQSPVRLIEKDKIGVSFADVAGCEEAKMEIIEFVNFLKNPARYEALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSVSGSEFLEMFVGVGPKRVRDMFNQARSKAPCILFIDEIDAIGGKRSGSSFG-HQERENTLNQLLVEMDGFTTQENVVVLAATNRIDILDPALLRPGRFDRQIYVSLPDIKGRASIFKVHLKPLKSALDKVEVARRMAARTPGFSGADIASVCNEAALIAAREDAKSVSLKHFDAAIDRVIAGLEKKSQVLQPEEKKTVAYHEAGHATVGWFLEHCNPLLKVSIIPRGKALGYAQYMPRDAYLHTQDQLLDEMCLALGGRASEQVFFGKVGSGAMDDLQRVTRSAYAQIVQLGFSSKVGNLSFDLPQQGEPMMTKPYSEQTAQLIDEEVRQLVAKAYDRTIKLVEQHKEHVEALALRLLDKEQLQKEDLVEILGPRPFLEKNTYEEIV-GSGPLDEDTALPPGLKDWNKE-PEPE 757          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. TrEMBL
Match: A0A3R7C0T4 (AFG3-like protein 2 (Fragment) OS=Clonorchis sinensis OX=79923 GN=AFG3L2 PE=3 SV=1)

HSP 1 Score: 836.254 bits (2159), Expect = 0.000e+0
Identity = 415/668 (62.13%), Postives = 508/668 (76.05%), Query Frame = 1
Query:  199 GGPLDPRKKENIVGVLLIGLSIGYTWYNVYNSM--YETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGF-LYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKEVP 2193
            G P +P    N  G L+I L +    Y V  S+  Y+ + W+ FV  F+++G++  +E++NK + ++ L         +P      A        +YWF +G VDTFE  LR+LE  +G+    +I ++Y T    S +         +G  LY +  S            G F F QS V++I + +I  +F+DVAGCEEAK+EIIEFVNFLKNP KY ALGAKIPRGA+LKGPPGTGKT+LAKATAGEANVPFLSISGSEFLE+FVGVGP RVRDMFS AR+ APCILF+DEIDAIG KRSG SFG H E+E+TLNQLLVEMDGF T ENVVVLAATNRIDILDPALLRPGRFDRQ+YVSLP+IKGRAS+FKVHL P+K   D    +R++AARTPGFSGAD+A+VCNEAALIAARE+A+ VT  HFD AI+RV+AGLE+K+QVLQP+EK+ VAYHEAGHA  GWFL HC+PLLKVSIIPRGK+LGYAQY PRD+YL TQ+QMLD M + L GRASE++FFEK GSGA DDLQ+VT++AY+Q+VQLGFS KVG LSFDLPQ  D  ++KPYSEQTAQLID+E R +V+++YER L +++ K+ LVEK+ALRLLDKEQ++K DL+E+LGPRPFAEK+TYE+ V G G  +E+T LP GLKDWNKE P
Sbjct:   62 GKPTNPGGVSN--GPLII-LGVACITYIVATSIPRYKRITWKEFVETFLQQGLVDHLEVVNKSWVQVYLKPGVETTVHLPSGSRDLATPQSTHSPSYWFEIGAVDTFERGLRELESHMGVDPMHRINVIYSTRVQASEVFHFGVTAVILGLVLYSLRSSFGGMVRKGGMGSGLFNFTQSPVRLIERDKIGVRFADVAGCEEAKLEIIEFVNFLKNPQKYEALGAKIPRGAVLKGPPGTGKTMLAKATAGEANVPFLSISGSEFLEMFVGVGPKRVRDMFSTARSKAPCILFIDEIDAIGGKRSGSSFG-HQERENTLNQLLVEMDGFTTQENVVVLAATNRIDILDPALLRPGRFDRQIYVSLPDIKGRASIFKVHLKPLKLAEDAQTVARRMAARTPGFSGADIASVCNEAALIAAREDAQSVTLMHFDKAIDRVVAGLEKKSQVLQPEEKRTVAYHEAGHATVGWFLEHCNPLLKVSIIPRGKALGYAQYQPRDIYLHTQEQMLDEMCLALGGRASEEVFFEKVGSGAVDDLQRVTRSAYAQVVQLGFSPKVGLLSFDLPQQGDMVLTKPYSEQTAQLIDDEVRQIVQKAYERTLGIIREKRSLVEKLALRLLDKEQLQKEDLVEVLGPRPFAEKSTYEEIV-GPGPLDEDTTLPPGLKDWNKEEP 724          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. TrEMBL
Match: H2KRB4 (AFG3 family protein OS=Clonorchis sinensis OX=79923 GN=CLF_105908 PE=3 SV=1)

HSP 1 Score: 835.099 bits (2156), Expect = 0.000e+0
Identity = 415/668 (62.13%), Postives = 508/668 (76.05%), Query Frame = 1
Query:  199 GGPLDPRKKENIVGVLLIGLSIGYTWYNVYNSM--YETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGF-LYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKEVP 2193
            G P +P    N  G L+I L +    Y V  S+  Y+ + W+ FV  F+++G++  +E++NK + ++ L         +P      A        +YWF +G VDTFE  LR+LE  +G+    +I ++Y T    S +         +G  LY +  S            G F F QS V++I + +I  +F+DVAGCEEAK+EIIEFVNFLKNP KY ALGAKIPRGA+LKGPPGTGKT+LAKATAGEANVPFLSISGSEFLE+FVGVGP RVRDMFS AR+ APCILF+DEIDAIG KRSG SFG H E+E+TLNQLLVEMDGF T ENVVVLAATNRIDILDPALLRPGRFDRQ+YVSLP+IKGRAS+FKVHL P+K   D    +R++AARTPGFSGAD+A+VCNEAALIAARE+A+ VT  HFD AI+RV+AGLE+K+QVLQP+EK+ VAYHEAGHA  GWFL HC+PLLKVSIIPRGK+LGYAQY PRD+YL TQ+QMLD M + L GRASE++FFEK GSGA DDLQ+VT++AY+Q+VQLGFS KVG LSFDLPQ  D  ++KPYSEQTAQLID+E R +V+++YER L +++ K+ LVEK+ALRLLDKEQ++K DL+E+LGPRPFAEK+TYE+ V G G  +E+T LP GLKDWNKE P
Sbjct:  192 GKPTNPGGVSN--GPLII-LGVACITYIVATSIPRYKRITWKEFVETFLQQGLVDHLEVVNKSWVQVYLKPGVETTVHLPSGSRDLATPQSTHSPSYWFEIGAVDTFERGLRELESHMGVDPMHRINVIYSTRVQASEVFHFGVTAVILGLVLYSLRSSFGGMVRKGGMGSGLFNFTQSPVRLIERDKIGVRFADVAGCEEAKLEIIEFVNFLKNPQKYEALGAKIPRGAVLKGPPGTGKTMLAKATAGEANVPFLSISGSEFLEMFVGVGPKRVRDMFSTARSKAPCILFIDEIDAIGGKRSGSSFG-HQERENTLNQLLVEMDGFTTQENVVVLAATNRIDILDPALLRPGRFDRQIYVSLPDIKGRASIFKVHLKPLKLAEDVQTVARRMAARTPGFSGADIASVCNEAALIAAREDAQSVTLMHFDKAIDRVVAGLEKKSQVLQPEEKRTVAYHEAGHATVGWFLEHCNPLLKVSIIPRGKALGYAQYQPRDIYLHTQEQMLDEMCLALGGRASEEVFFEKVGSGAVDDLQRVTRSAYAQVVQLGFSPKVGLLSFDLPQQGDMVLTKPYSEQTAQLIDDEVRQIVQKAYERTLGIIREKRSLVEKLALRLLDKEQLQKEDLVEVLGPRPFAEKSTYEEIV-GPGPLDEDTTLPPGLKDWNKEEP 854          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. TrEMBL
Match: A0A564YAU1 (AAA domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS4316 PE=3 SV=1)

HSP 1 Score: 835.099 bits (2156), Expect = 0.000e+0
Identity = 420/671 (62.59%), Postives = 516/671 (76.90%), Query Frame = 1
Query:  235 VGVLLIGLSIGYTWYNVYN-SMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPAN---INRLKT----------YWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXX-XQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKEV-PKP 2199
             G  +I   +G      YN S Y  + W+ F   F++ G I  +E++NKE+ R+ L   P    ++ D E   A ++   I++  T          YWF +G VDTFE +LR+LE  LG+   +++P+ Y++++  +    + +    IG     ++S         G        GQS V++I K +I   F+DVAGCEEAK+EIIEFVNFLKNP +Y ALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLS+SGSEFLE+FVGVGP RVRDMFSQAR+ APCILF+DEIDAIG KRSG SFG H E+E+TLNQLLVEMDGF T ENVVVLAATNRIDILDPALLRPGRFDRQ+YVSLP+IKGRAS+FKVHL P+K+ +DK E +R++AARTPGFSGAD+A+VCNEAALIAARE+A+ VT KHFDAAI+RVIAGLE+K+QVLQP+EKK VAYHEAGHA  GWFL HC+PLLKVSIIPRGK+LGYAQYMPRD YL TQDQMLD M + L GRASEQ+FF K GSGA DDLQ+VT++AY+Q+VQLGFS KVG+LSFDLPQ  +  M+KPYSEQTAQLIDEE R ++ ++Y+R +++++  K+ VE +ALRLLDKEQI+K DL+E+LGPRPF EK+TYE+ V G+G  +E+T LP GLKDWNKE  P+P
Sbjct:   98 AGPWIIAAIVGSGTLLGYNASKYHKITWKEFAEKFLQTGRIHHLEVVNKEWVRVYLQ--PPGAGNVRDIESGDAYSSTRGISQASTLNLTTGNEPIYWFEIGAVDTFERSLRELEANLGVEPINRVPVNYRSQFRPTDFIYMAFYAALIGAAVYSFKSTSGGVVRKPGMGSSLFNFGQSPVRLIEKDKIGVSFADVAGCEEAKLEIIEFVNFLKNPARYEALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSVSGSEFLEMFVGVGPKRVRDMFSQARSKAPCILFIDEIDAIGGKRSGSSFG-HQERENTLNQLLVEMDGFTTQENVVVLAATNRIDILDPALLRPGRFDRQIYVSLPDIKGRASIFKVHLKPLKSALDKVEVARRMAARTPGFSGADIASVCNEAALIAAREDAKSVTLKHFDAAIDRVIAGLEKKSQVLQPEEKKTVAYHEAGHATVGWFLEHCNPLLKVSIIPRGKALGYAQYMPRDAYLHTQDQMLDEMCLALGGRASEQVFFGKVGSGAMDDLQRVTRSAYAQVVQLGFSPKVGNLSFDLPQHGEPMMTKPYSEQTAQLIDEEVRELIAKAYDRTIKIVEQHKEHVEALALRLLDKEQIQKEDLVEILGPRPFQEKSTYEELV-GSGPLDEDTALPPGLKDWNKESEPEP 764          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. TrEMBL
Match: A0A0X3P1V9 (AFG3-like protein 2 OS=Schistocephalus solidus OX=70667 GN=AFG32 PE=3 SV=1)

