Condensin complex subunit 2

Overview
NameCondensin complex subunit 2
Smed IDSMED30004629
Length (bp)2458
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Condensin complex subunit 2 (SMED30004629) t-SNE clustered cells

Violin plots show distribution of expression levels for Condensin complex subunit 2 (SMED30004629) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Condensin complex subunit 2 (SMED30004629) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Condensin complex subunit 2 (SMED30004629) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004629

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30004629h1SMcG0002293 SmedASXL_017787SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30004629h1SMcG0002293 SmedASXL_017788SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30004629h1SMcG0002293 SmedASXL_077057SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30004629h1SMcG0002293 SmedASXL_077057SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30004629h1SMcG0002293 dd_Smed_v4_8491_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004629h1SMcG0002293 dd_Smed_v4_8491_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30004629h1SMcG0002293 dd_Smed_v4_8491_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Condensin complex subunit 2 vs. Ensembl Human
Match: NCAPH (non-SMC condensin I complex subunit H [Source:HGNC Symbol;Acc:HGNC:1112])

HSP 1 Score: 128.257 bits (321), Expect = 3.807e-30
Identity = 118/426 (27.70%), Postives = 202/426 (47.42%), Query Frame = 2
Query:  104 IFLNIEENDDTKEKRANRKSIVEKV------PNTLIINNQK-----LDLPNNRN-DIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVK----ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXX---XRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLREMM--AKKELEIEECNMP-EESICG-------MDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVD--KDDLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWK 1288
            +  +  +NDD KE+   R+S V  +      P  L   + +       +P   N  I +HY  CIKL++ENKI +KNAF LHLID++ + +K    E  +F+    +LDA TKIYA RVD+V  + Y+VL GLG       +       + GH++D          K    K     RT+ QNI  + ++ A  + E+DP+FQ  A +FD+   + + L+ L   D   EL   S+    +       P+    E+  D+ + + Q  E  +    +C     FQF  W   SET N    ES+  ++   KK  ++ + N   +ES CG        DD+  +  + +++A+    +E   + KE  +V   ++++I+LG       +G+  + ++  +++    +Y   + + + +WAGP  W+
Sbjct:   40 VLEDFPQNDDEKERLQRRRSRVFDLQFSTDSPRLLASPSSRSIDISATIPKFTNTQITEHYSTCIKLSTENKITTKNAFGLHLIDFMSEILKQKDTEPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGKDAPSLEE-------VEGHVADGSATEMGTTKKAVKPKKKHLHRTIEQNINNLNVSEADRKCEIDPMFQKTAASFDECSTAGVFLSTLHCQDYRSELLFPSDVQTLSTGEPLELPELGCVEMT-DLKAPLQQCAEDRQ----ICPSLAGFQFTQWD--SETHN----ESVSALVDKFKKNDQVFDINAEVDESDCGDFPDGSLGDDFDAND-EPDHTAV--GDHEEFRSWKEPCQVQSCQEEMISLG-------DGD--IRTMCPLLSMKPGEYSYFSPRTMSMWAGPDHWR 435          
BLAST of Condensin complex subunit 2 vs. Ensembl Human
Match: NCAPH (non-SMC condensin I complex subunit H [Source:HGNC Symbol;Acc:HGNC:1112])

HSP 1 Score: 129.028 bits (323), Expect = 4.616e-30
Identity = 120/426 (28.17%), Postives = 199/426 (46.71%), Query Frame = 2
Query:  104 IFLNIEENDDTKEKRANRKSIVEKV------PNTLIINNQK-----LDLPNNRN-DIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVK----ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXX---XRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLREMM--AKKELEIEECNMP-EESICG-------MDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVD--KDDLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWK 1288
            +  +  +NDD KE+   R+S V  +      P  L   + +       +P   N  I +HY  CIKL++ENKI +KNAF LHLID++ + +K    E  +F+    +LDA TKIYA RVD+V  + Y+VL GLG       +       + GH++D          K    K     RT+ QNI  + ++ A  + E+DP+FQ  A +FD+   + + L+ L   D   EL   S+    +       P+    E+  D+ + + Q  E  +    +C     FQF  W   SET N    ES+  ++   KK  ++ + N   +ES CG        DD+  D  D      V + +E   + KE  +V   ++++I+LG       +G+  + ++  +++    +Y   + + + +WAGP  W+
Sbjct:   40 VLEDFPQNDDEKERLQRRRSRVFDLQFSTDSPRLLASPSSRSIDISATIPKFTNTQITEHYSTCIKLSTENKITTKNAFGLHLIDFMSEILKQKDTEPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGKDAPSLEE-------VEGHVADGSATEMGTTKKAVKPKKKHLHRTIEQNINNLNVSEADRKCEIDPMFQKTAASFDECSTAGVFLSTLHCQDYRSELLFPSDVQTLSTGEPLELPELGCVEMT-DLKAPLQQCAEDRQ----ICPSLAGFQFTQWD--SETHN----ESVSALVDKFKKNDQVFDINAEVDESDCGDFPDGSLGDDF--DANDEPDHTAVGD-HEEFRSWKEPCQVQSCQEEMISLG-------DGD--IRTMCPLLSMKPGEYSYFSPRTMSMWAGPDHWR 435          

HSP 2 Score: 68.9366 bits (167), Expect = 2.616e-11
Identity = 45/121 (37.19%), Postives = 67/121 (55.37%), Query Frame = 2
Query: 1844 VTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQA----SIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 2194
            + A  + V +I+I YAKTAK++D+K +K  MWS+L A      DA E    +A K   L   +   + S L   L   L P  +++LS+ +   CLL LANE  L +  T+D +D+L+ QG
Sbjct:  610 LVAEPQKVNKIEIHYAKTAKKMDMKKLKQSMWSLLTALSGKEADA-EANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG 729          
BLAST of Condensin complex subunit 2 vs. Ensembl Human
Match: NCAPH (non-SMC condensin I complex subunit H [Source:HGNC Symbol;Acc:HGNC:1112])

HSP 1 Score: 128.642 bits (322), Expect = 5.820e-30
Identity = 118/426 (27.70%), Postives = 202/426 (47.42%), Query Frame = 2
Query:  104 IFLNIEENDDTKEKRANRKSIVEKV------PNTLIINNQK-----LDLPNNRN-DIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVK----ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXX---XRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLREMM--AKKELEIEECNMP-EESICG-------MDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVD--KDDLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWK 1288
            +  +  +NDD KE+   R+S V  +      P  L   + +       +P   N  I +HY  CIKL++ENKI +KNAF LHLID++ + +K    E  +F+    +LDA TKIYA RVD+V  + Y+VL GLG       +       + GH++D          K    K     RT+ QNI  + ++ A  + E+DP+FQ  A +FD+   + + L+ L   D   EL   S+    +       P+    E+  D+ + + Q  E  +    +C     FQF  W   SET N    ES+  ++   KK  ++ + N   +ES CG        DD+  +  + +++A+    +E   + KE  +V   ++++I+LG       +G+  + ++  +++    +Y   + + + +WAGP  W+
Sbjct:   51 VLEDFPQNDDEKERLQRRRSRVFDLQFSTDSPRLLASPSSRSIDISATIPKFTNTQITEHYSTCIKLSTENKITTKNAFGLHLIDFMSEILKQKDTEPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGKDAPSLEE-------VEGHVADGSATEMGTTKKAVKPKKKHLHRTIEQNINNLNVSEADRKCEIDPMFQKTAASFDECSTAGVFLSTLHCQDYRSELLFPSDVQTLSTGEPLELPELGCVEMT-DLKAPLQQCAEDRQ----ICPSLAGFQFTQWD--SETHN----ESVSALVDKFKKNDQVFDINAEVDESDCGDFPDGSLGDDFDAND-EPDHTAV--GDHEEFRSWKEPCQVQSCQEEMISLG-------DGD--IRTMCPLLSMKPGEYSYFSPRTMSMWAGPDHWR 446          

HSP 2 Score: 68.9366 bits (167), Expect = 2.827e-11
Identity = 45/121 (37.19%), Postives = 67/121 (55.37%), Query Frame = 2
Query: 1844 VTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQA----SIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 2194
            + A  + V +I+I YAKTAK++D+K +K  MWS+L A      DA E    +A K   L   +   + S L   L   L P  +++LS+ +   CLL LANE  L +  T+D +D+L+ QG
Sbjct:  621 LVAEPQKVNKIEIHYAKTAKKMDMKKLKQSMWSLLTALSGKEADA-EANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG 740          
BLAST of Condensin complex subunit 2 vs. Ensembl Human
Match: NCAPH (non-SMC condensin I complex subunit H [Source:HGNC Symbol;Acc:HGNC:1112])

HSP 1 Score: 82.8037 bits (203), Expect = 1.179e-15
Identity = 85/328 (25.91%), Postives = 147/328 (44.82%), Query Frame = 2
Query:  344 ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXX---XRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLREMMAKKELEIEECNMP-EESICG-------MDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVD--KDDLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWK 1288
            E  +F+    +LDA TKIYA RVD+V  + Y+VL GLG       +       + GH++D          K    K     RT+ QNI  + ++ A  + E+DP+FQ  A +FD+   + + L+ L   D   EL   S+    +       P+    E+  D+ + + Q  E  +    +C     FQF  W   SET N   +  + +   KK  ++ + N   +ES CG        DD+  D  D      V + +E   + KE  +V   ++++I+LG       +G+  + ++  +++    +Y   + + + +WAGP  W+
Sbjct:   11 EPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGKDAPSLEE-------VEGHVADGSATEMGTTKKAVKPKKKHLHRTIEQNINNLNVSEADRKCEIDPMFQKTAASFDECSTAGVFLSTLHCQDYRSELLFPSDVQTLSTGEPLELPELGCVEMT-DLKAPLQQCAEDRQ----ICPSLAGFQFTQWD--SETHNESVSALVDKF--KKNDQVFDINAEVDESDCGDFPDGSLGDDF--DANDEPDHTAVGD-HEEFRSWKEPCQVQSCQEEMISLG-------DGD--IRTMCPLLSMKPGEYSYFSPRTMSMWAGPDHWR 310          

HSP 2 Score: 68.9366 bits (167), Expect = 2.688e-11
Identity = 45/121 (37.19%), Postives = 67/121 (55.37%), Query Frame = 2
Query: 1844 VTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQA----SIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 2194
            + A  + V +I+I YAKTAK++D+K +K  MWS+L A      DA E    +A K   L   +   + S L   L   L P  +++LS+ +   CLL LANE  L +  T+D +D+L+ QG
Sbjct:  485 LVAEPQKVNKIEIHYAKTAKKMDMKKLKQSMWSLLTALSGKEADA-EANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG 604          
BLAST of Condensin complex subunit 2 vs. Ensembl Human
Match: NCAPH (non-SMC condensin I complex subunit H [Source:HGNC Symbol;Acc:HGNC:1112])

HSP 1 Score: 67.781 bits (164), Expect = 2.252e-12
Identity = 46/124 (37.10%), Postives = 68/124 (54.84%), Query Frame = 2
Query: 1835 EDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQA----SIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 2194
            E  + A  + V +I+I YAKTAK++D+K +K  MWS+L A      DA E    +A K   L   +   + S L   L   L P  +++LS+ +   CLL LANE  L +  T+D +D+L+ QG
Sbjct:   59 ESNLVAEPQKVNKIEIHYAKTAKKMDMKKLKQSMWSLLTALSGKEADA-EANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG 181          
BLAST of Condensin complex subunit 2 vs. Ensembl Fly
Match: barr (gene:FBgn0014127 transcript:FBtr0081349)

HSP 1 Score: 58.5362 bits (140), Expect = 2.191e-8
Identity = 27/71 (38.03%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  254 NCIKLASENKINSKNAFSLHLIDYLQDFV----KELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGL 454
            NC++L + NK++  NA++L LID L + +    K +++F+  GSSL+A +K+Y  RVDS++ +  ++  GL
Sbjct:   65 NCLELYNGNKVSKDNAWNLMLIDSLANLLDHHHKRMSNFKMAGSSLEASSKVYGLRVDSIYLDAMRISAGL 135          
BLAST of Condensin complex subunit 2 vs. Ensembl Fly
Match: barr (gene:FBgn0014127 transcript:FBtr0343850)

HSP 1 Score: 58.5362 bits (140), Expect = 2.191e-8
Identity = 27/71 (38.03%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  254 NCIKLASENKINSKNAFSLHLIDYLQDFV----KELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGL 454
            NC++L + NK++  NA++L LID L + +    K +++F+  GSSL+A +K+Y  RVDS++ +  ++  GL
Sbjct:   65 NCLELYNGNKVSKDNAWNLMLIDSLANLLDHHHKRMSNFKMAGSSLEASSKVYGLRVDSIYLDAMRISAGL 135          
BLAST of Condensin complex subunit 2 vs. Ensembl Fly
Match: barr (gene:FBgn0014127 transcript:FBtr0081348)

HSP 1 Score: 58.5362 bits (140), Expect = 2.191e-8
Identity = 27/71 (38.03%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  254 NCIKLASENKINSKNAFSLHLIDYLQDFV----KELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGL 454
            NC++L + NK++  NA++L LID L + +    K +++F+  GSSL+A +K+Y  RVDS++ +  ++  GL
Sbjct:   65 NCLELYNGNKVSKDNAWNLMLIDSLANLLDHHHKRMSNFKMAGSSLEASSKVYGLRVDSIYLDAMRISAGL 135          
BLAST of Condensin complex subunit 2 vs. Ensembl Zebrafish
Match: ncaph (non-SMC condensin I complex, subunit H [Source:ZFIN;Acc:ZDB-GENE-070112-652])

HSP 1 Score: 151.754 bits (382), Expect = 1.090e-37
Identity = 167/681 (24.52%), Postives = 296/681 (43.47%), Query Frame = 2
Query:  236 IGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVKELN---HFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLRE----MMAKKELEIEECNMPEESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVDKDD---LITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKLINIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHWEPTKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLMNREVLLVNKAFKKHTENIQNIQLKDEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTANVKHVEQ---------------IDIDYAKTAKRIDVKNIKAKMWSILQASID--AIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGY 2197
            I +HY  CIKL++ENKI +KNAF LHLIDY+ D +KE +   +F+    +LDA TKIYA RVD+V  + Y+VL GLG++ +    ++ ++       ++  +  +    + K    K+T+ QN+  I ++ ++++ EVDP+FQ  A +FD+   + + L+ L   D   EL   S       ++    P    +      S F    K + +   P+C   EDF F  W     T  +   E +++         ++E +E + P+           D  D +     P  NE     KEA      +   +I +         GE  ++++   ++    +Y   + + +  W GP  W        L     K+     KE ++  P  P  I+F+ +      +    +++ T+    +T ++++ L  + +K   LP   Q+   +++QL  +    ++   KK        +L ++  +  Y+ N AND               N     QE +      D + + G+   DN + D   P + +   +                 I+I+YA+TAK++D+K +K  MW +L  S +  A ++++    + P          FSQ I  L+  L    + +LSV +    LL LANE  L +   D   D++I QG+
Sbjct:   87 ISEHYSTCIKLSTENKITTKNAFGLHLIDYMADILKEKDSELNFKVAAGTLDASTKIYAVRVDAVHADAYRVLGGLGSETKPKESQDGDD---ETEAAEGSQGEQVAAKQTKKRPPKKTVEQNLSNINLSESEMKCEVDPMFQRMAASFDENSTAGVFLSVLFSEDSCCELRFPSH----MTLLKSQLPPVQVSHQNVPASPFTGHLKTLED--RPICPSLEDFSFTRWTPEQTTNLNQLLEKMKQGEHAFDVNADIEPDEDDAPDFG---------DNFDADVDEGRPGDNEEFKEHKEACSKSPQNGRGVIPI---------GEVDIATMCLQLSDQPREYSYFSPRTMATWVGPGYW--------LFKPGHKQDQKPDKEPRKRAPKNPLIIDFKAD------INFHNYFKTTR---AATTISKSALNTS-NKKTTLPADFQYPPSNLSQLNLKPSNTLSAEGKKRLSG----ELSED--IGEYDYNNANDT-------------ANFCPGLQEGDS----EDAEGFGGS---DNSQTDRPTPFSLDTDDISTYGEDCLVPEPHKLNIIEINYARTAKKMDMKKLKTTMWGLLTESPEKTAKQVESEDTTEVPGEK------SFSQSIRNLVQRLPSAMATNLSVPLAFVALLHLANEKNLELHKIDGMTDIIIKQGH 690          
BLAST of Condensin complex subunit 2 vs. Ensembl Zebrafish
Match: ncaph (non-SMC condensin I complex, subunit H [Source:ZFIN;Acc:ZDB-GENE-070112-652])

HSP 1 Score: 147.517 bits (371), Expect = 2.936e-36
Identity = 167/681 (24.52%), Postives = 296/681 (43.47%), Query Frame = 2
Query:  236 IGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVKELN---HFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLRE----MMAKKELEIEECNMPEESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVDKDD---LITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKLINIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHWEPTKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLMNREVLLVNKAFKKHTENIQNIQLKDEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTAN------------VKHVEQIDI---DYAKTAKRIDVKNIKAKMWSILQASID--AIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGY 2197
            I +HY  CIKL++ENKI +KNAF LHLIDY+ D +KE +   +F+    +LDA TKIYA RVD+V  + Y+VL GLG++ +    ++ ++       ++  +  +    + K    K+T+ QN+  I ++ ++++ EVDP+FQ  A +FD+   + + L+ L   D   EL   S       ++    P    +      S F    K + +   P+C   EDF F  W     T  +   E +++         ++E +E + P+           D  D +     P  NE     KEA      +   +I +         GE  ++++   ++    +Y   + + +  W GP  W        L     K+     KE ++  P  P  I+F+ +      +    +++ T+    +T ++++ L  + +K   LP   Q+   +++QL  +    ++   KK        +L ++    NY  N AND               N     QE +      D + + G+   D+ + D   P + +            V    +++I   +YA+TAK++D+K +K  MW +L  S +  A ++++    + P          FSQ I  L+  L    + +LSV +    LL LANE  L +   D   D++I QG+
Sbjct:   87 ISEHYSTCIKLSTENKITTKNAFGLHLIDYMADILKEKDSELNFKVAAGTLDASTKIYAVRVDAVHADAYRVLGGLGSETKPKESQDGDD---ETEAAEGSQGEQVAAKQTKKRPPKKTVEQNLSNINLSESEMKCEVDPMFQRMAASFDENSTAGVFLSVLFSEDSCCELRFPSH----MTLLKSQLPPVQVSHQNVPASPFTGHLKTLED--RPICPSLEDFSFTRWTPEQTTNLNQLLEKMKQGEHAFDVNADIEPDEDDAPDFG---------DNFDADVDEGRPGDNEEFKEHKEACSKSPQNGRGVIPI---------GEVDIATMCLQLSDQPREYSYFSPRTMATWVGPGYW--------LFKPGHKQDQKPDKEPRKRAPKNPLIIDFKAD------INFHNYFKTTR---AATTISKSALNTS-NKKTTLPADFQYPPSNLSQLNLKPSNTLSAEGKKRLSG----ELSEDIGEYNY--NNANDT-------------ANFCPGLQEGDS----EDAEGFAGS---DDSQTDRPTPFSLDTDDISTYGEDCLVPEPHKLNIIEINYARTAKKMDMKKLKTTMWGLLTESPEKTAKQVESEDTTEVPGEK------SFSQSIRNLVQRLPSAMATNLSVPLAFVALLHLANEKNLELHKIDGMTDIIIKQGH 690          
BLAST of Condensin complex subunit 2 vs. Ensembl Zebrafish
Match: ncaph (non-SMC condensin I complex, subunit H [Source:ZFIN;Acc:ZDB-GENE-070112-652])