HSP 1 Score: 835.099 bits (2156), Expect = 0.000e+0
Identity = 414/668 (61.98%), Postives = 519/668 (77.69%), Query Frame = 1
Query:  235 VGVLLIGLSIGYTWYNVYN-SMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLIL--NSTPSKFSSMPD-EEVLQAPANINRLKT--------YWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXX-XQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKEVPKP 2199
            +G  +I  ++G      YN S Y+ + W+ F  NF++KG+I  +E++NKE+ R+ L  + T +   SM + E  L   +  + L T        YWF +G VDTFE +LR+LE  LG+   +++ I YK++   S    + + +  IG  +  +RS         G        GQS V++I + +I   F+DVAGCEEAK+EIIEFVNFLKNP +Y ALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLS+SGSEFLE+FVGVGP RVRDMFSQARA APCILF+DEIDAIG KRSG SFG H E+E+TLNQLLVEMDGF T ENVVVL+ATNRIDILDPALLRPGRFDRQ+YVSLP+IKGRAS+FKVHL P+K+++DK + +R++A RTPGFSGAD+A+VCNEAALIAAR +A+ V   HFD+AI+RVIAGLE+K+QVLQP+EKK VAYHEAGHAV GWFL HC+PLLKVSIIPRGK+LGYAQY PRD YL TQ+Q+LD M + L GRASEQ+FF K GSGA DDLQ++T++AY+QIVQLGFS ++G++SFDLPQ  D  ++KPYSEQTAQ+IDE+ R M+ ++Y+R L+L++  K  VE +ALRLL+KEQ++K DL+E+LGPRPF EK+TYE+ V G+GS +E+T LP GLKDWNKE P+P
Sbjct:   99 IGPWIIVAAVGVGALVAYNASRYQKISWKEFSENFLQKGLIHHLEVVNKEWVRVYLQPSGTATSLDSMQNFESPLTTSSAGSGLPTRSGPTEVIYWFEIGAVDTFERSLRELETSLGVEPMNRVSINYKSKMRTSDFLYMGFYLALIGAAFYSFRSTTGGVVRKPGMGSSLFNFGQSPVRLIERDKIGVSFADVAGCEEAKMEIIEFVNFLKNPARYEALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSVSGSEFLEMFVGVGPKRVRDMFSQARAKAPCILFIDEIDAIGGKRSGSSFG-HQERENTLNQLLVEMDGFTTQENVVVLSATNRIDILDPALLRPGRFDRQIYVSLPDIKGRASIFKVHLKPLKSSLDKVQLARRMATRTPGFSGADIASVCNEAALIAARHDAKSVELTHFDSAIDRVIAGLEKKSQVLQPEEKKTVAYHEAGHAVVGWFLEHCNPLLKVSIIPRGKALGYAQYQPRDAYLHTQEQLLDEMCLALGGRASEQVFFGKVGSGAMDDLQRITRSAYAQIVQLGFSPRIGNVSFDLPQQGDMALTKPYSEQTAQMIDEDVREMIAKAYKRTLDLVEKHKTQVEALALRLLEKEQLQKEDLIEVLGPRPFKEKSTYEELV-GSGSLDEDTSLPPGLKDWNKE-PEP 763          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Cavefish
Match: afg3l2 (AFG3-like AAA ATPase 2 [Source:ZFIN;Acc:ZDB-GENE-070912-46])

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 385/643 (59.88%), Postives = 490/643 (76.21%), Query Frame = 1
Query:  268 YTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFL-YLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTN--VDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKE 2187
            ++++  +    + + W+ FVN ++ KG +  +E++NK + ++I    P K           AP         WFN+G+VDTFE  L   + ELGI  ++++P+VY  E   S L S++  +  IGFL +++ R         +G  G F   ++T KV+ + EI  KF DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GAIL GPPGTGKTLLAKATAGEANVPF++++GSEFLE+FVGVGP+RVRD+F  AR +APCILF+DEIDA+GRKR   +FGG SEQE+TLNQLLVEMDGF T  NVVVLA TNR DILDPAL+RPGRFDRQ+Y+  P+IKGRAS+FKVHL P+K +  +DK   +RK+AA TPGFSGAD+ANVCNEAALIAAR  ++ +T KHF+ +IERVI GLE+KTQVLQP+EKK VAYHEAGHAVAGW+L H DPLLKVSIIPRGK LGYAQY+P++ YL T++Q+LD M MTL GR +EQIFF +  +GAQDDL+KVT++AY+QIVQ G +EKVG +SF++P+  +  + KPYSE TA LID E R ++  +YER L+LL  KK  VEKVALRLL+KE ++K+D+LELLG RPFAE++TYE+FVEGTG  +E+T LPEGLKDWNKE
Sbjct:  156 FSYFLFFREGSKEVTWKDFVNGYLAKGNVDRLEVVNKRFVKVIF--PPGK-----------APVE----GYVWFNIGSVDTFERNLETAQQELGIEGENRLPVVYAAESDGSFLLSMLPTVLIIGFLLFMLRRGAAGGGRPGRGMGGLFSVSETTAKVL-RDEIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVNGSEFLEMFVGVGPARVRDLFVLARKNAPCILFIDEIDAVGRKRGRGNFGGQSEQENTLNQLLVEMDGFNTATNVVVLAGTNRPDILDPALMRPGRFDRQIYIGPPDIKGRASIFKVHLRPLKLDAELDKESLARKMAALTPGFSGADIANVCNEAALIAARHLSDAITQKHFEQSIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVAEQIFFGRITTGAQDDLKKVTQSAYAQIVQFGMNEKVGQVSFEMPRQGEMVLEKPYSEATAFLIDTEVRDLINTAYERTLKLLSEKKPEVEKVALRLLEKEVLDKNDMLELLGQRPFAERSTYEEFVEGTGGMDEDTTLPEGLKDWNKE 780          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Cavefish
Match: afg3l2 (AFG3-like AAA ATPase 2 [Source:ZFIN;Acc:ZDB-GENE-070912-46])

HSP 1 Score: 777.704 bits (2007), Expect = 0.000e+0
Identity = 385/643 (59.88%), Postives = 490/643 (76.21%), Query Frame = 1
Query:  268 YTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFL-YLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTN--VDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKE 2187
            ++++  +    + + W+ FVN ++ KG +  +E++NK + ++I    P K           AP         WFN+G+VDTFE  L   + ELGI  ++++P+VY  E   S L S++  +  IGFL +++ R         +G  G F   ++T KV+ + EI  KF DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GAIL GPPGTGKTLLAKATAGEANVPF++++GSEFLE+FVGVGP+RVRD+F  AR +APCILF+DEIDA+GRKR   +FGG SEQE+TLNQLLVEMDGF T  NVVVLA TNR DILDPAL+RPGRFDRQ+Y+  P+IKGRAS+FKVHL P+K +  +DK   +RK+AA TPGFSGAD+ANVCNEAALIAAR  ++ +T KHF+ +IERVI GLE+KTQVLQP+EKK VAYHEAGHAVAGW+L H DPLLKVSIIPRGK LGYAQY+P++ YL T++Q+LD M MTL GR +EQIFF +  +GAQDDL+KVT++AY+QIVQ G +EKVG +SF++P+  +  + KPYSE TA LID E R ++  +YER L+LL  KK  VEKVALRLL+KE ++K+D+LELLG RPFAE++TYE+FVEGTG  +E+T LPEGLKDWNKE
Sbjct:  176 FSYFLFFREGSKEVTWKDFVNGYLAKGNVDRLEVVNKRFVKVIF--PPGK-----------APVE----GYVWFNIGSVDTFERNLETAQQELGIEGENRLPVVYAAESDGSFLLSMLPTVLIIGFLLFMLRRGAAGGGRPGRGMGGLFSVSETTAKVL-RDEIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVNGSEFLEMFVGVGPARVRDLFVLARKNAPCILFIDEIDAVGRKRGRGNFGGQSEQENTLNQLLVEMDGFNTATNVVVLAGTNRPDILDPALMRPGRFDRQIYIGPPDIKGRASIFKVHLRPLKLDAELDKESLARKMAALTPGFSGADIANVCNEAALIAARHLSDAITQKHFEQSIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVAEQIFFGRITTGAQDDLKKVTQSAYAQIVQFGMNEKVGQVSFEMPRQGEMVLEKPYSEATAFLIDTEVRDLINTAYERTLKLLSEKKPEVEKVALRLLEKEVLDKNDMLELLGQRPFAERSTYEEFVEGTGGMDEDTTLPEGLKDWNKE 800          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Cavefish
Match: ENSAMXT00000003575.2 (pep primary_assembly:Astyanax_mexicanus-2.0:18:6368815:6385454:-1 gene:ENSAMXG00000003503.2 transcript:ENSAMXT00000003575.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 741.11 bits (1912), Expect = 0.000e+0
Identity = 366/661 (55.37%), Postives = 477/661 (72.16%), Query Frame = 1
Query:  205 PLDPRKKENIVGVLLIGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPA-NINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIK--TNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDW 2178
            P D +   N+V +   G+   + + +  ++  E + W+ FV  ++ KG++  +E++NK+Y R                 VL AP  N + +   WFN+G VDTFE  L + E ELG+  + ++ +VY TE   S L +++     +GFL    R    S                +   I K  I T+F DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GA+L GPPGTGKTLLAKATAGEA VPF+++SGSEFLE+FVGVG +RVRDMF+ AR  APCI+F+DEIDA+G+KR   +FGG  EQE+TLNQLLVEMDGF +  NVVVLAATNR+D+LDPALLRPGRFDRQ+Y+  P+IKGRAS+FKVHL P+K  +++  +  +RKLAA TPGF+GAD+ANVCNEAALIAAR  +  V+  HF+ A+ERVI GLE+KTQVLQP EK  VAYHEAGHAV GWFL H DPLLKVSI+PRGK LGYAQY+P++ +L T++Q+ D M M L GR +EQ+FF +  +GAQDDL+KVT++AY+QIVQ G SE+VG ++FD PQ       KPYSE TAQLID+E R ++ ++++R  +L+  K+ LVE+V  RLL+KE +EK+D++ELLGPRPF EK++YE+FVEGTGS EE+T LP+GLKDW
Sbjct:   80 PWDEKDFRNVV-IAAAGMLAAFLYLHFRDTGKE-ISWRDFVTYYLAKGLVERLEVVNKQYVR-----------------VLPAPGVNTSEVNYVWFNIGTVDTFERNLEQAERELGLETR-KLSVVYSTESDGSFLMNVLPTALLLGFLLFSLRRGPVSGVKGSQKSNNPLSMTESTAKIFKNNISTRFRDVAGCEEAKVEIMEFVNFLKNPKQYKELGAKIPKGAVLSGPPGTGKTLLAKATAGEAGVPFITVSGSEFLEMFVGVGAARVRDMFAMARKLAPCIIFIDEIDAVGKKRGAGNFGGQGEQENTLNQLLVEMDGFNSSTNVVVLAATNRVDVLDPALLRPGRFDRQIYIGPPDIKGRASIFKVHLRPLKLDSSLTSDALARKLAALTPGFTGADIANVCNEAALIAARHLSPAVSGVHFEQAVERVIGGLEKKTQVLQPAEKTTVAYHEAGHAVVGWFLEHADPLLKVSIVPRGKGLGYAQYLPKEQFLFTREQLFDRMCMMLGGRVAEQVFFGRITTGAQDDLRKVTQSAYAQIVQFGMSEQVGQMAFDWPQQGGVMSEKPYSEATAQLIDQEVRSLISKAFQRTHQLITDKRGLVEQVGKRLLEKEVLEKADMMELLGPRPFDEKSSYEEFVEGTGSSEEDTSLPKGLKDW 720          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Cavefish
Match: ENSAMXT00000029966.1 (pep primary_assembly:Astyanax_mexicanus-2.0:18:6368815:6385310:-1 gene:ENSAMXG00000003503.2 transcript:ENSAMXT00000029966.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 740.725 bits (1911), Expect = 0.000e+0
Identity = 367/661 (55.52%), Postives = 478/661 (72.31%), Query Frame = 1
Query:  205 PLDPRKKENIVGVLLIGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTY-WFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIK--TNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDW 2178
            P D +   N+V +   G+   + + +  ++  E + W+ FV  ++ KG++  +E++NK+Y R                 VL AP  +N  + Y WFN+G VDTFE  L + E ELG+  + ++ +VY TE   S L +++     +GFL    R    S                +   I K  I T+F DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GA+L GPPGTGKTLLAKATAGEA VPF+++SGSEFLE+FVGVG +RVRDMF+ AR  APCI+F+DEIDA+G+KR   +FGG  EQE+TLNQLLVEMDGF +  NVVVLAATNR+D+LDPALLRPGRFDRQ+Y+  P+IKGRAS+FKVHL P+K  +++  +  +RKLAA TPGF+GAD+ANVCNEAALIAAR  +  V+  HF+ A+ERVI GLE+KTQVLQP EK  VAYHEAGHAV GWFL H DPLLKVSI+PRGK LGYAQY+P++ +L T++Q+ D M M L GR +EQ+FF +  +GAQDDL+KVT++AY+QIVQ G SE+VG ++FD PQ       KPYSE TAQLID+E R ++ ++++R  +L+  K+ LVE+V  RLL+KE +EK+D++ELLGPRPF EK++YE+FVEGTGS EE+T LP+GLKDW
Sbjct:   58 PWDEKDFRNVV-IAAAGMLAAFLYLHFRDTGKE-ISWRDFVTYYLAKGLVERLEVVNKQYVR-----------------VLPAPG-VNTSENYVWFNIGTVDTFERNLEQAERELGLETR-KLSVVYSTESDGSFLMNVLPTALLLGFLLFSLRRGPVSGVKGSQKSNNPLSMTESTAKIFKNNISTRFRDVAGCEEAKVEIMEFVNFLKNPKQYKELGAKIPKGAVLSGPPGTGKTLLAKATAGEAGVPFITVSGSEFLEMFVGVGAARVRDMFAMARKLAPCIIFIDEIDAVGKKRGAGNFGGQGEQENTLNQLLVEMDGFNSSTNVVVLAATNRVDVLDPALLRPGRFDRQIYIGPPDIKGRASIFKVHLRPLKLDSSLTSDALARKLAALTPGFTGADIANVCNEAALIAARHLSPAVSGVHFEQAVERVIGGLEKKTQVLQPAEKTTVAYHEAGHAVVGWFLEHADPLLKVSIVPRGKGLGYAQYLPKEQFLFTREQLFDRMCMMLGGRVAEQVFFGRITTGAQDDLRKVTQSAYAQIVQFGMSEQVGQMAFDWPQQGGVMSEKPYSEATAQLIDQEVRSLISKAFQRTHQLITDKRGLVEQVGKRLLEKEVLEKADMMELLGPRPFDEKSSYEEFVEGTGSSEEDTSLPKGLKDW 697          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Cavefish
Match: spg7 (SPG7 matrix AAA peptidase subunit, paraplegin [Source:NCBI gene;Acc:103029937])