HSP 1 Score: 147.517 bits (371), Expect = 2.936e-36
Identity = 167/681 (24.52%), Postives = 296/681 (43.47%), Query Frame = 2
Query:  236 IGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVKELN---HFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLRE----MMAKKELEIEECNMPEESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVDKDD---LITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKLINIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHWEPTKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLMNREVLLVNKAFKKHTENIQNIQLKDEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTAN------------VKHVEQIDI---DYAKTAKRIDVKNIKAKMWSILQASID--AIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGY 2197
            I +HY  CIKL++ENKI +KNAF LHLIDY+ D +KE +   +F+    +LDA TKIYA RVD+V  + Y+VL GLG++ +    ++ ++       ++  +  +    + K    K+T+ QN+  I ++ ++++ EVDP+FQ  A +FD+   + + L+ L   D   EL   S       ++    P    +      S F    K + +   P+C   EDF F  W     T  +   E +++         ++E +E + P+           D  D +     P  NE     KEA      +   +I +         GE  ++++   ++    +Y   + + +  W GP  W        L     K+     KE ++  P  P  I+F+ +      +    +++ T+    +T ++++ L  + +K   LP   Q+   +++QL  +    ++   KK        +L ++    NY  N AND               N     QE +      D + + G+   D+ + D   P + +            V    +++I   +YA+TAK++D+K +K  MW +L  S +  A ++++    + P          FSQ I  L+  L    + +LSV +    LL LANE  L +   D   D++I QG+
Sbjct:   87 ISEHYSTCIKLSTENKITTKNAFGLHLIDYMADILKEKDSELNFKVAAGTLDASTKIYAVRVDAVHADAYRVLGGLGSETKPKESQDGDD---ETEAAEGSQGEQVAAKQTKKRPPKKTVEQNLSNINLSESEMKCEVDPMFQRMAASFDENSTAGVFLSVLFSEDSCCELRFPSH----MTLLKSQLPPVQVSHQNVPASPFTGHLKTLED--RPICPSLEDFSFTRWTPEQTTNLNQLLEKMKQGEHAFDVNADIEPDEDDAPDFG---------DNFDADVDEGRPGDNEEFKEHKEACSKSPQNGRGVIPI---------GEVDIATMCLQLSDQPREYSYFSPRTMATWVGPGYW--------LFKPGHKQDQKPDKEPRKRAPKNPLIIDFKAD------INFHNYFKTTR---AATTISKSALNTS-NKKTTLPADFQYPPSNLSQLNLKPSNTLSAEGKKRLSG----ELSEDIGEYNY--NNANDT-------------ANFCPGLQEGDS----EDAEGFAGS---DDSQTDRPTPFSLDTDDISTYGEDCLVPEPHKLNIIEINYARTAKKMDMKKLKTTMWGLLTESPEKTAKQVESEDTTEVPGEK------SFSQSIRNLVQRLPSAMATNLSVPLAFVALLHLANEKNLELHKIDGMTDIIIKQGH 690          
BLAST of Condensin complex subunit 2 vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:NCBI gene;Acc:493346])

HSP 1 Score: 171.4 bits (433), Expect = 6.479e-44
Identity = 188/719 (26.15%), Postives = 315/719 (43.81%), Query Frame = 2
Query:  113 NIEENDDTKEKRANRKSIV-------EKVPNTLIINNQK--LDLPNN------RNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVK----ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPK---ADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMN-SMTAESLREMMAKKELEIE-ECNMPEESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAV--EVDKDDLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKLINIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHWEPTKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLMNREVLLVNKAFKKHTENIQNIQLKDEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQ 2191
            N   NDD +E++  R S V          P + I   Q   +D P +         I  HY  CIKL+ ENKI +KNAF LHLIDY+ D +K    EL +F+    +LDA  KIYA RVD+V  + Y+VL GLG +++     +N+E   S    D++ + K K+         +T+ +N+  I  +  + +SEVDP+FQ  A +FD+   + + L+ L       EL  D++    +   +   P    AD  E    +   + Q  E      P+C     F+F  W   ++  N S+  +  ++     ++  E E +  E      DD+  D  D   +  + E  E     +EA   E  +  L  +G       NG+  + ++   ++S   +Y   + + + +WAGP  W+ +       + D++K     K  +     F + ++F +            H+  T+    +T LT++ L+    K   LP    +   +I ++  R    + K        +Q+   + ED +  Y+ N  ND           D   + ++      E++      A   A    N     E  + A  + V +I+I YAKTAK++D+K +K+ MWS+L    ++ E      K+  +  L +   +FS +   L   L P  +++LSV +   CLL LANE  L +   DD +D+LI Q
Sbjct:   41 NFTSNDDERERKLRRMSRVIDLQLSNADSPASAISPAQSRGIDTPTSLLPKLSNTQISDHYSTCIKLSQENKITTKNAFGLHLIDYMGDILKHKDSELTNFKVAAGTLDASAKIYAVRVDAVHADVYKVLGGLGKESQATEDTDNQEIDNSKDPQDRKNQKKRKRSY-------KTIERNLNNINRSETERKSEVDPLFQKTAASFDEFSTAGVFLSTLKCHSYHSELRFDTDVRPLSTTEETEPPSPGSADSTE----LKPLILQCVE----KRPICPSLSGFRFMQWNSDAQNENLSLLMDKFKKSDHVFDINAEVEDDFAESEAPVADDFDADVCDGMDAGDIREFAE----HREACRSERKRPQLTQIG-------NGD--IGTMCLQLSSCPGEYSYFSPRTMSMWAGPEHWRFRPRQKASTDSDQQKVKKAKKVFELN---FEDDVDFEV------------HFRKTR---AATTLTKSTLESQNKKSTTLPADFHYDPDNIARMSLRPKDRIRKT------TVQDSVSETEDDIGEYDYNNPNDTSNFCPALQAADSDDDDDDGAFLGPESN-----SAGFSAENQLNITSYGESNLVAEPQKVNKIEIHYAKTAKKMDMKRLKSNMWSLLANCPESQEEMPSSKKEEIDAALITDERIFSSVTHDLQKRLPPVMAQNLSVPLAFACLLHLANEKNLKLQGMDDLSDVLIMQ 702          
BLAST of Condensin complex subunit 2 vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:NCBI gene;Acc:493346])

HSP 1 Score: 167.162 bits (422), Expect = 1.145e-42
Identity = 183/717 (25.52%), Postives = 300/717 (41.84%), Query Frame = 2
Query:  113 NIEENDDTKEKRANRKSIV-------EKVPNTLIINNQK--LDLPNN------RNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVK----ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXP---KADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMN-SMTAESLREMMAKKELEIE-ECNMPEESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVDKDDLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKLINIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHWEPTKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLMNREVLLVNKAFKKHTENIQNIQLKDEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQ 2191
            N   NDD +E++  R S V          P + I   Q   +D P +         I  HY  CIKL+ ENKI +KNAF LHLIDY+ D +K    EL +F+    +LDA  KIYA RVD+V  + Y+VL GLG +              S    D + +        K  +  +T+ +N+  I  +  + +SEVDP+FQ  A +FD+   + + L+ L       EL  D++    +   +   P    AD  E    +   + Q  E      P+C     F+F  W   ++  N S+  +  ++     ++  E E +  E      DD+  D  D   +  + E  EP     +  ++   D+ T+   +  SC GE                Y   + + + +WAGP  W+ +             +  V K  K  +  F + ++F +            H+  T+    +T LT++ L+    K   LP    +   +I ++  R    + K        +Q+   + ED +  Y+ N  ND           D   + ++      E++      A   A    N     E  + A  + V +I+I YAKTAK++D+K +K+ MWS+L    ++ E   +   +  +  L +   +FS +   L   L P  +++LSV +   CLL LANE  L +   DD +D+LI Q
Sbjct:   47 NFTSNDDERERKLRRMSRVIDLQLSNADSPASAISPAQSRGIDTPTSLLPKLSNTQISDHYSTCIKLSQENKITTKNAFGLHLIDYMGDILKHKDSELTNFKVAAGTLDASAKIYAVRVDAVHADVYKVLGGLGKE--------------SQATEDTDNQEIGSIMLSKRKRSYKTIERNLNNINRSETERKSEVDPLFQKTAASFDEFSTAGVFLSTLKCHSYHSELRFDTDVRPLSTTEETEPPSPGSADSTE----LKPLILQCVE----KRPICPSLSGFRFMQWNSDAQNENLSLLMDKFKKSDHVFDINAEVEDDFAESEAPVADDFDADVCDGMDAGDIREFAEP-----QLTQIGNGDIGTMCL-QLSSCPGE----------------YSYFSPRTMSMWAGPEHWRFRPRQ------KDSDQQKVKKAKKVFELNFEDDVDFEV------------HFRKTR---AATTLTKSTLESQNKKSTTLPADFHYDPDNIARMSLRPKDRIRKT------TVQDSVSETEDDIGEYDYNNPNDTSNFCPALQAADSDDDDDDGAFLGPESN-----SAGFSAENQLNITSYGESNLVAEPQKVNKIEIHYAKTAKKMDMKRLKSNMWSLLANCPESQE--EVHWTEEIDAALITDERIFSSVTHDLQKRLPPVMAQNLSVPLAFACLLHLANEKNLKLQGMDDLSDVLIMQ 685          
BLAST of Condensin complex subunit 2 vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:NCBI gene;Acc:493346])