HSP 1 Score: 501.516 bits (1290), Expect = 1.200e-162
Identity = 262/622 (42.12%), Postives = 389/622 (62.54%), Query Frame = 1
Query:  247 LIGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEII-NKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYK-TEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFG-GHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPR-GKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEK 2100
            L+ ++I  +  N  N+    + W  FVN  + KG ++ ++++   E   + L+     F   P   ++           Y   + N+D FE  LR  ED+L I  KD+IP+ YK T +  ++L SL      +  L+ I+R                        V GK      F DVAG  EAK+E+ EFV++LKNP++Y  LGAK+P+G++L GPPG GKTLLAKA A EA VPFL+++GSEF+E+  G+G +RVR +F +AR+ APCI+++DEIDA+G+KRS    G  ++E+E TLNQLLVEMDG  T ++V+VLA+TNR DILD AL+RPGR DR +++ LP ++ R  +F+ HL  +K +   +  S +LA  TPGFSGAD+AN+CNEAAL AARE  + +   +F+ A+ERVIAG  +K+++L  +E+++VA+HE+GHA+ GW L H + ++KVSI PR   +LG+AQ +P+D YL T++Q+ + M M L GRASE I F K  +GAQDDL+KVT+ AY+ + Q G    VGH+SF   + +     +P+S+   Q +D EA++++  +Y +  +LL   +D +  +A  LL++E +   D+  LLGP P   K
Sbjct:  160 LVFIAIIMSLLNSINTSGGNISWSDFVNEMLAKGEVSWVQVVPESEMVEIHLHPGAVIFGR-PKLALM-----------YRIQVANIDKFEEKLRAAEDQLNIDAKDRIPVSYKRTGFFGNALYSLGMAAIGVAILWYIFRLAGLGVREGGFGAFNQWKMAKFTIVDGKSGKGVSFKDVAGMHEAKMEVKEFVDYLKNPERYLQLGAKVPKGSLLLGPPGCGKTLLAKAVATEAQVPFLAMAGSEFVEVIGGLGAARVRSLFKEARSRAPCIVYIDEIDAVGKKRSNNMSGFTNTEEEQTLNQLLVEMDGMGTTDHVIVLASTNRADILDNALMRPGRLDRHIFIDLPTLQERKEIFEQHLKILKLSQPADVYSLRLAELTPGFSGADIANICNEAALHAAREGHKSIDTFNFEYAVERVIAGSVKKSKILSKEEQRVVAFHESGHALVGWLLEHTEAVMKVSIAPRTNAALGFAQILPKDQYLFTKEQLFERMCMALGGRASEAITFNKVTTGAQDDLRKVTRVAYAMVKQYGMVPSVGHVSFPESEVQGPLGRRPFSQGLQQKMDHEAKMLIAHAYRKTEKLLLDNRDKLAVLANALLEREVVNYEDIEALLGPPPHGPK 769          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Sea Lamprey
Match: spg7 (SPG7 matrix AAA peptidase subunit, paraplegin [Source:ZFIN;Acc:ZDB-GENE-030131-5391])

HSP 1 Score: 473.781 bits (1218), Expect = 1.331e-154
Identity = 255/624 (40.87%), Postives = 376/624 (60.26%), Query Frame = 1
Query:  280 NVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSK---FSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMY-------IIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVN-----------FLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFG-GHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPR-GKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGP 2082
            N+      ++ W  F N  + KG +A +++            TP     + ++    V+     + R+  Y   + N+D FE  LR +E+ELGI  KD+IP++Y+          +M+       +++ I   YL + +                           G IK+ + D  GC +    I++ ++           F + P++Y  LGAK+P+GA+L GPPG GKTLL KA A EA VPFL+++GSEF+E+  G+G +RVR +F +ARA APCI+++DEIDA+G+KRS  + G  ++E+E TLNQLLVEMDG    ++V+VLA+TNR DILD AL+RPGRFDR +Y+ LP ++ R  +F+ HL  +K    +   S++LA  TPGFSGAD+ANVCNEAAL AAREN++ V    F+ A+ERVIAG  +K+++L  +E++IVA+HE+GHAV GW L+H D +LKVSI PR   +LG+AQ +PRD YL + +++ + M M L GR +E I F K  +GA+DDL+KVT+ AY+ I   G +E VGH+SF        P  +PYS    +++D EAR  V Q+Y R  +LL   +D +  +A  LL+ E +   D+++LLGP
Sbjct:   60 NLLTDTQSSVSWNDFANEMLAKGEVASVQV------------TPESEVVYVTIHPGAVISGQQRVARV--YSMRVPNIDKFEEKLRTIENELGIDPKDRIPVIYRRTSMLQRNCEIMFQTRIAIALVHDIA--YLQFNTF--------------------------GYIKSTWIDNVGCAQEG-SILQLISGPATPTSPTSPFSQAPERYLQLGAKVPKGALLLGPPGCGKTLLGKAVATEAQVPFLAMAGSEFVEVIGGLGAARVRSLFKEARARAPCIVYIDEIDAVGKKRSRNTGGFANTEEEQTLNQLLVEMDGMGPKDHVIVLASTNRADILDGALMRPGRFDRHIYIDLPTLQERREIFEQHLKSLKLAQLETHYSQRLAELTPGFSGADIANVCNEAALHAARENSKSVGVDDFEYAVERVIAGTAKKSKILSKEERRIVAFHESGHAVTGWLLQHTDAVLKVSIAPRTNAALGFAQILPRDQYLHSTEELFERMCMALGGRVAEAITFNKVTNGAEDDLRKVTRLAYNMIRSFGMNEVVGHVSFPSADEEGVPGRRPYSRALQEVMDHEARKTVAQAYRRTEKLLLENRDKLILLAEALLEHEVVSYDDIVKLLGP 640          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Sea Lamprey
Match: si:ch1073-174d20.2 (si:ch1073-174d20.2 [Source:ZFIN;Acc:ZDB-GENE-121214-51])

HSP 1 Score: 426.402 bits (1095), Expect = 5.583e-142
Identity = 202/288 (70.14%), Postives = 240/288 (83.33%), Query Frame = 1
Query: 1003 PSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNV--DKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHL 1860
            P +VRDMF  AR +APCILF+DEIDA+GRKR   +FGG SEQE+TLNQLLVEMDGF T  NVV LA TNR DILDPALLRPGRFDRQ++V  P+IKGRAS+FKVHL P+KT +  DK   SRKLAA TPGF+GAD+ANVCNEAALIAAR   E ++ KHF+ AIERVI GLE+KTQVLQP+EK+ VAYHE+GHAVAGW+L H DPLLKVSIIPRGK LGYAQY+P++ YL +Q+Q+ D M MTL GR +EQ+FF +  +GAQDDL+KVT++AY+QIVQ G +EKVG +
Sbjct:    1 PPQVRDMFQLARKNAPCILFIDEIDAVGRKRGRGNFGGQSEQENTLNQLLVEMDGFNTTTNVV-LAGTNRPDILDPALLRPGRFDRQIFVGAPDIKGRASIFKVHLKPLKTELALDKAAISRKLAALTPGFTGADIANVCNEAALIAARHLNEAISEKHFEQAIERVIGGLEKKTQVLQPEEKRTVAYHESGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYSQEQLFDRMCMTLGGRVAEQLFFGRITTGAQDDLRKVTQSAYAQIVQFGMNEKVGQV 287          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Sea Lamprey
Match: yme1l1b (YME1-like 1b [Source:ZFIN;Acc:ZDB-GENE-070410-25])

HSP 1 Score: 335.109 bits (858), Expect = 1.801e-101
Identity = 181/450 (40.22%), Postives = 277/450 (61.56%), Query Frame = 1
Query:  766 FSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIK--TNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPR-DVYLMTQDQMLDSMGMTLAGRASEQIFF--EKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEK 2100
            F  V G +EAK E+ + V FLKNP K+  LG K+P+G +L GPPGTGKTL+A+A AGEA+VPF   SGSEF E+FVGVG SR+R++F +A+A+APC++F+DE+D++G KR       +S Q  T+NQLL EMDGFK  E V+V+ ATN  + LD AL+RPGRFD QV V  P++KGR  + K++L+ +K  + VD    +R     T GF+GA++ N+ N+AAL AA +  E V+    + A ++++ G E+++  +    K I AYHE GHA+  ++ +   P+ K +I+PRG +LG+   +P  D +  T+ Q+L  M +++ GR +E+I F  +   +GA  D +  TK A   + + G SEK+G +         Y   +  S +T   I+ E R +++ SYER   +LK+     + +A  LL  E ++  ++  +L  +   E+
Sbjct:  291 FEQVKGADEAKEELQDVVQFLKNPQKFTVLGGKLPKGILLVGPPGTGKTLMARAVAGEADVPFYYASGSEFDEMFVGVGASRIRNLFREAKANAPCVIFIDELDSVGGKRIESPMHPYSRQ--TINQLLAEMDGFKPNEGVIVIGATNFPEALDNALVRPGRFDMQVTVPRPDVKGRTEILKLYLSKVKMESGVDPMTIARG----TVGFTGAELENLVNQAALKAAMDGKEVVSMVELEYAKDKILMGTERRSAEIDLKNKTITAYHEGGHALVAFYTKDAMPINKATIMPRGPTLGHVSLLPEDDRWSETKAQLLAQMDVSMGGRVAEEIIFGLDNITTGASSDFETATKIASLMVTRFGMSEKLGVMI--------YKDQEKLSPETQSAIETEVRALLRDSYERARNILKAHSREHKLLAEALLKYETLDAREIRSVLEGKCLEER 726          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Sea Lamprey
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6547])

HSP 1 Score: 213.772 bits (543), Expect = 3.018e-61
Identity = 109/248 (43.95%), Postives = 156/248 (62.90%), Query Frame = 1
Query:  760 TKFSDVAGCEEAKIEIIEFVNF-LKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVI 1500
            + +  + G ++   EI E +   +K+P+ + ALG   P+G +L GPPGTGKTLLA+A A      F+ +SGSE ++ F+G G   VR++F  AR HAP I+F+DEID+IG  R     GG SE + T+ +LL ++DGF+  +N+ V+ ATNRIDILDPALLRPGR DR++    PN + R  + K+H    K N+ +    RK+A   PG SGA+V  VC EA + A RE    VT + F+ A+ +V+
Sbjct:  150 STYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSR--KMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVM 395          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010299.1 (pep scaffold:Pmarinus_7.0:GL479893:343:6144:1 gene:ENSPMAG00000009320.1 transcript:ENSPMAT00000010299.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.971 bits (489), Expect = 6.389e-54
Identity = 100/248 (40.32%), Postives = 152/248 (61.29%), Query Frame = 1
Query:  763 KFSDVAGCEEAKIEIIEFVNF-LKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIA 1503
            ++SDV G ++   E++E +   + + +++  LG + P+G ++ GPPGTGKTLLA+A A +    FL ++G + +++F+G G   VRD F+ A+  AP I+F+DE+DAIG KR      G  E + T+ +LL ++DGF+    V V+AATNR+DILDPALLR GR DR++   +PN + RA + ++H    K NV  +    +LA  T  F+GA    VC EA +IA R  A  +T + +   I  V A
Sbjct:  160 QYSDVGGLDKQIQELVEAIVLPMTHKERFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIH--SRKMNVSPDVNFEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMDGILEVQA 405          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Yeast
Match: AFG3 (Mitochondrial inner membrane m-AAA protease component; mediates degradation of misfolded or unassembled proteins; also required for correct assembly of mitochondrial enzyme complexes; involved in cytoplasmic mRNA translation and aging; expression of human homolog AFG3L2 can complement yeast yta12 afg3 double mutant [Source:SGD;Acc:S000000819])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 321/648 (49.54%), Postives = 426/648 (65.74%), Query Frame = 1
Query:  244 LLIGLSIGYTWY-----NVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYS-FSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXX-----QSTVKVIGK-GEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRS-GKSFGG-HSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLA-----PIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGK-SLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKT-TYEDFVE 2124
            L IG +I +T       N  +     L +Q F   +++KG++++I ++NK      L                     +N  +   F +G+VD FE  + +++D L I  +D+IPI Y    S F+ L   +  I  +G LY I R + SS   + G  G    G     +S  K+  K  +IK  F +VAGC+EAK EI+EFV+FLKNP KY  LGAKIPRGAIL GPPGTGKTLLAKATAGEANVPFLS+SGSEF+E+FVGVG SRVRD+F+QAR+ AP I+F+DEIDAIG++R  G + GG + E+E+TLNQLLVEMDGF T + VVVLA TNR D+LD AL+RPGRFDR + +  P++ GR  ++ VHL      P+ T+ D N  S KLA  TPGF+GAD+AN CNEAALIAAR N   +T  HF+ AIERVIAGLE+KT+VL  +EK+ VAYHEAGHAV GWFL++ DPLLKVSIIPRG+ +LGYAQY+P D YL++++Q    M M L GR SE++ F    SGA DD +KVT+ A + +  LG S K+G+LSFD     ++ ++KP+S +TA+ ID E + +V  ++    ELL    D V+ VA  LL KE I + D++ LLGPRPF E+   +E +++
Sbjct:  122 LTIGFTIIFTLLTPSSNNSGDDSNRVLTFQDFKTKYLEKGLVSKIYVVNKFLVEAEL---------------------VNTKQVVSFTIGSVDIFEEQMDQIQDLLNIPPRDRIPIKYIERSSPFTFLFPFLPTIILLGGLYFITRKINSSPPNANGGGGGGLGGMFNVGKSRAKLFNKETDIKISFKNVAGCDEAKQEIMEFVHFLKNPGKYTKLGAKIPRGAILSGPPGTGKTLLAKATAGEANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALGGANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVNGRQQIYLVHLKRLNLDPLLTD-DMNNLSGKLATLTPGFTGADIANACNEAALIAARHNDPYITIHHFEQAIERVIAGLEKKTRVLSKEEKRSVAYHEAGHAVCGWFLKYADPLLKVSIIPRGQGALGYAQYLPPDQYLISEEQFRHRMIMALGGRVSEELHFPSVTSGAHDDFKKVTQMANAMVTSLGMSPKIGYLSFD-QNDGNFKVNKPFSNKTARTIDLEVKSIVDDAHRACTELLTKNLDKVDLVAKELLRKEAITREDMIRLLGPRPFKERNEAFEKYLD 746          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Yeast
Match: YTA12 (Mitochondrial inner membrane m-AAA protease component; mediates degradation of misfolded or unassembled proteins; also required for correct assembly of mitochondrial enzyme complexes; overexpression of human AFG3L2 complements respiratory defect of yeast afg3 yta12 double null mutation, but overexpression of disease-associated AFG3L2 variants does not; expression of both human SPG7 (paraplegin) and AFG3L2 complements yeast yta12 afg3 double mutation [Source:SGD;Acc:S000004695])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 297/607 (48.93%), Postives = 416/607 (68.53%), Query Frame = 1
Query:  307 LPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPI-----GFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSF-GGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGK-SLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSR-DYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKT 2103
            + WQ F    + KG +A++ ++NK   +++LN      +            N  R   Y+F +G++D+FE+ L+K +DEL I    +IP++Y  E +++     M+ I P      G ++L  RS +++     G  G         K   + ++K KF DVAGC+EAK EI+EFV+FLK P +Y  +GAKIPRGAIL GPPGTGKTLLAKATAGEA VPF  +SGSEF+E+FVGVG +RVRD+F  AR +AP I+F+DEIDAIG+ R   +F G + E+E+TLNQ+LVEMDGF   ++VVVLA TNR DILD ALLRPGRFDR + +  P ++GR ++F VHL  +K   +  +   +LAA TPGFSGAD+ANVCNEAALIAAR + + V   HF+ AIERVI G+E+K+++L P+EKK+VAYHEAGHAV GW+L++ DPLLKVSIIPRG+ +LGYAQY+P D++L+T+ Q+ D M M+L GR SE++ F    SGA DD +KVT  A + + +LG S+K+G +++   Q R D  ++KP+S++T  +ID E   +V++ ++R  +LLK K + VEK+A  LL KE + + D+++LLG RPF E+ 
Sbjct:  206 ITWQDFREKLLAKGYVAKLIVVNKSMVKVMLNDNGKNQAD-----------NYGR-NFYYFTIGSIDSFEHKLQKAQDELDIDKDFRIPVLYVQEGNWAKA---MFQILPTVLMIAGIIWLTRRSAQAAGGSRGGIFGLSRSKAK--KFNTETDVKIKFKDVAGCDEAKEEIMEFVSFLKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAGEAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSGANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEGRKAIFAVHLHHLKLAGEIFDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDAVKLNHFEQAIERVIGGVERKSKLLSPEEKKVVAYHEAGHAVCGWYLKYADPLLKVSIIPRGQGALGYAQYLPGDIFLLTEQQLKDRMTMSLGGRVSEELHFPSVTSGASDDFKKVTSMATAMVTELGMSDKIGWVNY---QKRDDSDLTKPFSDETGDIIDSEVYRIVQECHDRCTKLLKEKAEDVEKIAQVLLKKEVLTREDMIDLLGKRPFPERN 792          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Yeast
Match: YME1 (Catalytic subunit of i-AAA protease complex; complex is located in mitochondrial inner membrane; responsible for degradation of unfolded or misfolded mitochondrial gene products; serves as nonconventional translocation motor to pull PNPase into intermembrane space; also has role in intermembrane space protein folding; mutation causes elevated rate of mitochondrial turnover; human homolog YME1L1 can complement yeast null mutant [Source:SGD;Acc:S000006228])

HSP 1 Score: 347.436 bits (890), Expect = 4.093e-106
Identity = 192/478 (40.17%), Postives = 290/478 (60.67%), Query Frame = 1
Query:  733 KVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIK--TNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPR-DVYLMTQDQMLDSMGMTLAGRASEQIFFEK--FGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELL-GPRPFAEKTTYEDFVEGTGSFEEE 2148
            K +   +   KF DV GC+EA+ E+ E V+FLK+P KY +LG K+P+G +L GPPGTGKTLLA+ATAGEA V F  +SGSEF E++VGVG  R+RD+F+QAR+ AP I+F+DE+DAIG KR+ K     +  + TLNQLLVE+DGF     ++++ ATN  + LD AL RPGRFD+ V V LP+++GRA + K H+  I    NVD    +R     TPG SGA++AN+ N+AA+ A ++NA  V   HF+ A ++++ G E+KT VL    +K  A+HEAGHA+   +     PL K +I+PRG++LG    +P  D   +T+ +    + + + G+ +E++ + K    SG   DLQ  T  A + + Q G S+ VG ++     S ++   + +S +   + D E   ++K S ER   LL  K   + ++A  L++ E ++  ++ ++  G +    KT+    VEG  S E +
Sbjct:  269 KSVDVAKTNVKFDDVCGCDEARAELEEIVDFLKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARATAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD---QAYAKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDVRGRADILKHHMKKITLADNVDPTIIARG----TPGLSGAELANLVNQAAVYACQKNAVSVDMSHFEWAKDKILMGAERKTMVLTDAARKATAFHEAGHAIMAKYTNGATPLYKATILPRGRALGITFQLPEMDKVDITKRECQARLDVCMGGKIAEELIYGKDNTTSGCGSDLQSATGTARAMVTQYGMSDDVGPVNL----SENW---ESWSNKIRDIADNEVIELLKDSEERARRLLTKKNVELHRLAQGLIEYETLDAHEIEQVCKGEKLDKLKTSTNTVVEGPDSDERK 732          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Yeast
Match: RPT6 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; bound by ubiquitin-protein ligases Ubr1p and Ufd4p; localized mainly to the nucleus throughout the cell cycle; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003016])

HSP 1 Score: 212.616 bits (540), Expect = 5.074e-61
Identity = 107/248 (43.15%), Postives = 159/248 (64.11%), Query Frame = 1
Query:  760 TKFSDVAGCEEAKIEIIEFVNF-LKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVI 1500
            + +  V G  +   EI E +   +K+P+ + +LG   P+G IL GPPGTGKTLLA+A A   +  F+ +SG+E ++ ++G G   VR++F  AR HAP I+F+DEID+IG  R   S GG SE + T+ +LL ++DGF+T +N+ ++ ATNR+DILDPALLRPGR DR++    P++  RA + ++H    K N+ +    RK+A +  G SGADV  VC EA + A RE    VT + F+ A+ +V+
Sbjct:  145 STYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSR--KMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVM 390          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Yeast
Match: RPT1 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; required for optimal CDC20 transcription; interacts with Rpn12p and Ubr1p; mutant has aneuploidy tolerance [Source:SGD;Acc:S000001628])

HSP 1 Score: 200.29 bits (508), Expect = 3.757e-56
Identity = 101/251 (40.24%), Postives = 159/251 (63.35%), Query Frame = 1
Query:  766 FSDVAGCEEAKIEIIEFVNF-LKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQ 1515
            +SDV GC++   ++ E V   L +P+++A LG   P+G +L GPPGTGKTL A+A A   +  F+ + GSE ++ +VG G   VR++F  AR    CI+F DEIDA+G  R     GG +E + T+ +L+ ++DGF    N+ V+ ATNR + LDPALLRPGR DR+V  SLP+++GRA++F++H   +  +V++      ++   P  +GA++ +VC EA + A R   +  T K F  A+++VI+G ++
Sbjct:  208 YSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSM--SVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKK 456          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Nematostella
Match: EDO40553 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S706])

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 366/636 (57.55%), Postives = 458/636 (72.01%), Query Frame = 1
Query:  313 WQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSF-SSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGK-GEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRS-GKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLK----DWNKEVPKP 2199
            WQ F  N+++KG + ++ + NK   ++   S P   +                     F +G+V+ FE  L  ++ E+ I     +P+ Y  E  +   +  L   +  IG L    R + + + G   +  F    Q+T K   K   +K KF DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GAIL GPPGTGKTLLAKA AGEA VPFLSISGSEFLE+FVGVGP+RVRD+F+QAR +APCI+F+DEIDA+GR R  G  FGGH E+E+TLNQLLVEMDGF +  NVVVL+ TNR D+LDPALLRPGRFDRQ+++  P+IKGR S+FKVHL PIK NVD+ + +RK+AA TPGF+GAD+ANVCNEAALIAAR  A  V  KHF+ AIERVI GLE+KTQVLQP+EKK VAYHEAGHAVAGWFL H DPLLKVSIIPRGK LGYAQY+P++ YL T +Q+LD M MTL GR SEQ+FF+K  +GAQDDL KVTK+AY+Q+V  G + K+G++SFDLP+  +    KPYSE TAQLIDE+AR ++  +Y R  ELL+  KD VEKVA RLL+KE +++ D+++LLGPRPF EK+TYE+FV GTGS  E+T LP+GL+    D   E P P
Sbjct:   12 WQEFRTNYLEKGDVEKLIVSNKSQVKVYPKSDPHNGA-------------------LTFTIGSVENFERNLESVQQEMNIDPSYWVPVTYVKESEWIKEVIKLTPTLLIIGALIYFSRRLSAGTKGQGVSGIFGVG-QTTAKFYNKETAVKMKFKDVAGCEEAKLEIMEFVNFLKNPQQYHELGAKIPKGAILSGPPGTGKTLLAKAVAGEAGVPFLSISGSEFLEMFVGVGPARVRDLFAQARKNAPCIIFIDEIDAVGRARGRGGQFGGHDERENTLNQLLVEMDGFSSSTNVVVLSGTNRPDVLDPALLRPGRFDRQIHLPAPDIKGRCSIFKVHLKPIKKNVDEEKLARKMAALTPGFTGADIANVCNEAALIAARYLAPFVEEKHFEQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWFLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTTEQLLDRMCMTLGGRVSEQLFFQKITTGAQDDLSKVTKSAYAQVVTYGMNSKLGNVSFDLPREGEPSFDKPYSEATAQLIDEQARELINSAYGRTTELLEKHKDDVEKVAKRLLEKEVLDREDMIDLLGPRPFKEKSTYEEFVAGTGSETEDTSLPKGLQGLQNDDEPEAPAP 627          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Nematostella
Match: EDO31422 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXY8])