HSP 1 Score: 166.392 bits (420), Expect = 2.626e-42
Identity = 192/731 (26.27%), Postives = 314/731 (42.95%), Query Frame = 2
Query:  113 NIEENDDTKEKRANRKSIV-------EKVPNTLIINNQK--LDLPNN------RNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVK----ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXP---KADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMN-SMTAESLREMMAKKELEIE-ECNMPEESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVDKDDLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKLINIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHWEPTKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLMNREVLLVNKAFKKHTENIQNIQLKDEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNN--NYQEQEEA---DYISDCDAYMG-----ASFHD----NFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQ 2191
            N   NDD +E++  R S V          P + I   Q   +D P +         I  HY  CIKL+ ENKI +KNAF LHLIDY+ D +K    EL +F+    +LDA  KIYA RVD+V  + Y+VL GLG +++                +D +E     K ++K  +  +T+ +N+  I  +  + +SEVDP+FQ  A +FD+   + + L+ L       EL  D++    +   +   P    AD  E    +   + Q  E      P+C     F+F  W   ++  N S+  +  ++     ++  E E +  E      DD+  D  D   +  + E  E     +EA    +  L  +G       NG+  + ++   ++S   +Y   + + + +WAGP  W+ +       + D   +  V K  K  +  F + ++F +            H+  T+    +T LT++ L+    K   LP                        F    +NI  + L+ +D+V  Y     ND+ E         D  N N+  N+    +A   D   D  A++G     A F      N     E  + A  + V +I+I YAKTAK++D+K +K+ MWS+L    ++ E   +   +  +  L +   +FS +   L   L P  +++LSV +   CLL LANE  L +   DD +D+LI Q
Sbjct:   41 NFTSNDDERERKLRRMSRVIDLQLSNADSPASAISPAQSRGIDTPTSLLPKLSNTQISDHYSTCIKLSQENKITTKNAFGLHLIDYMGDILKHKDSELTNFKVAAGTLDASAKIYAVRVDAVHADVYKVLGGLGKESQATED------------TDNQEIGSIIKNQKKRKRSYKTIERNLNNINRSETERKSEVDPLFQKTAASFDEFSTAGVFLSTLKCHSYHSELRFDTDVRPLSTTEETEPPSPGSADSTE----LKPLILQCVE----KRPICPSLSGFRFMQWNSDAQNENLSLLMDKFKKSDHVFDINAEVEDDFAESEAPVADDFDADVCDGMDAGDIREFAE----HREAC---RPQLTQIG-------NGD--IGTMCLQLSSCPGEYSYFSPRTMSMWAGPEHWRFRPRQKASTDSD---QQKVKKAKKVFELNFEDDVDFEV------------HFRKTR---AATTLTKSTLESQNKKSTTLP----------------------ADFHYDPDNIARMSLRPKDRVKAYTGYMQNDIGEY--------DYNNPNDTSNFCPALQAADSDDDDDDGAFLGPESNSAGFSAENQLNITSYGESNLVAEPQKVNKIEIHYAKTAKKMDMKRLKSNMWSLLANCPESQE--EVHWTEEIDAALITDERIFSSVTHDLQKRLPPVMAQNLSVPLAFACLLHLANEKNLKLQGMDDLSDVLIMQ 685          
BLAST of Condensin complex subunit 2 vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:NCBI gene;Acc:493346])

HSP 1 Score: 162.155 bits (409), Expect = 6.463e-41
Identity = 181/701 (25.82%), Postives = 305/701 (43.51%), Query Frame = 2
Query:  113 NIEENDDTKEKRANRKSIV-------EKVPNTLIINNQK--LDLPNN------RNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVK----ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPK---ADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMN-SMTAESLREMMAKKELEIE-ECNMPEESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAV--EVDKDDLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKLINIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHWEPTKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLMNREVLLVNKAFKKHTENIQNIQLKDEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANE 2137
            N   NDD +E++  R S V          P + I   Q   +D P +         I  HY  CIKL+ ENKI +KNAF LHLIDY+ D +K    EL +F+    +LDA  KIYA RVD+V  + Y+VL GLG +++     +N+E   S    D++ + K K+         +T+ +N+  I  +  + +SEVDP+FQ  A +FD+   + + L+ L       EL  D++    +   +   P    AD  E    +   + Q  E      P+C     F+F  W   ++  N S+  +  ++     ++  E E +  E      DD+  D  D   +  + E  E     +EA   E  +  L  +G       NG+  + ++   ++S   +Y   + + + +WAGP  W+ +       + D++K     K  +     F + ++F +            H+  T+    +T LT++ L+    K   LP    +   +I ++  R    + K        +Q+   + ED +  Y+ N  ND           D   + ++      E++      A   A    N     E  + A  + V +I+I YAKTAK++D+K +K+ MWS+L    ++ E      K+  +  L +   +FS +   L   L P  +++LSV +   CLL LANE
Sbjct:   41 NFTSNDDERERKLRRMSRVIDLQLSNADSPASAISPAQSRGIDTPTSLLPKLSNTQISDHYSTCIKLSQENKITTKNAFGLHLIDYMGDILKHKDSELTNFKVAAGTLDASAKIYAVRVDAVHADVYKVLGGLGKESQATEDTDNQEIDNSKDPQDRKNQKKRKRSY-------KTIERNLNNINRSETERKSEVDPLFQKTAASFDEFSTAGVFLSTLKCHSYHSELRFDTDVRPLSTTEETEPPSPGSADSTE----LKPLILQCVE----KRPICPSLSGFRFMQWNSDAQNENLSLLMDKFKKSDHVFDINAEVEDDFAESEAPVADDFDADVCDGMDAGDIREFAE----HREACRSERKRPQLTQIG-------NGD--IGTMCLQLSSCPGEYSYFSPRTMSMWAGPEHWRFRPRQKASTDSDQQKVKKAKKVFELN---FEDDVDFEV------------HFRKTR---AATTLTKSTLESQNKKSTTLPADFHYDPDNIARMSLRPKDRIRKT------TVQDSVSETEDDIGEYDYNNPNDTSNFCPALQAADSDDDDDDGAFLGPESN-----SAGFSAENQLNITSYGESNLVAEPQKVNKIEIHYAKTAKKMDMKRLKSNMWSLLANCPESQEEMPSSKKEEIDAALITDERIFSSVTHDLQKRLPPVMAQNLSVPLAFACLLHLANE 684          
BLAST of Condensin complex subunit 2 vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:NCBI gene;Acc:493346])

HSP 1 Score: 144.436 bits (363), Expect = 3.856e-35
Identity = 164/638 (25.71%), Postives = 276/638 (43.26%), Query Frame = 2
Query:  113 NIEENDDTKEKRANRKSIV-------EKVPNTLIINNQK--LDLPNN------RNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVK----ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXP---KADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMN-SMTAESLREMMAKKELEIE-ECNMPEESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAV--EVDKDDLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKLINIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHWEPTKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLMNREVLLVNKAFKKHTENIQNIQLKDEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSIL 1948
            N   NDD +E++  R S V          P + I   Q   +D P +         I  HY  CIKL+ ENKI +KNAF LHLIDY+ D +K    EL +F+    +LDA  KIYA RVD+V  + Y+VL GLG +++     +N+E   S    D+       K ++K  +  +T+ +N+  I  +  + +SEVDP+FQ  A +FD+   + + L+ L       EL  D++    +   +   P    AD  E    +   + Q  E      P+C     F+F  W   ++  N S+  +  ++     ++  E E +  E      DD+  D  D   +  + E  E     +EA   E  +  L  +G       NG+  + ++   ++S   +Y   + + + +WAGP  W+ +       + D   +  V K  K  +  F + ++F +            H+  T+    +T LT++ L+    K   LP    +   +I ++  R    + K        +Q+   + ED +  Y+ N  ND           D   + ++      E++      A   A    N     E  + A  + V +I+I YAKTAK++D+K +K+ MWS+L
Sbjct:   41 NFTSNDDERERKLRRMSRVIDLQLSNADSPASAISPAQSRGIDTPTSLLPKLSNTQISDHYSTCIKLSQENKITTKNAFGLHLIDYMGDILKHKDSELTNFKVAAGTLDASAKIYAVRVDAVHADVYKVLGGLGKESQATEDTDNQEIDNSKDPQDR-------KNQKKRKRSYKTIERNLNNINRSETERKSEVDPLFQKTAASFDEFSTAGVFLSTLKCHSYHSELRFDTDVRPLSTTEETEPPSPGSADSTE----LKPLILQCVE----KRPICPSLSGFRFMQWNSDAQNENLSLLMDKFKKSDHVFDINAEVEDDFAESEAPVADDFDADVCDGMDAGDIREFAE----HREACRSERKRPQLTQIG-------NGD--IGTMCLQLSSCPGEYSYFSPRTMSMWAGPEHWRFRPRQKASTDSD---QQKVKKAKKVFELNFEDDVDFEV------------HFRKTR---AATTLTKSTLESQNKKSTTLPADFHYDPDNIARMSLRPKDRIRKT------TVQDSVSETEDDIGEYDYNNPNDTSNFCPALQAADSDDDDDDGAFLGPESN-----SAGFSAENQLNITSYGESNLVAEPQKVNKIEIHYAKTAKKMDMKRLKSNMWSLL 621          
BLAST of Condensin complex subunit 2 vs. Ensembl Mouse
Match: Ncaph (non-SMC condensin I complex, subunit H [Source:MGI Symbol;Acc:MGI:2444777])