HSP 1 Score: 528.094 bits (1359), Expect = 1.003e-175
Identity = 266/560 (47.50%), Postives = 384/560 (68.57%), Query Frame = 1
Query:  481 YWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYS-FSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQST-----VKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKR-SGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPR-GKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGS 2136
            Y F++ ++D+FE  +   + EL IS ++ +PI Y+T+   FS+L +    +  IG ++ +    +    G KG         S       + I   +I + F DVAG +EAK+E++EFV++LK+  +Y  LGAKIP+GA+L GPPGTGKTLLAKA A EA+VPFLS++GS+F+E+F GVG +RVRD+F++AR  APCI+++DE+DAIGR R S +S GGH+EQE+TLNQLLVEMDG  T + V++LA+TNR DILD ALLRPGRFDR + + LP +  R  +F+VHL  +      ++ +++LA  TPG SGAD+AN+CNEAAL AAR N + V  K+F+ A+ERVIAG+E++T  + PDE++IVAYHEAGHA+ GW L H +PLLKVSI+PR   SLGYAQY+P D  L T +Q+ D M M L GRA+E   F +  +GA+DDL+KVT  AY QI+  G +++VG++SF + +S+++   KPYS+  + LIDEE RL++ ++++    +L    D ++ +A  L+ KE +   D+  L+GP P+ +K    D  + T +
Sbjct:   75 YVFSIASLDSFEKKIHHAQSELRISPQEFVPIKYRTQNELFSTLVAAATSLAIIGVVWYLLAGRRVPGGGRKGGILGSNPFVSNSYKLHYEQIYDQKIPSMFKDVAGMQEAKMEVMEFVDYLKSAGRYTQLGAKIPKGALLVGPPGTGKTLLAKAVATEADVPFLSMAGSDFVEMFAGVGSARVRDLFTRARKLAPCIVYIDEVDAIGRSRKSSRSMGGHNEQENTLNQLLVEMDGMNTLDGVIMLASTNRADILDNALLRPGRFDRHIAIDLPTLPERMEIFEVHLKKLTLKRSIDQYTKRLAELTPGHSGADIANICNEAALHAARLNKKNVDTKNFEYAVERVIAGMEKRTHTMSPDERRIVAYHEAGHALVGWMLEHTEPLLKVSIVPRTNASLGYAQYLPSDQKLYTTEQLFDRMCMALGGRAAEGKIFRRITTGAEDDLRKVTDMAYRQIITYGMNDRVGNISFPVKKSQEFG-KKPYSDHLSHLIDEEVRLLISRAFDATDNILTKHSDKLKVLAEELIKKEVLNYDDISSLIGPCPYGDKRARIDKWDTTAT 633          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Nematostella
Match: EDO49472 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG54])

HSP 1 Score: 352.058 bits (902), Expect = 2.757e-110
Identity = 192/449 (42.76%), Postives = 280/449 (62.36%), Query Frame = 1
Query:  757 KTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAAR-TPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMP-RDVYLMTQDQMLDSMGMTLAGRASEQIFF--EKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPF 2091
            K +F DV G +EAK E+ E V FL+NP+K+  LG K+P G +L G PGTGKTLLAKA AGEA VPF   SGSEF E+FVGVG +RVR++F+ A+ HAPCI+FVDE+DAIG  R       +S    TLNQLLVE+DGF+  E +VV+ ATN  ++LD AL+RPGRFD ++ V +P+++ R ++ KVHL  +  +   NE   ++ AR T GFSGAD+AN+ N+AAL AA      V  KH + A +++I G E+K+ V+  + +KIVAYHE GHA+  ++     PL K +I+PRG++LG    +P +D    T+ Q+L  + +++AGR +E+I F  E   +GA  D Q  T  A + +   G SEKVG +     ++         S  T  LI+ E + ++ ++YER   +L+S+    +++A  LL  E +   ++  ++   P 
Sbjct:   61 KFRFEDVQGVDEAKEELQEVVEFLRNPEKFKRLGGKLPTGVLLIGSPGTGKTLLAKAVAGEAGVPFFFCSGSEFDEMFVGVGAARVRNLFAAAKEHAPCIVFVDELDAIGGSRVVHDHQPYSRM--TLNQLLVELDGFEKSEGIVVIGATNFPEVLDKALVRPGRFDTKINVPMPDVRARLNILKVHLKNVTIS---NEVDIEVLARGTSGFSGADLANLVNQAALKAATSGDSSVMNKHLEYAKDKIIMGPERKSAVINSENRKIVAYHEGGHALVAFYTEGSLPLHKATIMPRGQALGMVSQLPEKDELQWTKKQLLARIDVSMAGRVAEEIIFGKENITTGASSDFQAATNLAKAMVTTYGMSEKVGTVQVKEDET--------LSPDTRLLIENEVKHLLAEAYERAKNILQSQAKEHKRLAEALLKYETLNAEEIGRVIRGEPI 496          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Nematostella
Match: EDO49524 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGH4])

HSP 1 Score: 210.305 bits (534), Expect = 7.616e-60
Identity = 107/248 (43.15%), Postives = 155/248 (62.50%), Query Frame = 1
Query:  760 TKFSDVAGCEEAKIEIIEFVNF-LKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVI 1500
            + +  V G ++   EI E +   +K+P+ + ALG   P+G +L GPPGTGKTLLA+A A      F+ +SGSE ++ F+G G   VR++F  AR HAP I+F+DEID+IG  R     GG SE + T+ +LL ++DGF+  +N+ V+ ATNRIDILD ALLRPGR DR++    PN + R  + K+H    K N+ +    +K+A   PG SGA++  VC EA + A RE    VT + F+ A+ +V+
Sbjct:  138 STYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIDQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARQDILKIHSR--KMNLTRGINLKKIAELMPGASGAEIKGVCTEAGMYALRERRVHVTQEDFEMAVTKVM 383          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Nematostella
Match: EDO37473 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFJ3])

HSP 1 Score: 198.749 bits (504), Expect = 1.767e-55
Identity = 103/246 (41.87%), Postives = 153/246 (62.20%), Query Frame = 1
Query:  766 FSDVAGCEEAKIEIIEFVNF-LKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVI 1500
            +SD+ GC+E   ++ E V   L +P+++  LG + P+G +L GPPGTGKTL A+A A   +  F+ + GSE ++ +VG G   VR++F  AR    CI+F DEIDAIG  R     GG +E + T+ +L+ ++DGF    N+ VL ATNR D LDPAL+RPGR DR+V   LP+++GRA +FK+H   +  +V+++     LA   P  +GA++ +VC EA + A R   +  T K F  A+ +VI
Sbjct:  175 YSDIGGCKEQIDKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRAHIFKIHARSM--SVERDIRYELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVNKVI 418          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Medaka
Match: afg3l2 (AFG3 like matrix AAA peptidase subunit 2 [Source:NCBI gene;Acc:101168241])

HSP 1 Score: 783.097 bits (2021), Expect = 0.000e+0
Identity = 383/642 (59.66%), Postives = 482/642 (75.08%), Query Frame = 1
Query:  271 TWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTY-WFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIK--TNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKE 2187
            T+Y         + W+ FVNN++ KG++  +E++NK Y +++                  AP        Y WFN+G+VDTFE  L   + E GI  ++++P+VY TE   + L S++  +  IGFL  + R   + +       G       T   I K EI  KF DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GAIL GPPGTGKTLLAKATAGEANVPF++++GSEFLE+FVGVGP+RVRD+F  AR +APCILF+DEIDA+GRKR   +FGG SEQE+TLNQLLVEMDGF T  NVVVLA TNR DILDPAL+RPGRFDRQ+Y+  P+IKGRAS+FKVHL P+K  T++DK+  +RK+AA TPGFSGAD+ANVCNEAALIAAR  ++ +  KHF+ AIERVI GLE+KTQVLQP+EKK VAYHEAGHAVAGWFL H DPLLKVSIIPRGK LGYAQY+P++ YL T++Q+LD M MTL GR SE+IFF +  +GAQDDL+KVT++AY+QIVQ G ++KVG +SFDLP+  +  + KPYSE TA+LID E R+++ ++YER  +LL+ KK  VE VA RLL+KE ++K+D++ELLG RPF EK+TYE+FVEGTG  EE+T LPEGLKDWN+E
Sbjct:  155 TYYFFLRDGGREVTWKDFVNNYLSKGVVDRLEVVNKRYVKVVF-----------------APGKTPVDGQYVWFNIGSVDTFERNLETAQYEFGIEGENRLPVVYSTESDGTFLLSMLPTVLIIGFLLFMLRRGPAGAGRPGRGMGGLFSVSETTAKILKDEIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVNGSEFLEMFVGVGPARVRDLFVMARKNAPCILFIDEIDAVGRKRGRGNFGGQSEQENTLNQLLVEMDGFNTASNVVVLAGTNRPDILDPALMRPGRFDRQIYIGPPDIKGRASIFKVHLRPLKLATDMDKDALARKMAALTPGFSGADIANVCNEAALIAARHLSDNINQKHFEQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWFLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQIVQFGMNQKVGQVSFDLPRQGEMVLEKPYSEATARLIDTEVRILISEAYERTKQLLQDKKGEVEMVAQRLLEKEVLDKNDMVELLGKRPFTEKSTYEEFVEGTGGEEEDTTLPEGLKDWNQE 779          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Medaka
Match: si:ch1073-174d20.2 (AFG3-like protein 1 [Source:NCBI gene;Acc:101157690])

HSP 1 Score: 764.222 bits (1972), Expect = 0.000e+0
Identity = 376/639 (58.84%), Postives = 478/639 (74.80%), Query Frame = 1
Query:  277 YNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKT--NVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKE 2187
            Y  +    + + W+ FV+ ++ +G +  +E++NK++ R+IL                  P         WFN+G+VDTFE  L     ELG+    +  +VY +E   S L S++  +  IGFL L          G+ G R  F   +ST K++ K  I  KF DVAGCEEAK+EI+EFVNFLKNP +Y  LGAKIP+GA+L GPPGTGKTLLAKATAGEANVPF++++GSEFLE+FVGVGP+RVRDMF+ AR +APCILF+DEIDA+GRKR G +FGG SEQE+TLNQLLVEMDGF T  NVVVLA TNR DILDPAL+RPGRFDRQ+Y+  P+IKGRAS+FKVHL PIK   ++DK+  +R++AA TPGF+GAD+ANVCNEAALIA+R     V  KHF+ AI+RVI GLE+KTQVLQP EKK VAYHEAGHAV GWFL+H DPLLKVSIIPRGK LGYAQY+PR+ YL +++Q+ D M M L GR +EQ+FF +  +GAQDDL+KVT++AY+Q+VQ G S+KVG +SFDLP+  +  + KPYSE TA+LID+E R +V ++YE  L+L++ K+DLVE V  RLL+KE + K+D+LELLGPRPF EK+TYE+FVEGTGSFEE+T LP+GL+ WN+E
Sbjct:  128 YFYFRDGGQEITWKDFVHRYLGRGTVDRLEVVNKQFVRVIL-----------------VPGAEAEASYVWFNIGSVDTFERNLEAAHVELGLEPSHRAAVVYNSESDGSFLMSMIPTLLLIGFL-LFTLRRGPMGGGAGGGRSPFSMSESTAKMM-KDNIDVKFKDVAGCEEAKLEIMEFVNFLKNPQQYLDLGAKIPKGAVLSGPPGTGKTLLAKATAGEANVPFITVNGSEFLEMFVGVGPARVRDMFALARKNAPCILFIDEIDAVGRKRGGGNFGGQSEQENTLNQLLVEMDGFNTATNVVVLAGTNRPDILDPALMRPGRFDRQIYIGPPDIKGRASIFKVHLRPIKVEPSLDKDALARRMAAATPGFTGADIANVCNEAALIASRYLEPSVNGKHFEQAIDRVIGGLEKKTQVLQPSEKKTVAYHEAGHAVTGWFLQHADPLLKVSIIPRGKGLGYAQYLPREQYLYSKEQLFDRMCMMLGGRVAEQVFFGRITTGAQDDLKKVTQSAYAQVVQFGMSDKVGQVSFDLPRQGETVLEKPYSEATAELIDQEVRGLVDRAYEHTLQLIQHKRDLVEMVGKRLLEKEVLVKADMLELLGPRPFEEKSTYEEFVEGTGSFEEDTSLPKGLEGWNQE 747          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Medaka
Match: ENSORLT00000011850.2 (AFG3-like protein 1 [Source:NCBI gene;Acc:101159734])

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 307/633 (48.50%), Postives = 436/633 (68.88%), Query Frame = 1
Query:  205 PLDPRKKENIVGVLLIGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIK--TNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAE 2097
            PLD R  +N+  V   G++  + +++   +  + + W+ FV+ ++ +G++  +E++NKEY +           + P + V     N + +   WFN+G+V +FE+ L   + E+G S  D+IP++Y  E   +   S++ ++  +G   +  R      + S   +G       +     K  I  +F DVAGCE+AK+EI+E VNFLK+P +Y  LGAK P+GA+L GPPGTGKTLLAKATAGE +VPF+S++GSEF E+FVGVGP+R+RD+F +A + APCILF+DEIDA+GRKR   ++   SEQE+TLNQLLVEMDGF +  NVVVLA+TNR DILDPAL+RPGRFDR +Y+  P++KGRAS+FKVHL P+K  T +D     R LAA TP F+GA++A VCNEAALIAAR   + +  +HF+ A+ER+I G+E+K Q+LQ +EK  VAYH+AGHAV GWFL+H DP+ K+SI+PRG+SL  +QY+ ++ +L +QDQ+ D M M L GR SE IFF +  SGA DDL++ T+ AY+QIVQ G ++ VG +SFD PQ  +    +P+ E TAQLID E R ++  ++ R  +LL  KK++VEKVA  LL+KE ++++DL++LLGPRPF E
Sbjct:  111 PLDRRAFQNL-AVGAAGMATAFVYFHFRETGVQ-VSWKDFVDRYLSRGLVGRMEVVNKEYVK-----------AFPADGV-----NSSEVNYLWFNIGSVTSFEHNLELAQQEMGQSSMDKIPVLYTNESDGTIFFSILPVLLLVGLFLVSMRQGPVVGACSSRVKGNSLTVSESKARTVKDNICVRFEDVAGCEDAKLEIMELVNFLKHPHQYRDLGAKTPKGALLTGPPGTGKTLLAKATAGEVDVPFISVNGSEFQEVFVGVGPARIRDLFVKAHSMAPCILFIDEIDAVGRKRGSGNYMNQSEQENTLNQLLVEMDGFNSSTNVVVLASTNRADILDPALMRPGRFDRHIYLGPPDLKGRASIFKVHLRPLKLCTGIDVETLCRHLAALTPSFTGAEIAGVCNEAALIAARHLNQCINTEHFELAVERIIGGVEKKMQILQLEEKTTVAYHQAGHAVTGWFLKHADPIFKLSIVPRGRSLSSSQYLCKEQHLFSQDQLFDRMCMMLGGRVSEHIFFHRITSGAHDDLRRATELAYAQIVQFGMNKAVGPVSFDRPQQGNTLCERPFGESTAQLIDLEVRSLIDAAFHRTHQLLVDKKEMVEKVAKCLLEKEILDRTDLVKLLGPRPFRE 725          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Medaka
Match: ENSORLT00000038203.1 (AFG3-like protein 1 [Source:NCBI gene;Acc:101159734])

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 307/643 (47.74%), Postives = 441/643 (68.58%), Query Frame = 1
Query:  205 PLDPRKKENIVGVLLIGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIE-------IINKEYARLILNSTPSKFSSMPDEEVLQAPA---NINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIK--TNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAE 2097
            PLD R  +N+  V   G++  + +++   +  + + W+ FV+ ++ +G++ ++E        ++ +Y  L++++   +   +  E V   PA   N + +   WFN+G+V +FE+ L   + E+G S  D+IP++Y  E   +   S++ ++  +G   +  R      + S   +G       +     K  I  +F DVAGCE+AK+EI+E VNFLK+P +Y  LGAK P+GA+L GPPGTGKTLLAKATAGE +VPF+S++GSEF E+FVGVGP+R+RD+F +A + APCILF+DEIDA+GRKR   ++   SEQE+TLNQLLVEMDGF +  NVVVLA+TNR DILDPAL+RPGRFDR +Y+  P++KGRAS+FKVHL P+K  T +D     R LAA TP F+GA++A VCNEAALIAAR   + +  +HF+ A+ER+I G+E+K Q+LQ +EK  VAYH+AGHAV GWFL+H DP+ K+SI+PRG+SL  +QY+ ++ +L +QDQ+ D M M L GR SE IFF +  SGA DDL++ T+ AY+QIVQ G ++ VG +SFD PQ  +    +P+ E TAQLID E R ++  ++ R  +LL  KK++VEKVA  LL+KE ++++DL++LLGPRPF E
Sbjct:  111 PLDRRAFQNL-AVGAAGMATAFVYFHFRETGVQ-VSWKDFVDRYLSRGLVRDMEHFIFTFVSVSTQYV-LVISAQVGRMEVVNKEYVKAFPADGVNSSEVNYLWFNIGSVTSFEHNLELAQQEMGQSSMDKIPVLYTNESDGTIFFSILPVLLLVGLFLVSMRQGPVVGACSSRVKGNSLTVSESKARTVKDNICVRFEDVAGCEDAKLEIMELVNFLKHPHQYRDLGAKTPKGALLTGPPGTGKTLLAKATAGEVDVPFISVNGSEFQEVFVGVGPARIRDLFVKAHSMAPCILFIDEIDAVGRKRGSGNYMNQSEQENTLNQLLVEMDGFNSSTNVVVLASTNRADILDPALMRPGRFDRHIYLGPPDLKGRASIFKVHLRPLKLCTGIDVETLCRHLAALTPSFTGAEIAGVCNEAALIAARHLNQCINTEHFELAVERIIGGVEKKMQILQLEEKTTVAYHQAGHAVTGWFLKHADPIFKLSIVPRGRSLSSSQYLCKEQHLFSQDQLFDRMCMMLGGRVSEHIFFHRITSGAHDDLRRATELAYAQIVQFGMNKAVGPVSFDRPQQGNTLCERPFGESTAQLIDLEVRSLIDAAFHRTHQLLVDKKEMVEKVAKCLLEKEILDRTDLVKLLGPRPFRE 750          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Medaka
Match: spg7 (SPG7 matrix AAA peptidase subunit, paraplegin [Source:NCBI gene;Acc:101169593])

HSP 1 Score: 497.664 bits (1280), Expect = 2.923e-161
Identity = 263/635 (41.42%), Postives = 393/635 (61.89%), Query Frame = 1
Query:  211 DPRKKENIVGVLLIGLSIGYTWYNVYNSMYETLPWQSFVNNFVKKGMIAEIEII-NKEYARLILNSTPSKFSSMPDEEVLQAPANINRLK-TYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYK-TEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFG-GHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPR-GKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEK 2100
            D   +E +  + +I L +  +  N  N+    + W  FVN  + KG ++ ++++   +   + L+         P   +   P    RL   Y   + N+D FE  LR  E+EL I  KD+IP+ YK T +  +++ +L      +  L+ I+R           +            V GK      F DVAG  EAK+E+ EFV++LK+P++Y  LGAK+P+GA+L GPPG GKTLLAKA A EA VPFL+++GSEF+E+  G+G +RVR +F +ARA APCI+++DEIDA+G+KRS    G  ++E+E TLNQLLVEMDG  T ++V+VLA+TNR DILD AL+RPGR DR +++ LP ++ R  +F+ HL  +K     +  S +LA  TPGFSGAD+AN+CNEAAL AARE  + +   +F+ A+ERVIAG  +K+++L  +E+++VA+HE+GHA+ GW L H + +LKVSI PR   +LG+AQ +PRD YL T++Q+ + M M L GR +E I F K  +GAQDDL+KVT+ AYS + Q G  + VG +SF   + +     +P+S+   + +D EA++++ ++Y    +LL   +D +  +A  LL++E +   D+  LLGP P   K
Sbjct:  148 DQMYRERLRTLFIIALIM--SLLNSINTSGGNISWNDFVNEMLAKGEVSRVQVVPESDIVEIYLH---------PGAVIFGRP----RLALMYRMQVANIDKFEEKLRAAEEELNIDTKDRIPVSYKRTGFFGNAVYALGMAAIGVAILWYIFRLAGMGGREGGFSAFNQLKMAKFTIVDGKSGKGVSFKDVAGMHEAKMEVKEFVDYLKSPERYLQLGAKVPKGALLLGPPGCGKTLLAKAVATEAQVPFLAMAGSEFVEVIGGLGAARVRSLFKEARARAPCIVYIDEIDAVGKKRSTNMSGFSNTEEEQTLNQLLVEMDGMGTTDHVIVLASTNRADILDNALMRPGRLDRHIFIDLPTLQERKEIFEQHLKMLKLTQPADFYSLRLAELTPGFSGADIANICNEAALHAAREGLKSIDTFNFEYAVERVIAGSVKKSKILSKEEQRVVAFHESGHALVGWLLEHTEAVLKVSIAPRTNAALGFAQMLPRDQYLFTKEQLFERMCMALGGRTAEAITFNKVTTGAQDDLRKVTRVAYSMVKQYGMCDSVGQVSFPETEEQGAVGRRPFSQGLQEQMDHEAKMLIARAYRHTEKLLLDNRDKLTLLANALLEREVVNYDDIEALLGPPPHGPK 767          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Planmine SMEST
Match: SMESG000006323.1 (SMESG000006323.1)

HSP 1 Score: 1269.22 bits (3283), Expect = 0.000e+0
Identity = 637/637 (100.00%), Postives = 637/637 (100.00%), Query Frame = 1
Query:  295 MYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKXXXXXXXXXXXXXXXXQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKEVPKPEL 2205
            MYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKSSSSGSKGARGFFGFGQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKEVPKPEL
Sbjct:    1 MYETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQAPANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSFSSLSSLMYIIYPIGFLYLIYRSMKSSSSGSKGARGFFGFGQSTVKVIGKGEIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYEDFVEGTGSFEEETQLPEGLKDWNKEVPKPEL 637          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Planmine SMEST
Match: SMESG000006322.1 (SMESG000006322.1)

HSP 1 Score: 493.041 bits (1268), Expect = 9.327e-168
Identity = 246/246 (100.00%), Postives = 246/246 (100.00%), Query Frame = 3
Query: 2394 MDKLNEILCNKCDSSIDLHDKHASFEGLIWHNNCFVCSICFEHMENILFTLENNEIICFKCYDEKFGVVCSTCQDIIKLGDEKFKLGDLVWHRKCFQCQNCRDVLSPNSFWLHDKLSYCKNCYGELFTENCEKCQQKIWKNYIKFRDTRFHSECFVCNVCEIRLSETRFLYKDELVYCDSCYSEKFCKVCVRCNDYITGIGGEEVITSNNENWHNKCFFCSSCDQSLVGLSFVGKGNQIFCPGCSK 3131
            MDKLNEILCNKCDSSIDLHDKHASFEGLIWHNNCFVCSICFEHMENILFTLENNEIICFKCYDEKFGVVCSTCQDIIKLGDEKFKLGDLVWHRKCFQCQNCRDVLSPNSFWLHDKLSYCKNCYGELFTENCEKCQQKIWKNYIKFRDTRFHSECFVCNVCEIRLSETRFLYKDELVYCDSCYSEKFCKVCVRCNDYITGIGGEEVITSNNENWHNKCFFCSSCDQSLVGLSFVGKGNQIFCPGCSK
Sbjct:    1 MDKLNEILCNKCDSSIDLHDKHASFEGLIWHNNCFVCSICFEHMENILFTLENNEIICFKCYDEKFGVVCSTCQDIIKLGDEKFKLGDLVWHRKCFQCQNCRDVLSPNSFWLHDKLSYCKNCYGELFTENCEKCQQKIWKNYIKFRDTRFHSECFVCNVCEIRLSETRFLYKDELVYCDSCYSEKFCKVCVRCNDYITGIGGEEVITSNNENWHNKCFFCSSCDQSLVGLSFVGKGNQIFCPGCSK 246          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Planmine SMEST
Match: SMESG000077944.1 (SMESG000077944.1)

HSP 1 Score: 382.104 bits (980), Expect = 1.349e-122
Identity = 190/414 (45.89%), Postives = 283/414 (68.36%), Query Frame = 1
Query:  880 ILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKN--ETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKS-LGYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEKTTYE 2112
            +L GPPG GKTLL KA A EANVPF   SG +F+++  G   +++R++F +A + AP I+F+DEIDAIG+ R   S  G S+++ TLNQLLVEMDG ++   V+V AATNR+DILD AL+RPGRFDR + V  P ++ R  LF ++L+  + ++  +    S +L+ +TPG +GAD++N+CNEAA+IA+R + + VT + FD A+ERVIAG E KT+ L   E+KI AYHEAGH + GW L++ DP+LKVSIIPR    LG+ Q   ++ YL   D ++D + + L GRA+E I F+   SGA++DL+KV+K A++ + + G SEKVGH SF + +  ++  + P+S+ T  LI+ EA  ++  +Y++   ++K  ++ +EK+A+ LL KE +   D+  L+GPRPF  K + E
Sbjct:    1 MLLGPPGCGKTLLVKALASEANVPFFYKSGPDFIDMRGGQAAAKLREVFRKASSSAPSIIFIDEIDAIGKTRGFHS--GESDEDQTLNQLLVEMDGMESVAGVIVFAATNRVDILDKALIRPGRFDRHILVDYPVLEERKELFTLYLSKNQQHIQGSIKNLSDRLSLQTPGMTGADISNICNEAAVIASRMDYKTVTNECFDIALERVIAGSESKTRFLSESERKINAYHEAGHVLVGWMLKYADPILKVSIIPRTMGLLGFTQKDFQNKYLKNYDMLVDEISVLLGGRAAESITFDYITSGAENDLKKVSKLAFNMVREWGMSEKVGHFSFQVTEQDEHSGNFPFSKYTQALIEMEANQIIVSAYKKAENVIKGNREKLEKIAVELLKKESLTFEDIETLIGPRPFGRKISNE 412          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Planmine SMEST
Match: SMESG000026563.1 (SMESG000026563.1)