HSP 1 Score: 161.384 bits (407), Expect = 1.017e-40
Identity = 194/740 (26.22%), Postives = 335/740 (45.27%), Query Frame = 2
Query:  104 IFLNIEENDDTKEKRANRKSIVEKVPNT-----LIINNQKLDLPNN-----RNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVK----ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLREMMAK-----------KELEIEECNMPEESICGMDDY-QHDGVDMEYSAIVPEINEPIIAEKEAVEV--DKDDLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKLINIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHWEPTKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLM---NREVLLVN---KAFKKHTENIQNIQLKDEDKVLNYEPN-QANDVLEMQSVTLVTDDAGNVN--NNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSIL------QASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 2194
            +  +  +NDD KE+   R+S V  +  +     L   N+ +D+           I +HY  CIKL+SENKI +KNAF LHLID++ + +K    E  +F+    +LDA TKIYA RVD+V  + Y+VL GLG       ++++     SG  S  E E   K  K K  +  +T+ QN+  I ++ A  +  VDP+FQ  A +FD+   + + L+ L   D   EL   S+    +       P         D++   +  ++  E + P+C     FQF  W   SET N    ES+  ++ K            E E +E ++P+  +  ++D+  +D  D+  +      +E   + KE  +V  +++++I+L            +M S + M      +Y   + + + +WAGP  W+ +    +    D        K+          K +F +N      +    +++ TK    +T LT++ L+    K   LP    +   ++ QL     +  L ++   KA  +H E I++    + +   NY P  QA D    ++  L  D  G ++  ++ +  +E  +IS  +  +  + +          + A  + V +I+I YAKTAK++D+K +K  MWS+L      +A  +A   ++ Q      +    K    S L   L   L P  +++LS+ +   CLL LANE  L +  T+D +D+L+ QG
Sbjct:   48 VLEDFPQNDDEKERMQRRRSRVFDLQFSTDSIHLASPNRNIDVSTTISKFTNTQITEHYSTCIKLSSENKITTKNAFGLHLIDFMSEILKQKDAEPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGKDTPPQGEESH-----SGDGSTLETERTKKPAKPKKKQSCKTIEQNLSNINVSEADGKCAVDPMFQKTAASFDECSTTGVFLSTLHCQDYRSELLFPSDMQTLSSGEPLELPDLG----FVDMTDLEASLQQCVE-DRPLCPSLAGFQFTKW--DSETHN----ESVSALVDKFKKNDQVFDINAEAEDDEEDVPDGPL--VEDFVDNDEPDLSAAG----DHEEFRSWKELCQVQSNQEEVISLEDRDIQ------VMCSFLSMKPG---EYSYFSPRTMKMWAGPDHWRFRPRPKQ----DATSCTEHKKKSA--------KKDFEINFDDD--IDFDAYFQKTK---AATILTKSTLENQNWKATTLPTDFHYETDNLIQLHLKPGKRSLKMDQDQKAKTEHYEEIEDYDYNNPNDTSNYCPGLQAADSDYEEADDLFADPVGTLDLESDPKTTQENGHISPENQGVDITTYQELN------LVAEPQKVNKIEIHYAKTAKKMDMKKLKQSMWSLLTKFSRKEADTEANHTESGQEGAPEEVADEKK---LSGLTKDLQTRLPPLMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVMQG 730          
BLAST of Condensin complex subunit 2 vs. UniProt/SwissProt
Match: sp|O13067|CND2_XENLA (Condensin complex subunit 2 OS=Xenopus laevis OX=8355 GN=ncaph PE=1 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.097e-43
Identity = 183/720 (25.42%), Postives = 311/720 (43.19%), Query Frame = 2
Query:  104 IFLNIEENDDTKEKRANRKSIV-------EKVPNTLIINNQK--LDLPN------NRNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVK----ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXX---XXXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMN-SMTAESLREMMAKKELEIE-ECNMPEESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVDKDDLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKLINIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHWEPTKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLMNREVLLVNKAFKKHTENIQNIQLKDEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQ 2191
              LN   NDD +E++  R S V          P T I   Q    D P       N   I  HY  CIKL+ ENKI +KNAF LHLIDY+ D +K    EL +F+    +LDA  KIYA RVD+V  + Y+VL GLG +++          +  P  G  + +  +  +           +T+ +N+  I  +  + +SE+DP+FQ  A +FD+   + + L+ L       EL  D++    +   +   P         D +   S F +  E   P+C     F+F  W   ++  N S+  +  ++     ++  E E +  E      D++  D  +   +  + E  E     +EA  +++      G   T   NG+  + ++   ++S   +Y   + + + +WAGP  W+ +       + D+++     K  +     F + I+F +            H+  T+    +T LT++ L+    K   LP    +   +I ++  R    + K        +Q    + ED + +Y+ N  ND        L   D+ + +  +   E         A   A    N     E  + A  K V +I+I YAKTAK++D+K +K+ MWS+L    ++ E +   +K+  +  L +   +FS +   L   L P  +++LSV +   CLL LANE  L +   DD +D++I Q
Sbjct:   38 TLLNFTSNDDERERKLRRMSRVIDLQLSNANSPATAISPAQSRGADTPTSLLPKLNNTQISDHYSTCIKLSQENKITTKNAFGLHLIDYMGDILKHKDSELTNFKVAAGTLDASAKIYAVRVDAVHADVYKVLGGLGKESQATEDTENQETDTGPQDGRKNPKRRKCSY-----------KTIERNLNSINRSETERKSEIDPLFQKAAASFDEFSTAGVFLSTLKCHSYHSELHFDADVKPLSTAEETEPPSPGS----MDSTELKSLFLQCVEKR-PLCPSLSGFRFMQWNSDAQNENLSLLMDKFKKSDHVFDINAEVEDDFVESEAPVADEFDADVCEGMDAGDIGEFAE----HREACRLERK-----GAQLTQIGNGD--IGTMCLQLSSCPGEYSYFSPRTMSMWAGPEHWRFRPRQKASTDSDQQRVKKAKKVFELN---FEDDIDFEV------------HFRKTR---AATTLTKSTLESQNKKSTTLPADFHYDPDNIARMSLRPKDRIRKT------TVQESVSEPEDDIGDYDYNNPNDTSNF-CPALQAADSDDDDGAFLGPESNS------AGFSAENQMNITSYGESNLVAGQK-VNKIEIQYAKTAKKMDMKRLKSSMWSLLANCPESQE-EMPSSKEEIDAALITDEQVFSSVTHGLQKRLPPVMAQNLSVPLAFACLLHLANEKNLKLQGMDDLSDVMIMQ 697          
BLAST of Condensin complex subunit 2 vs. UniProt/SwissProt
Match: sp|Q8C156|CND2_MOUSE (Condensin complex subunit 2 OS=Mus musculus OX=10090 GN=Ncaph PE=1 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 7.115e-40
Identity = 194/740 (26.22%), Postives = 335/740 (45.27%), Query Frame = 2
Query:  104 IFLNIEENDDTKEKRANRKSIVEKVPNT-----LIINNQKLDLPNN-----RNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVK----ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLREMMAK-----------KELEIEECNMPEESICGMDDY-QHDGVDMEYSAIVPEINEPIIAEKEAVEV--DKDDLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKLINIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHWEPTKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLM---NREVLLVN---KAFKKHTENIQNIQLKDEDKVLNYEPN-QANDVLEMQSVTLVTDDAGNVN--NNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSIL------QASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 2194
            +  +  +NDD KE+   R+S V  +  +     L   N+ +D+           I +HY  CIKL+SENKI +KNAF LHLID++ + +K    E  +F+    +LDA TKIYA RVD+V  + Y+VL GLG       ++++     SG  S  E E   K  K K  +  +T+ QN+  I ++ A  +  VDP+FQ  A +FD+   + + L+ L   D   EL   S+    +       P         D++   +  ++  E + P+C     FQF  W   SET N    ES+  ++ K            E E +E ++P+  +  ++D+  +D  D+  +      +E   + KE  +V  +++++I+L            +M S + M      +Y   + + + +WAGP  W+ +    +    D        K+          K +F +N      +    +++ TK    +T LT++ L+    K   LP    +   ++ QL     +  L ++   KA  +H E I++    + +   NY P  QA D    ++  L  D  G ++  ++ +  +E  +IS  +  +  + +          + A  + V +I+I YAKTAK++D+K +K  MWS+L      +A  +A   ++ Q      +    K    S L   L   L P  +++LS+ +   CLL LANE  L +  T+D +D+L+ QG
Sbjct:   48 VLEDFPQNDDEKERMQRRRSRVFDLQFSTDSIHLASPNRNIDVSTTISKFTNTQITEHYSTCIKLSSENKITTKNAFGLHLIDFMSEILKQKDAEPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGKDTPPQGEESH-----SGDGSTLETERTKKPAKPKKKQSCKTIEQNLSNINVSEADGKCAVDPMFQKTAASFDECSTTGVFLSTLHCQDYRSELLFPSDMQTLSSGEPLELPDLG----FVDMTDLEASLQQCVE-DRPLCPSLAGFQFTKW--DSETHN----ESVSALVDKFKKNDQVFDINAEAEDDEEDVPDGPL--VEDFVDNDEPDLSAAG----DHEEFRSWKELCQVQSNQEEVISLEDRDIQ------VMCSFLSMKPG---EYSYFSPRTMKMWAGPDHWRFRPRPKQ----DATSCTEHKKKSA--------KKDFEINFDDD--IDFDAYFQKTK---AATILTKSTLENQNWKATTLPTDFHYETDNLIQLHLKPGKRSLKMDQDQKAKTEHYEEIEDYDYNNPNDTSNYCPGLQAADSDYEEADDLFADPVGTLDLESDPKTTQENGHISPENQGVDITTYQELN------LVAEPQKVNKIEIHYAKTAKKMDMKKLKQSMWSLLTKFSRKEADTEANHTESGQEGAPEEVADEKK---LSGLTKDLQTRLPPLMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVMQG 730          
BLAST of Condensin complex subunit 2 vs. UniProt/SwissProt
Match: sp|Q15003|CND2_HUMAN (Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3)

HSP 1 Score: 128.642 bits (322), Expect = 2.795e-29
Identity = 118/426 (27.70%), Postives = 202/426 (47.42%), Query Frame = 2
Query:  104 IFLNIEENDDTKEKRANRKSIVEKV------PNTLIINNQK-----LDLPNNRN-DIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVK----ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXX---XRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLREMM--AKKELEIEECNMP-EESICG-------MDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVD--KDDLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWK 1288
            +  +  +NDD KE+   R+S V  +      P  L   + +       +P   N  I +HY  CIKL++ENKI +KNAF LHLID++ + +K    E  +F+    +LDA TKIYA RVD+V  + Y+VL GLG       +       + GH++D          K    K     RT+ QNI  + ++ A  + E+DP+FQ  A +FD+   + + L+ L   D   EL   S+    +       P+    E+  D+ + + Q  E  +    +C     FQF  W   SET N    ES+  ++   KK  ++ + N   +ES CG        DD+  +  + +++A+    +E   + KE  +V   ++++I+LG       +G+  + ++  +++    +Y   + + + +WAGP  W+
Sbjct:   51 VLEDFPQNDDEKERLQRRRSRVFDLQFSTDSPRLLASPSSRSIDISATIPKFTNTQITEHYSTCIKLSTENKITTKNAFGLHLIDFMSEILKQKDTEPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGKDAPSLEE-------VEGHVADGSATEMGTTKKAVKPKKKHLHRTIEQNINNLNVSEADRKCEIDPMFQKTAASFDECSTAGVFLSTLHCQDYRSELLFPSDVQTLSTGEPLELPELGCVEMT-DLKAPLQQCAEDRQ----ICPSLAGFQFTQWD--SETHN----ESVSALVDKFKKNDQVFDINAEVDESDCGDFPDGSLGDDFDAND-EPDHTAV--GDHEEFRSWKEPCQVQSCQEEMISLG-------DGD--IRTMCPLLSMKPGEYSYFSPRTMSMWAGPDHWR 446          