HSP 1 Score: 332.798 bits (852), Expect = 1.158e-101
Identity = 173/444 (38.96%), Postives = 282/444 (63.51%), Query Frame = 1
Query:  754 IKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYM-PRDVYLMTQDQMLDSMGMTLAGRASEQIFF--EKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELL 2076
            I T F D+ GC+EAK ++   ++FL+NP+K+  LGA +PRG IL GPPG GKT LA+A AGEA VPF+  S SEF E++VGVG SRVR++F  A+AH+PC++F+DE+DAI  K+   S      Q  TL+QLL+E+DGF++ + ++VL+ATN  + LD AL+RPGRFD +V +  P+ +GR +LFK+++  +K+  D +    KLA  + GF+GA++ N+ N+AALIA   N + V  +    A +R++ G+ +K +V   +  +I A+HEAGHA+  +     + + KV+IIPR  SLG+  ++  ++ + MT+ Q+   +   LAG+ +E++ +  +K  +G  DDL++ T  A + ++ LG S+ +   ++    S         S Q   +IDEE   ++ +S+ER+ +LL    + ++ +A  LL  E ++ S++ E++
Sbjct:  125 ISTTFCDIQGCDEAKQDLENLIHFLRNPEKFNELGATLPRGVILVGPPGVGKTSLARAVAGEAKVPFIYASASEFDEMYVGVGASRVRELFESAKAHSPCVIFIDELDAISNKKVDASL--RQSQSQTLSQLLIELDGFQSTQGIIVLSATNNKEALDKALIRPGRFDLEVELVPPDFEGRKALFKLYVGKVKSIGDID--YEKLAKGSVGFTGAEIKNMVNQAALIAGMNNEKHVQSEDLWKARDRILMGVARK-KVPDDETNRITAFHEAGHALTAFLTPDSEKIHKVTIIPRNHSLGFTSFLGDKERHHMTRSQLQARIDSLLAGKIAEELIYGPDKVTTGGSDDLKRATAIAQNMVMNLGMSQNMKFRTY--SSSISGFQDSNLSSQARSMIDEEVDRILHESHERVRKLLVENTEKLKTLAENLLKHETLDNSEVSEII 561          
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Planmine SMEST
Match: SMESG000026563.1 (SMESG000026563.1)

HSP 1 Score: 332.798 bits (852), Expect = 3.034e-101
Identity = 173/444 (38.96%), Postives = 282/444 (63.51%), Query Frame = 1
Query:  754 IKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPGTGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAPCILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLAATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKNETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVIAGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSLGYAQYM-PRDVYLMTQDQMLDSMGMTLAGRASEQIFF--EKFGSGAQDDLQKVTKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARLMVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELL 2076
            I T F D+ GC+EAK ++   ++FL+NP+K+  LGA +PRG IL GPPG GKT LA+A AGEA VPF+  S SEF E++VGVG SRVR++F  A+AH+PC++F+DE+DAI  K+   S      Q  TL+QLL+E+DGF++ + ++VL+ATN  + LD AL+RPGRFD +V +  P+ +GR +LFK+++  +K+  D +    KLA  + GF+GA++ N+ N+AALIA   N + V  +    A +R++ G+ +K +V   +  +I A+HEAGHA+  +     + + KV+IIPR  SLG+  ++  ++ + MT+ Q+   +   LAG+ +E++ +  +K  +G  DDL++ T  A + ++ LG S+ +   ++    S         S Q   +IDEE   ++ +S+ER+ +LL    + ++ +A  LL  E ++ S++ E++
Sbjct:  156 ISTTFCDIQGCDEAKQDLENLIHFLRNPEKFNELGATLPRGVILVGPPGVGKTSLARAVAGEAKVPFIYASASEFDEMYVGVGASRVRELFESAKAHSPCVIFIDELDAISNKKVDASL--RQSQSQTLSQLLIELDGFQSTQGIIVLSATNNKEALDKALIRPGRFDLEVELVPPDFEGRKALFKLYVGKVKSIGDID--YEKLAKGSVGFTGAEIKNMVNQAALIAGMNNEKHVQSEDLWKARDRILMGVARK-KVPDDETNRITAFHEAGHALTAFLTPDSEKIHKVTIIPRNHSLGFTSFLGDKERHHMTRSQLQARIDSLLAGKIAEELIYGPDKVTTGGSDDLKRATAIAQNMVMNLGMSQNMKFRTY--SSSISGFQDSNLSSQARSMIDEEVDRILHESHERVRKLLVENTEKLKTLAENLLKHETLDNSEVSEII 592          
The following BLAST results are available for this feature:
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AFG3L20.000e+061.06AFG3 like matrix AAA peptidase subunit 2 [Source:H... [more]
SPG73.092e-16442.24SPG7 matrix AAA peptidase subunit, paraplegin [Sou... [more]
SPG73.160e-16342.65SPG7 matrix AAA peptidase subunit, paraplegin [Sou... [more]
SPG71.135e-16242.17SPG7 matrix AAA peptidase subunit, paraplegin [Sou... [more]
SPG78.494e-16242.17SPG7 matrix AAA peptidase subunit, paraplegin [Sou... [more]
back to top
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spg-70.000e+056.73AFG3-like protein spg-7 [Source:UniProtKB/Swiss-P... [more]
ppgn-17.479e-15242.56ParaPleGiN AAA protease family; Paraplegin [Sourc... [more]
ppgn-17.479e-15242.56ParaPleGiN AAA protease family; Paraplegin [Sourc... [more]
ymel-11.384e-11143.07ATP-dependent zinc metalloprotease YME1 homolog [... [more]
ymel-11.384e-11143.07ATP-dependent zinc metalloprotease YME1 homolog [... [more]
back to top
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG65120.000e+058.03gene:FBgn0036702 transcript:FBtr0075252[more]
CG65120.000e+059.33gene:FBgn0036702 transcript:FBtr0075251[more]
Spg73.178e-14541.80gene:FBgn0024992 transcript:FBtr0070502[more]
Spg73.178e-14541.80gene:FBgn0024992 transcript:FBtr0345716[more]
YME1L6.435e-10942.83gene:FBgn0034792 transcript:FBtr0332910[more]
back to top
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
afg3l20.000e+060.74AFG3-like AAA ATPase 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
si:ch1073-174d20.20.000e+059.00si:ch1073-174d20.2 [Source:ZFIN;Acc:ZDB-GENE-12121... [more]
AL954648.37.655e-16542.49SPG7 matrix AAA peptidase subunit, paraplegin [Sou... [more]
AL954648.27.655e-16542.49SPG7 matrix AAA peptidase subunit, paraplegin [Sou... [more]
spg73.322e-16342.42SPG7 matrix AAA peptidase subunit, paraplegin [Sou... [more]
back to top
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
afg3l20.000e+061.08AFG3-like AAA ATPase 2 [Source:NCBI gene;Acc:78021... [more]
afg3l20.000e+061.08AFG3-like AAA ATPase 2 [Source:NCBI gene;Acc:78021... [more]
afg3l20.000e+061.08AFG3-like AAA ATPase 2 [Source:NCBI gene;Acc:78021... [more]
fut10.000e+058.97fucosyltransferase 1 (H blood group) [Source:Xenba... [more]
fut10.000e+058.97fucosyltransferase 1 (H blood group) [Source:Xenba... [more]
back to top
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Afg3l20.000e+060.75AFG3-like AAA ATPase 2 [Source:MGI Symbol;Acc:MGI:... [more]
Afg3l10.000e+058.28AFG3-like AAA ATPase 1 [Source:MGI Symbol;Acc:MGI:... [more]
Spg76.809e-16341.80SPG7, paraplegin matrix AAA peptidase subunit [Sou... [more]
Spg75.047e-16141.80SPG7, paraplegin matrix AAA peptidase subunit [Sou... [more]
Afg3l13.712e-14353.01AFG3-like AAA ATPase 1 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of ATP-dependent zinc metalloprotease FtsH vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2KJI7|AFG32_BOVIN0.000e+061.02AFG3-like protein 2 OS=Bos taurus OX=9913 GN=AFG3L... [more]
sp|Q9Y4W6|AFG32_HUMAN0.000e+061.06AFG3-like protein 2 OS=Homo sapiens OX=9606 GN=AFG... [more]
sp|Q8JZQ2|AFG32_MOUSE0.000e+060.75AFG3-like protein 2 OS=Mus musculus OX=10090 GN=Af... [more]
sp|Q920A7|AFG31_MOUSE0.000e+058.28AFG3-like protein 1 OS=Mus musculus OX=10090 GN=Af... [more]
sp|Q9N3T5|AFG3_CAEEL0.000e+056.73AFG3-like protein spg-7 OS=Caenorhabditis elegans ... [more]
back to top
BLAST of ATP-dependent zinc metalloprotease FtsH vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3TJS30.000e+063.16AAA domain-containing protein OS=Rodentolepis nana... [more]
A0A3R7C0T40.000e+062.13AFG3-like protein 2 (Fragment) OS=Clonorchis sinen... [more]
H2KRB40.000e+062.13AFG3 family protein OS=Clonorchis sinensis OX=7992... [more]
A0A564YAU10.000e+062.59AAA domain-containing protein OS=Hymenolepis dimin... [more]
A0A0X3P1V90.000e+061.98AFG3-like protein 2 OS=Schistocephalus solidus OX=... [more]
back to top
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
afg3l20.000e+059.88AFG3-like AAA ATPase 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
afg3l20.000e+059.88AFG3-like AAA ATPase 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ENSAMXT00000003575.20.000e+055.37pep primary_assembly:Astyanax_mexicanus-2.0:18:636... [more]
ENSAMXT00000029966.10.000e+055.52pep primary_assembly:Astyanax_mexicanus-2.0:18:636... [more]
spg71.200e-16242.12SPG7 matrix AAA peptidase subunit, paraplegin [Sou... [more]
back to top
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spg71.331e-15440.87SPG7 matrix AAA peptidase subunit, paraplegin [Sou... [more]
si:ch1073-174d20.25.583e-14270.14si:ch1073-174d20.2 [Source:ZFIN;Acc:ZDB-GENE-12121... [more]
yme1l1b1.801e-10140.22YME1-like 1b [Source:ZFIN;Acc:ZDB-GENE-070410-25][more]
psmc53.018e-6143.95proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:... [more]
ENSPMAT00000010299.16.389e-5440.32pep scaffold:Pmarinus_7.0:GL479893:343:6144:1 gene... [more]
back to top
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AFG30.000e+049.54Mitochondrial inner membrane m-AAA protease compon... [more]
YTA120.000e+048.93Mitochondrial inner membrane m-AAA protease compon... [more]
YME14.093e-10640.17Catalytic subunit of i-AAA protease complex; compl... [more]
RPT65.074e-6143.15ATPase of the 19S regulatory particle of the 26S p... [more]
RPT13.757e-5640.24ATPase of the 19S regulatory particle of the 26S p... [more]
back to top
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO405530.000e+057.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314221.003e-17547.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494722.757e-11042.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495247.616e-6043.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374731.767e-5541.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
afg3l20.000e+059.66AFG3 like matrix AAA peptidase subunit 2 [Source:N... [more]
si:ch1073-174d20.20.000e+058.84AFG3-like protein 1 [Source:NCBI gene;Acc:10115769... [more]
ENSORLT00000011850.20.000e+048.50AFG3-like protein 1 [Source:NCBI gene;Acc:10115973... [more]
ENSORLT00000038203.10.000e+047.74AFG3-like protein 1 [Source:NCBI gene;Acc:10115973... [more]
spg72.923e-16141.42SPG7 matrix AAA peptidase subunit, paraplegin [Sou... [more]
back to top
BLAST of ATP-dependent zinc metalloprotease FtsH vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006323.10.000e+0100.00SMESG000006323.1[more]
SMESG000006322.19.327e-168100.00SMESG000006322.1[more]
SMESG000077944.11.349e-12245.89SMESG000077944.1[more]
SMESG000026563.11.158e-10138.96SMESG000026563.1[more]
SMESG000026563.13.034e-10138.96SMESG000026563.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004666 ID=SMED30004666|Name=ATP-dependent zinc metalloprotease FtsH|organism=Schmidtea mediterranea sexual|type=transcript|length=3214bp
CAACATTTCAAATATAAAGTATTAATGGTGTTATTTTTAAGATCAGCAAT
AATTAAATTTAGAATTGGCTACAGATCTTTTTTTAATTTTTCACATGTTA
AAAATAAATTAAACCTAAATAATGGTATAGTAAAATTAAATGGTAATAAT
AATAAAAAACCAGATATATTAAATTATATTAAAGAAAATTCGAGACCAGG
TGGACCATTAGATCCCAGAAAGAAAGAAAACATTGTCGGAGTTTTATTAA
TCGGATTATCTATTGGCTATACTTGGTATAACGTCTATAATTCTATGTAT
GAAACCTTGCCTTGGCAATCCTTTGTTAATAATTTTGTTAAAAAAGGTAT
GATCGCAGAAATAGAAATTATTAATAAAGAATATGCTCGACTGATATTAA
ACTCAACACCCTCAAAGTTTTCATCCATGCCTGATGAAGAAGTTCTCCAA
GCACCTGCAAATATTAATCGCCTCAAAACATATTGGTTTAACTTAGGTAA
CGTGGACACTTTTGAAAATACTTTAAGAAAACTAGAAGACGAATTGGGTA
TTAGCGTTAAAGATCAAATTCCAATTGTTTACAAAACAGAATATAGTTTT
TCATCACTCAGTTCATTGATGTATATTATATATCCGATCGGTTTTCTTTA
TTTAATTTATCGCTCAATGAAAAGCAGTTCATCTGGTAGCAAAGGAGCGA
GAGGTTTCTTTGGTTTTGGTCAGTCAACCGTTAAAGTGATAGGCAAAGGT
GAGATTAAGACTAAATTTAGCGACGTAGCCGGCTGTGAAGAAGCGAAGAT
AGAAATTATTGAATTTGTAAATTTCCTTAAAAATCCTGATAAATACGCCG
CACTCGGTGCTAAAATCCCAAGAGGAGCCATTTTGAAAGGTCCTCCTGGT
ACCGGGAAAACTTTATTAGCCAAAGCCACTGCCGGAGAGGCTAATGTTCC
GTTTCTATCGATTTCGGGTAGTGAATTTCTTGAACTGTTTGTCGGTGTTG
GCCCAAGTCGAGTTCGTGATATGTTTAGCCAGGCTCGAGCACACGCTCCT
TGCATTTTATTTGTCGATGAAATCGATGCCATCGGGCGCAAAAGGAGCGG
CAAATCGTTCGGTGGTCACAGTGAGCAAGAAAGCACTCTGAATCAGTTAC
TTGTCGAAATGGATGGATTCAAAACCTGTGAAAACGTTGTAGTGCTCGCC
GCAACGAATCGAATCGATATTCTCGATCCTGCACTTCTCAGACCCGGGAG
ATTTGATCGACAAGTATATGTCTCATTACCAAATATCAAAGGACGGGCTT
CTCTTTTTAAAGTTCATTTGGCACCCATTAAAACAAATGTCGATAAAAAT
GAAACCTCCAGAAAATTAGCGGCCAGAACACCTGGATTTTCAGGGGCAGA
CGTTGCCAATGTTTGTAATGAAGCTGCTTTGATTGCGGCAAGAGAGAATG
CAGAAGGTGTGACATTTAAACATTTCGATGCAGCAATCGAAAGAGTTATT
GCCGGTTTGGAGCAAAAAACCCAAGTTCTCCAACCAGATGAAAAAAAAAT
CGTAGCTTATCACGAAGCAGGCCACGCAGTTGCTGGTTGGTTTCTGCGTC
ACTGTGATCCGCTTCTAAAGGTTTCTATCATCCCCCGGGGGAAATCCCTG
GGATACGCACAATACATGCCGAGGGATGTCTATTTAATGACTCAAGACCA
GATGCTAGACAGCATGGGCATGACTCTTGCAGGCAGAGCAAGTGAGCAAA
TATTTTTCGAAAAATTTGGTTCCGGTGCTCAAGATGATTTGCAGAAAGTT
ACGAAAAATGCATATTCTCAAATAGTGCAATTGGGGTTCAGTGAAAAAGT
CGGACATTTGAGTTTTGATTTACCTCAATCAAGGGATTATCCAATGTCGA
AACCGTATTCAGAACAAACTGCTCAGTTAATCGACGAAGAGGCTCGTCTA
ATGGTTAAACAATCGTATGAACGAATCCTAGAATTGTTGAAATCGAAGAA
AGATTTGGTGGAGAAAGTGGCATTGAGGCTATTGGATAAAGAACAAATAG
AGAAATCGGATCTTCTCGAATTGCTTGGGCCGAGACCGTTTGCTGAGAAA
ACCACTTACGAAGACTTCGTTGAAGGAACAGGATCATTTGAGGAAGAAAC
ACAATTACCAGAAGGGCTTAAAGATTGGAATAAAGAAGTTCCCAAACCTG
AATTATGATTATTGTGTTTCAAATAAATTTTAAGTTTTAGTTTTACCTTA
CATATTTTATTACAAAATGAGTTTTGTATTTGGATAAATCGATCAATATA
AGGAAATAAATTTCGCTATATTTTTATAGAGTTTTAATTGGACAGTTTAT
TTTTATATATTCTGTGTTTGTAAAATTATGTTTATTTTTTTTGATGGATA
AATTAAATGAAATTTTATGTAACAAATGCGATAGTTCAATAGATCTCCAT
GACAAACATGCATCATTTGAAGGTTTAATTTGGCACAATAATTGCTTTGT
GTGTTCAATATGTTTTGAACATATGGAGAACATATTGTTTACTTTAGAAA
ATAACGAAATAATTTGTTTTAAATGTTATGATGAAAAATTTGGAGTGGTT
TGCAGTACATGCCAGGATATAATTAAACTGGGAGATGAAAAGTTCAAGCT
TGGAGATTTAGTTTGGCACAGAAAGTGCTTTCAATGCCAAAATTGTCGGG
ATGTTTTAAGCCCAAATTCGTTTTGGCTACATGATAAGTTGAGTTACTGT
AAAAATTGTTATGGTGAACTATTTACTGAAAATTGTGAAAAATGTCAACA
GAAAATTTGGAAAAATTATATCAAATTTAGAGATACTAGATTCCATTCGG
AATGCTTTGTATGCAATGTTTGTGAAATAAGATTATCAGAAACAAGATTT
CTATACAAAGATGAATTAGTTTACTGTGATAGTTGTTACAGCGAGAAATT
TTGTAAAGTTTGTGTCAGGTGCAATGATTATATTACAGGTATAGGGGGTG
AAGAAGTTATAACCTCTAATAATGAAAATTGGCACAATAAATGCTTCTTT
TGCAGTTCATGTGATCAGTCTCTTGTTGGCTTGAGTTTTGTGGGAAAAGG
TAATCAAATCTTTTGCCCAGGATGCTCCAAATAGTTTGAGAAATGTGTTC
CAAAGATTTATGTTATGTTATTCGAATTTAGTTTTCTTTCATTTTGATGT
TTAAGTTATATTTA
back to top

protein sequence of SMED30004666-orf-1

>SMED30004666-orf-1 ID=SMED30004666-orf-1|Name=SMED30004666-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=247bp
MDKLNEILCNKCDSSIDLHDKHASFEGLIWHNNCFVCSICFEHMENILFT
LENNEIICFKCYDEKFGVVCSTCQDIIKLGDEKFKLGDLVWHRKCFQCQN
CRDVLSPNSFWLHDKLSYCKNCYGELFTENCEKCQQKIWKNYIKFRDTRF
HSECFVCNVCEIRLSETRFLYKDELVYCDSCYSEKFCKVCVRCNDYITGI
GGEEVITSNNENWHNKCFFCSSCDQSLVGLSFVGKGNQIFCPGCSK*
back to top

protein sequence of SMED30004666-orf-2

>SMED30004666-orf-2 ID=SMED30004666-orf-2|Name=SMED30004666-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=736bp
QHFKYKVLMVLFLRSAIIKFRIGYRSFFNFSHVKNKLNLNNGIVKLNGNN
NKKPDILNYIKENSRPGGPLDPRKKENIVGVLLIGLSIGYTWYNVYNSMY
ETLPWQSFVNNFVKKGMIAEIEIINKEYARLILNSTPSKFSSMPDEEVLQ
APANINRLKTYWFNLGNVDTFENTLRKLEDELGISVKDQIPIVYKTEYSF
SSLSSLMYIIYPIGFLYLIYRSMKSSSSGSKGARGFFGFGQSTVKVIGKG
EIKTKFSDVAGCEEAKIEIIEFVNFLKNPDKYAALGAKIPRGAILKGPPG
TGKTLLAKATAGEANVPFLSISGSEFLELFVGVGPSRVRDMFSQARAHAP
CILFVDEIDAIGRKRSGKSFGGHSEQESTLNQLLVEMDGFKTCENVVVLA
ATNRIDILDPALLRPGRFDRQVYVSLPNIKGRASLFKVHLAPIKTNVDKN
ETSRKLAARTPGFSGADVANVCNEAALIAARENAEGVTFKHFDAAIERVI
AGLEQKTQVLQPDEKKIVAYHEAGHAVAGWFLRHCDPLLKVSIIPRGKSL
GYAQYMPRDVYLMTQDQMLDSMGMTLAGRASEQIFFEKFGSGAQDDLQKV
TKNAYSQIVQLGFSEKVGHLSFDLPQSRDYPMSKPYSEQTAQLIDEEARL
MVKQSYERILELLKSKKDLVEKVALRLLDKEQIEKSDLLELLGPRPFAEK
TTYEDFVEGTGSFEEETQLPEGLKDWNKEVPKPEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016887ATPase activity
GO:0008270zinc ion binding
GO:0005524ATP binding
GO:0004222metalloendopeptidase activity
GO:0000166nucleotide binding
GO:0008233peptidase activity
GO:0008237metallopeptidase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0030163protein catabolic process
GO:0006508proteolysis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR005936FtsH
IPR037219Peptidase_M41-like
IPR041569AAA_lid_3
IPR001781Znf_LIM
IPR003593AAA+_ATPase
IPR003959ATPase_AAA_core
IPR027417P-loop_NTPase
IPR000642Peptidase_M41
IPR003960ATPase_AAA_CS
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 289..428
e-value: 2.8E-20
score: 83.4
NoneNo IPR availableGENE3DG3DSA:3.40.1690.20coord: 89..199
e-value: 8.7E-21
score: 75.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 242..427
e-value: 1.9E-65
score: 222.1
NoneNo IPR availableGENE3DG3DSA:1.10.8.60coord: 428..506
e-value: 5.0E-25
score: 89.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 718..735
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 709..735
NoneNo IPR availablePANTHERPTHR43655:SF9AFG3-LIKE PROTEIN 2coord: 89..730
NoneNo IPR availablePANTHERPTHR43655FAMILY NOT NAMEDcoord: 89..730
NoneNo IPR availableCDDcd00009AAAcoord: 284..426
e-value: 1.00681E-25
score: 101.454
NoneNo IPR availableTMHMMTMhelixcoord: 198..220
NoneNo IPR availableTMHMMTMhelixcoord: 78..96
NoneNo IPR availableTMHMMTMhelixcoord: 7..24
IPR005936Peptidase, FtsHTIGRFAMTIGR01241TIGR01241coord: 203..692
e-value: 2.7E-194
score: 644.5
IPR037219Peptidase M41-likeGENE3DG3DSA:1.20.58.760coord: 509..706
e-value: 3.1E-60
score: 205.3
IPR037219Peptidase M41-likeSUPERFAMILYSSF140990FtsH protease domain-likecoord: 509..700
IPR041569AAA ATPase, AAA+ lid domainPFAMPF17862AAA_lid_3coord: 455..493
e-value: 2.2E-13
score: 49.7
IPR000642Peptidase M41PFAMPF01434Peptidase_M41coord: 509..690
e-value: 2.2E-56
score: 190.7
IPR003959ATPase, AAA-type, corePFAMPF00004AAAcoord: 294..425
e-value: 3.4E-42
score: 144.0
IPR003960ATPase, AAA-type, conserved sitePROSITEPS00674AAAcoord: 396..414
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 253..499