HSP 2 Score: 68.9366 bits (167), Expect = 1.358e-10
Identity = 45/121 (37.19%), Postives = 67/121 (55.37%), Query Frame = 2
Query: 1844 VTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQA----SIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 2194
            + A  + V +I+I YAKTAK++D+K +K  MWS+L A      DA E    +A K   L   +   + S L   L   L P  +++LS+ +   CLL LANE  L +  T+D +D+L+ QG
Sbjct:  621 LVAEPQKVNKIEIHYAKTAKKMDMKKLKQSMWSLLTALSGKEADA-EANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG 740          
BLAST of Condensin complex subunit 2 vs. UniProt/SwissProt
Match: sp|Q564K3|CND2_ARATH (Condensin complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=CAPH PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 2.908e-15
Identity = 56/164 (34.15%), Postives = 88/164 (53.66%), Query Frame = 2
Query:  248 YGNCIKLASENKINSKNAFSLHLIDYLQDFVK-------ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTL 718
            + NCIKLASENKIN KN + L+LID+L + +K       E N FQ    +L+AG KIY+ RVDSV +  Y+VL G+     ++   + + A    + ++Q+++ + K           TL  +   + +    +   VDP++   +  FD+GG   L LNNL +
Sbjct:   79 FQNCIKLASENKINQKNTWELNLIDHLCEIIKVEDENNTETN-FQKASCTLEAGVKIYSMRVDSVHSEAYKVLGGITRAGHDDGGDHEDAAGAVENATNQKKQPEKKISPLS------TLEPSFDALNVKKFDVAFAVDPLYHQTSAQFDEGGAKGLLLNNLGV 235          
BLAST of Condensin complex subunit 2 vs. UniProt/SwissProt
Match: sp|Q9Y7R3|CND2_SCHPO (Condensin complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnd2 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.062e-12
Identity = 60/200 (30.00%), Postives = 107/200 (53.50%), Query Frame = 2
Query:  137 KEKRANRKSIVEKV-PNTLIINNQKLDLPNNRNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFV-----KELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTL 718
            K++   R S +  + P    +NN      +++  +  ++   IKLA++NKINS N ++  LIDY  D       +++N FQ    +LD   KIY SR+DSV T T ++L+GL N ++   Q    E        + +E+++ KK +++  +  +TLV++ + IR    +L+   DP+F+    +FD+ G   L +N+L +
Sbjct:   33 KQRELRRSSALHSITPRRESLNNSSPFNSSHQVPVLSNFEEWIKLATDNKINSTNTWNFALIDYFHDMSLLRDGEDIN-FQKASCTLDGCVKIYTSRIDSVATETGKLLSGLANDSKVLQQTEEGE-----DAENDDEDLQKKKERKRAQRSVKTLVKDFESIRAKKFELECSFDPLFKKMCADFDEDGAKGLLMNHLCV 226          
BLAST of Condensin complex subunit 2 vs. TrEMBL
Match: A0A068YGG5 (Condensin complex subunit 2 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000907700 PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 1.593e-51
Identity = 227/812 (27.96%), Postives = 364/812 (44.83%), Query Frame = 2
Query:  119 EENDDTKEKRANRKSIVEKVPNTLIINNQKLD----------LPNNRNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVK--ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXX---XXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIK--------KIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEV-IYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLREMMAKKELEIEEC-------NMPEESICGMD---------DYQHDGVDMEYSAIVPEINEPII--AEKEAVEVDKDDLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKL---------------INIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHWEP-----TKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLMNREVL--LVNKAFKKHTENIQNIQLKDEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMG------ASFHDN------FEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASID-------AIEIKTIQAKK---------YPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFGIGNSLYNISRKRQSL 2278
            E+N+D  E+ A R+S + + P+  ++N+   D          LP  R  +G+HYGNCI+LA+ENKI  KNAF LHLID++ + +K  +   F+   SSLDA  KIYA RVD+V   TY+VLTGLG  + +  +      +   + G ++D  +E+          + +R    NIK        KIR      ++EVDP+FQ QA  +DDGG  ELRLN L       EL  DS T ++    +          V +Y I  F S   E      P+C  F+DF F          N +  E+   +     L ++E         +P  S   MD             DG D E    V  +NE  +    K+ V+V   D +        +  GE  +SS+  M+ + +E +G++N+ +LGLWAGP  W+KKA+  +L               + + K  +    K+ K+    +   +      R     +++  W       TK    S  L E   +   ++  LLP     + ++I +L NREV+  LV+K   +  EN+    + D   V  +  +Q ++V           D G+V +     ++ DY  D   Y G        F++N       EG+    + A  + + +++I YA++AK I+V+++K+ +WS++++          A+E+ +  AKK                S +  FS L+ AL A++  + + +LSVAI   CLL LANE  L +    D  DL I +G    ++  I      +   + SR ++ L
Sbjct:   49 EQNNDDVERIARRRSRLLE-PHPEVVNSPAHDAARRAAATQFLP--RAQVGEHYGNCIRLAAENKITYKNAFDLHLIDFMGEMIKKEDFTSFRMASSSLDASAKIYAGRVDAVHQETYKVLTGLGRSDSKTTKTGTDGDDPRTLDG-VNDSVDELGSGVAVNDRKRRERKRAPNIKPVIVTTLSKIRSRIKAFEAEVDPLFQQQAAAYDDGGIVELRLNRLRTYSKFSELLQDSGTPLFNLREEAGSLTCCTQPVDLYPI--FDSHTLE-----APLCLAFDDFHF----------NKLNDETRAHIAPLSPLFVQEAYDSATTTPIPLASPPQMDIDDDNTAFPIPDTDGDDFE----VTLVNEGNVKSGNKDGVQV--IDAVENQNTAEPTAEGELFVSSLKSMLATHLENFGQVNDGILGLWAGPEHWRKKAKRRRLDEFGNVAAQVENEENVTVGKSARSRCAKKTKKTSMDYAAVLLDTGENRSKSGCVVRGDWSKQLEIYTKASGKSPVLREQNRRLAGERFNLLPPSIADARQNIYELFNREVMRNLVDKRTNETHENVTANAMADGGIVPPWLDSQEDEV----------HDDGDVGDMVANDDD-DY--DVAPYDGVFTQGTTGFNENTPTMMPLEGEDGVKLVAPPRQIARLEIGYARSAKLINVRHLKSVLWSMIESDFGATLSLTTAVEVLSPPAKKTRTSTEADAVSAPPSPSSSSSFSDLLTALPAKVSKQTAGELSVAIGLNCLLHLANEKDLFLETGMDYADLFISRGLPATELNLISQHKRCSHRGDASRSKKQL 820          
BLAST of Condensin complex subunit 2 vs. TrEMBL
Match: U6IY34 (Condensin complex subunit OS=Echinococcus granulosus OX=6210 GN=EGR_00441 PE=4 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 3.640e-51
Identity = 224/804 (27.86%), Postives = 364/804 (45.27%), Query Frame = 2
Query:  119 EENDDTKEKRANRKSIVEKVPNTLIINNQKLD----------LPNNRNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVK--ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXX-----XXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIK--------KIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEV-IYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGS-------------ETMNSMTAESLREMMAKKELEIEECNMPEESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVDKDDLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKL---------------INIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHWEP-----TKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLMNREVL--LVNKAFKKHTENIQNIQLKDEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGAS-FHDN------FEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCL----------------FSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFGIGNSLYNISRKRQSL 2278
            E+N+D  E+ A R+S + + P+  ++N+   D          LP  R  +G+HYGNCI+LA+ENKI  KNAF LHLID++ + +K  +   F+   SSLDA  KIYA RVD+V   TY+VLTGLG  + +  +        +   + G ++D  +E+          + +R    NIK        KIR      +++VDP+FQ QA  +DDGG  ELRLN L       EL  DS T ++    +          V +Y I  F S   E      P+C  F+DF F    + +             E  +S+T   +  + +  +++I++ N              DG D E + +V E N  I   K  V+V   D +        +  GE  +SS+  M+ + +E +G++N+ +LGLWAGP  W+KKA+  +L               + + K  +   VK+ K+    +   +      R     +++  W       TK    S  L E   +   ++  LLP     + ++I +L NREV+  LV+K   +  EN+    + D   V  +  +QA        V    D    V N+  + + A Y  D     G + F++N       EG+    + A  + + +++I YA++AK I+V+++K+ +WS++++ + A    T  A+        ++T                  FS L+ AL A++  + + +LSVAI   CLL LANE  L +    D  DL I QG    ++  I      +   + SR ++ L
Sbjct:   49 EQNNDDVERIARRRSRLLE-PHPEVVNSPAHDAARRAAATQFLP--RAQVGEHYGNCIRLAAENKITYKNAFDLHLIDFMGEMIKKEDFTSFRMASSSLDASAKIYAGRVDAVHQETYKVLTGLGRSDSKTTKTGTDGDGNDPRALDG-VNDSVDELGGGVAVNDRKRRERKRAPNIKPVIVTALSKIRSRIKPFEADVDPLFQQQAAAYDDGGIVELRLNRLRTYSKFSELLQDSGTPLFNLREEAGSLTCCTQPVDLYPI--FDSHTLE-----APLCLAFDDFHFNKLNDETRAHIAPLSPLFVQEAYDSVTTTPI-PLASPPQMDIDDDN------TAFPIPDTDGDDFEVT-LVNEGNV-ISGNKGGVQV--IDAVENQNTAEPTAEGELFVSSLKSMLATHLENFGQVNDGILGLWAGPEHWRKKAKRRRLDEFGNVAAQVQNEENVTVGKSARSRCVKKTKKTSMDYAAVLLDTGENRSKSGCVVRGDWSKQLEIYTKASGKSPVLREQNRRLAGERFNLLPPSIADARQNIYELFNREVMRNLVDKRTNETHENVTANAMADGGIVPPWLDSQAAAAAAEDEVHDDADVGDMVANDDDDYDVAPY--DGIFTQGPTGFNENTPTMMPLEGEDGVKLVAPPRQIARLEIGYARSAKLINVRHLKSVLWSMIESDLGATPSLTTAAEVLSPPAKKTRTSTEADAVSAPPSPSSSSSFSDLLTALPAKVSKQTAGELSVAIGLNCLLHLANEKDLFLETGMDYADLFISQGLPATELNLISQHKRCSHRGDASRSKKQL 828          
BLAST of Condensin complex subunit 2 vs. TrEMBL
Match: A0A0R3X4T5 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS8423 PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 5.433e-50
Identity = 206/815 (25.28%), Postives = 354/815 (43.44%), Query Frame = 2
Query:  119 EENDDTKEKRANRKSIVEKVPNTLIINNQKLDLPNN--------RNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVK--ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXX-----XAPMSGH-------LSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEVIYDISS----------FMSQFKEISEGNIPMCDQFEDFQFCGWKEGSET----MNSMTAESLREMMAKKELEIEECNMPEESICGMDDYQHDGVDMEYSAI-----VPEINEPI----IAEKEAVEVDKDDLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKL----------------INIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHWEP-----TKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLMNREVL--LVNKAFKKHTENIQNIQLKDEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMG-ASFHDN------FEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASI-------DAIEIKTIQAKKYPNLHLSS-------------KTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFGIGNSLYNISRKRQSL 2278
            E+N+D  E+ A R+S + + P+  ++N+   D            R  +G+HYGNCI+LA+ENKI  KNAF LHLID++ + +K  +   F+   SSLDA  KIYA RVD+V   TY+VLTGLG  + +  +            + G        +S      + ++ +++    K  ++  + KIR      +++VDP+FQ QA  +DDGG  ELRLN L       EL  DS+            P  +  E  Y +S           F S   E      P+C  F+DF F    + + T    ++ +  E   + +    + +   +M  +    +     DG D E + I     +PE  + +     AEK+ V                +  GE  +SS+  M+ + +E +G++N+ +LGLWAGP  W+KKA+  +L                 ++ K  +    K+ K +   +   +      R     +++  W       TK    S  L E   +   ++  LLP     + ++I +L NREV+  LV++   +  EN+    + D   V  +  +QA      + V    D    V+    + ++     D     G   F +N       EG+    +    + + +++I YA++AK I+V+++K+ +WS++++ +          E+ +   KK      ++              +  F  ++ AL A++  + + +LSVAI   CLL LANE  L +    D  DL I QG    +++ I          ++SR ++ L
Sbjct:   49 EQNNDDVERIARRRSRLLE-PHPEVVNSPAHDAARRVVATPFVPRAQVGEHYGNCIRLAAENKITYKNAFDLHLIDFMGEMIKKEDFTSFRMASSSLDASAKIYAGRVDAVHQETYKVLTGLGRSDSKTTKATAGCDGDDSRALDGANDSVDELVSGVAINDRRRRERKRAPNAKSVIITTLNKIRSRIKAFEADVDPLFQQQAAAYDDGGTVELRLNRLRTYSKYSELLQDSD-----------TPLFNPREEAYSLSCCTQPVDLYPVFDSHTLE-----APLCLAFDDFHFTKHNDETSTHIAPLSPIFMEDPHDSVTTTPIPLASPSMDVDDNAAIPAPDADGDDGEVTLINKGSAIPENMDGVRAIDAAEKQNV-------------AEPTAEGELFVSSLKSMLTTHLENFGQVNDGVLGLWAGPEHWRKKAKRRRLDEFGNVAAQVENEENVTSVGKSARSKCAKKPKRMTMDYAAVLLDAGENRSKSGCVVRGDWSKQLEVYTKESGKSPVLREQNRRLAGERFNLLPPSIADARQNIYELFNREVMRNLVDRRTNETHENVTANAMADGGIVPPWLDSQAAAAAAEEGVHDDADVGDLVDMVADDDDDDVAPYDGIFTQGPGGFSENTPTVAPLEGEDGVKLVVPPRQIARLEIGYARSAKLINVRHLKSVLWSMIESDLAAAPVLAATAEVTSPPPKKIRTFAETATSPASSSSPSPSPPSSSFGDVLTALPAKVSKQTAGELSVAIGLNCLLHLANEKDLFLAAGADYADLSISQGLPSTELDLISQHKRCMHRGDVSRSKKQL 833          
BLAST of Condensin complex subunit 2 vs. TrEMBL
Match: A0A4E0RIN3 (Condensin complex subunit 2 OS=Fasciola hepatica OX=6192 GN=D915_001631 PE=4 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 1.372e-49
Identity = 148/432 (34.26%), Postives = 220/432 (50.93%), Query Frame = 2
Query:  119 EENDDTKEKRANRKS-IVEKVP--------NTLIINNQKLDLPN--NRNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVKELNH--FQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQ-NIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEV-IYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLREMMAKKELEIEECNMPEESICGMDDYQHDGV-DMEYSAIVPEINEPII-----------AEKEAVEVDK--DD-----LITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKL 1312
            +EN+D  E+ A RKS ++E  P        N      ++   P   ++  IG+HYGNCI+LA+ENKI +KNAF+LHLIDY+ D +K+ ++  FQ   SSLDAG KIYA RVD+V   TYQVLTGLG  ++     + ++    G  +            RK  +V R ++Q  + KIR      +++VDP+FQ Q   +++GG +ELRLN L  LD    L LDS T I          K   N V +  I  F+S  +  +   + +C   EDF+F  W +G +   S T  S  +M +    +    +  ++     D  Q D + D   +   PEI + I+             KE V V+K  DD     + T GTD      GE  +SS+  M++   E +G++N+ +LG+WAGP  W+KKA+  + 
Sbjct:   47 DENNDDDERLARRKSRLLEPHPASANSPCANASTTRRREAAAPRGISQAQIGEHYGNCIRLAAENKITAKNAFNLHLIDYMSDMLKKEDYASFQIASSSLDAGAKIYAGRVDAVHQETYQVLTGLGRSDKLQPTGDEDDE-NPGDDATGPIGSANIAKDRKKTQVHRDIIQKQLNKIRSKVLAAKADVDPLFQHQTATYNEGGTAELRLNQLCTLDEACVLILDSSTQIMHTSS-----KPTTNTVNVTGILDFLSPLQPKNISQLHICSSLEDFRFTNWDKGQDWDASTTRPSELQMKSPPITDSGPVDDDDDHSHFADYPQEDNLNDGTLTEEPPEITDKIVPCGSSAAAAAATSKEIVPVEKSLDDTPSSPVHTTGTD------GELFVSSLKSMLDKQYEHFGQLNDHLLGMWAGPEHWRKKAKRRRF 466          
BLAST of Condensin complex subunit 2 vs. TrEMBL
Match: A0A0R3S9F7 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS882 PE=4 SV=2)

HSP 1 Score: 192.971 bits (489), Expect = 1.456e-47
Identity = 212/823 (25.76%), Postives = 344/823 (41.80%), Query Frame = 2
Query:   98 NYIFLNIEENDDTKEKRANRKSIVEKVPNTLIINNQKLDLPNN--------RNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVK--ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAP---MSGHLSDQXXXXXXXXXXXXXXXXXR------TLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEVIYDISSFMSQ---------FKEISEGNI--PMCDQFEDFQFCGWKEGSETMNSMTAESLREMMAKKELEIEECNMPEESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEA----VEVDKDD----LITLGTDK------------------TDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLK----------------LINIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHW-----EPTKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLMNREVL--LVNKAFKKHTENIQNIQLKDEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQE---EADYISDCDAYMGASFHDNFEGD------FEDP----VTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKK--------------------YPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLF 2230
            +++ LN + NDD +     R  ++E  P+  +IN+   D            R  +G+HYGNCI+LA+ENKI  KNAF LHLIDY+ + +K  +   F+   SSLDA  KIYA RVD+V   TY+VLTGLG  ++      +       + G   D   +++     RK    KR       +V ++ KIR      +++VDP+FQ QA  +DDGG  EL LN L       EL  DS                  N  ++D    +S          +  I   ++  P+C  F+ F+F    +  ++  S+  + +  +                         HD   +E  A  P     +  + +     V  D+DD    L+ +G DK                    +  GE  +SS+  M+ + +E +G +N+ +LGLWAGP  W+KKA+  +                +  + K  +    K+ K     +   +      R     +++  W     + TK+   ST L E  L+   ++  +LP     + ++I +L NREV+  +V+       EN     + +   V  +        L+ Q+   V +D  + ++N         AD   D   Y G  F     GD       ED     + A  + V ++DI YA+ AK I+V+++K+ +W ++   + A   ++  AKK                     P       TC FS ++  L +++    + +LSVAI   CLL LANE  L +   +   D+LI QG S  ++E I  +
Sbjct:   43 SFLGLNEQNNDDVERMARRRSRLLE--PHPEVINSPAHDTARRAIASQAVPRTQVGEHYGNCIRLAAENKITYKNAFDLHLIDYMGEMIKKEDFTSFRMASSSLDASAKIYAGRVDAVHQETYKVLTGLGRSDKPPKSDKDGGDENDQVPGESDDSANDIEGGTNDRKKKDRKRIPNGKKVIVTSLIKIRSKVKGFEADVDPLFQQQAAAYDDGGTVELSLNRLRTRSKFSELLQDS------------------NTPLFDFGDSLSTVCCIKPVELYPPIDSHSLEAPLCVAFDHFRF---NDDEQSTMSVHLDPITPVAI-----------------------HDAYVVENEAPAPPPVMDMDDDNDVAMPLVNGDEDDNDVTLVNMGHDKLANDGGVQAVNAETEQPIEPTSEGELFVSSLKSMLTAHLENFGHVNDGVLGLWAGPEHWRKKAKRRRLDEFGNAAPFDNEENEVTTVGKSSRTKTTKKSKPTTVEYVGALLDAGENRSRSGCLVRNDWSKELEQYTKDSGKSTILREQNLRLAGERFNILPPSITDARQNIYELFNREVMRNIVDPNTTVTQENAAAQAMAEGGIVPPW--------LDSQAAAAVAEDGCHDDDNDAGDIDHMPADDDDDIAPYDGI-FTQQGAGDNSLTVPMEDEDGMQLVAPPRQVARLDIGYARAAKLINVRHLKSVLWDMIDRDLTANSDRSPPAKKPRPSVEEDGEGGDGVETSQDKPTQGEFRPTCHFSDILTTLPSKVSKSTASELSVAIGLNCLLHLANEKDLFLDTGEGCIDILISQGPSASELEMISQY 810          
BLAST of Condensin complex subunit 2 vs. Ensembl Cavefish
Match: ncaph (non-SMC condensin I complex subunit H [Source:NCBI gene;Acc:103036217])

HSP 1 Score: 171.4 bits (433), Expect = 2.800e-44
Identity = 188/722 (26.04%), Postives = 311/722 (43.07%), Query Frame = 2
Query:   95 SNYIFLNIEENDDTKEKRANRKSIVEKV----------PNTLIINNQKLDLPN-NRNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVKELN---HFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLRE----MMAKKELEIEECNMPEESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVDKDDLITLGTDKTDSCN-GEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKLINIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHWEPTKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLMNREVLLVNKAFKKHTENIQNIQLKDEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASID--AIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGY 2197
            S  +  +I+ NDD +E+R  RKS V  +            T         +P  +   I +HY  CIKL++ENKI +KNAF LHLIDY+ D +KE +   +F+    +LDA  KIYA RVD+V  + Y+VL GLG + +    +  ++       S+Q       K   K    K+T+ QN+  I +  ++++ EVDP+FQ  A +FD+   + + L+ L   D   EL   S       ++    P A         S F +  + + E  I  C   +DF F  W     T  +   E +++         E+E E  + P+      +D+  DG DM                 +  +  K+     G+DK      GE  +S++   ++    +Y   + + +  W GP  W  K    +    D  K+P        +   F E I F              ++  TK    +T ++++ L  + +K   LP   Q+ L +++QL  +    +N   KK        +L +E  +  Y+ N AND        L   D+ +    +   +++  I D    + A   D      ED +      V  I+I+YA+TAK++D+K +K  MWS+L  S +  A E+++  + + P          F +    L+  L    + +LSV +    LL LANE  L +   DD +D++I QG+
Sbjct:   29 STPLLGSIQGNDDEQERRQRRKSKVIDLHGVGDSSINEGGTFSNAGTPAAVPKLSSAQISEHYSTCIKLSTENKITTKNAFGLHLIDYMADILKEKDSELNFKVAAGTLDASAKIYAVRVDAVHADAYRVLGGLGAETKPKEGQEGDDDATEDGQSEQ----ASAKQAPKKRPPKKTVEQNLSNINLLESEMKCEVDPMFQRMAASFDENSTAGVFLSVLFSEDSRCELRFPSH----MTLLQSRPPSAPAPVQHSPASPFTASLRALEEKCI--CPSLKDFSFTQWTPDQSTSLNQLLEKMKQGEHAFDVNAEIEPEVDDAPD-----FEDFDADGDDMGPGDC-----------GDVFDEHKEGCAQRGSDKRGVIPIGEADISTMCLQLSDKPREYSYFSPRTMATWVGPGYWLFKPTHKQDHKPD--KEPKKRAPKNPLVIDFSEDIHFH------------NYFRTTK---AATTISKSALNSS-NKKTTLPADFQYPLSNLSQLSLKPSNTLNAEGKKRLSG----ELTEE--IGEYDYNNANDTANF-CPGLQAGDSDDEAEGFAGTDDSPPIED---RLNAFDPDGVSTYGEDCLVPEPHKVNIIEINYARTAKKMDMKRLKTSMWSLLTDSQEKAAPEVESESSHEVPGEK------SFRESTKTLLQRLPTTMANNLSVPLAFVALLHLANEKNLELHKVDDMSDIIIKQGH 690          
BLAST of Condensin complex subunit 2 vs. Ensembl Sea Lamprey
Match: ncaph (non-SMC condensin I complex, subunit H [Source:ZFIN;Acc:ZDB-GENE-070112-652])

HSP 1 Score: 97.4413 bits (241), Expect = 4.432e-21
Identity = 57/139 (41.01%), Postives = 79/139 (56.83%), Query Frame = 2
Query:   65 DDSSMSNRKLSNYIFLNIEENDDTKEKRANR------KSIVEKVPNTLIINNQKLDLPNNRND--IGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVK----ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVL 445
            DD S++N  L  ++     + DD KE+R +R      K  V  +  T+      L LP    +  + +HY  CIKL++ENKI +KNAF LHLIDY+ D  K    E+ +FQ    +LDA TKIYA RVDSV  + Y++L
Sbjct:   39 DDGSVANSPL--FLGSKKSDADDRKERRKSRVIELQQKGGVSPISPTIDRRRSLLTLPGGMTNAQLSEHYSTCIKLSTENKITTKNAFGLHLIDYMADLCKQKGTEMTNFQMAAGTLDASTKIYAVRVDSVHADAYKML 175          

HSP 2 Score: 63.929 bits (154), Expect = 9.283e-11
Identity = 46/119 (38.66%), Postives = 65/119 (54.62%), Query Frame = 2
Query: 1838 DPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQAS-IDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQ 2191
            D + A    V +I +DYAKTAK++DVK +K  +W++L     D   + T    +  +  +S K  LFS++   L A L    SK+LSV +   CLL LANE  L I+  +D  DL I Q
Sbjct:  598 DNLVAEPHKVNKIQLDYAKTAKKMDVKRLKQNIWNMLTMQEGDMGSLPTNNTNENEDAKVS-KEILFSEMYKKLPARLPISMSKNLSVPMAFVCLLHLANEKNLVISGQEDLLDLKINQ 715          
BLAST of Condensin complex subunit 2 vs. Ensembl Yeast
Match: BRN1 (Subunit of the condensin complex; required for chromosome condensation and for clustering of tRNA genes at the nucleolus; may influence multiple aspects of chromosome transmission [Source:SGD;Acc:S000000193])

HSP 1 Score: 67.0106 bits (162), Expect = 6.846e-12
Identity = 55/193 (28.50%), Postives = 96/193 (49.74%), Query Frame = 2
Query:  215 LPNNRNDIGKHYGNCIKLASENKINSKNAFSLHLIDY------LQDFVKELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXA-------------------PMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTL 718
            L  NR+ +  ++   IK+A++NKINS+N+++  LIDY      L+D    +N FQ   ++LD   KIY+SRVDSV T T ++L+GL  +        ++                     P++G     + +V   + +     ++ TLV+  + I++     +  +DP+F+    +FD+GG   L LN L +
Sbjct:   20 LFTNRSTMMANFEEWIKMATDNKINSRNSWNFALIDYFYDLDVLKDGENNIN-FQKASATLDGCIKIYSSRVDSVTTETGKLLSGLAQRKTNGASNGDDSNGGNGEGLGGDSDEANIEIDPLTGMPISNDPDVNNTRRRVYNRVLETTLVE-FETIKMKELDQELIIDPLFKKALVDFDEGGAKSLLLNTLNI 210          

HSP 2 Score: 53.5286 bits (127), Expect = 9.610e-8
Identity = 44/145 (30.34%), Postives = 69/145 (47.59%), Query Frame = 2
Query: 1799 GASFHDNFEGDFEDPVTANVKHVEQIDID-----------YAKTAKRIDVKNIKAKMWSILQASIDAIEIK--TIQAKKYPNLHL---SSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLI 2185
            G  F+  FEG  +D   A+VK   Q D D           Y++ +K++DV+ +K  +W  +   I   + +    Q+      H    S+K   FS +I  +      +  KD+S +    CLL LANE GL IT T++ NDL++
Sbjct:  599 GVDFNQAFEG-TDDNEEASVKLDLQDDEDHKFPIRENKVTYSRVSKKVDVRRLKKNVWRSINNLIQEHDSRKNREQSSNDSETHTEDESTKELKFSDIIQGISKMYSDDTLKDISTSFCFICLLHLANEHGLQITHTENYNDLIV 742          
BLAST of Condensin complex subunit 2 vs. Ensembl Medaka
Match: ncaph (non-SMC condensin I complex subunit H [Source:NCBI gene;Acc:101162454])

HSP 1 Score: 155.221 bits (391), Expect = 6.501e-39
Identity = 188/681 (27.61%), Postives = 296/681 (43.47%), Query Frame = 2
Query:  236 IGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVK----ELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLREMMAKKELEIEECNM----PEESICGMD---DYQHDGVDMEYSAIVPEINEPIIAEKEAVEVDKD----DLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKLINIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHWEPTKNELVSTQLTEACLKRNVDKDYLLPER--SQFSLKSINQLMNREVLLVNKAFKKHTENIQNIQLKDEDKVLNYEPNQANDVLE----MQSVTLVTDD----AGNVNNNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTC---LFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQG 2194
            I +HY  CIKL++ENKI +KNAF LHLIDY+ D +K    EL +F+    +LDA TKIYA RVD+V  + Y+VL GLG       +     A  +G+  D + E    K  +K    K+T+ QN+  I  + ++ + EVDP+FQ  A +FD+   + + L+ L   +   EL   S  I+       + P           S FM+  +   E +  +C   +DF F  W    +TMN      L E M + E  + + N       E   G++   DY+   VD +         E +   KE  E        D+I +         GE  +S++   ++S   +Y   + + +  WAGP  W+ K +  KL ++   K+    K  K  +  F + + F          + +     T N  V + L+    K  +  D+  P    SQ SLK  + L                E  + +  +  D + +Y+ N AND       +Q      DD     G+ +       EA    D +   G S +       ED +      V +I+I+YAKTAK++D+K +K  MW++L  S +    +T++ +           C    FSQ    L+  L    +++LSV +    LL LANE  L +   DD +D++I QG
Sbjct:   89 ISEHYSTCIKLSTENKITTKNAFGLHLIDYMADILKQKDSELTNFKVAAGTLDASTKIYAVRVDAVHADAYRVLGGLG----GETKPGEARAAEAGN-EDDDGEEVTAKQPKKKRPPKKTVEQNLNNINSSESERKCEVDPMFQRMASSFDETSTAGVFLSVLFSENSRCELLFPSHLILLQSTPSYSPPAPQSTPA----SPFMAGLQRSQEKSS-ICPSLQDFSFTSWNP-EQTMN-----QLLEKMKEGE-HVFDVNADPDPEPEEDEGLEFDADYEEGQVDSQ---------EGLKEYKEGCEATGSGKGRDVIPI---------GEGDISTMCLQLSSQPREYSYFSPRTMATWAGPGYWQFKPKH-KLDHL-PDKETRKRKPKKTFEIDFSDDVNF--------DTLFRTSRAATTN--VKSALSTTNKKTTLPTDFQFPPETLSQLSLKPSSSLCQ--------------EGQKRLSGEVGDGIGDYDYNNANDTANFCPGLQGGDSDDDDVEGFTGSDDIQPSGGSEAPPSQDLE---GVSTYG------EDELVPEPHRVNKIEINYAKTAKKMDMKKLKNSMWTLLTDSPEEKVKETVETQ---------DVCGEKAFSQTTKMLLQRLPNVMAQNLSVPLAFVALLHLANEKNLELVKVDDMSDIIIRQG 690          
BLAST of Condensin complex subunit 2 vs. Planmine SMEST
Match: SMESG000037461.1 (SMESG000037461.1)

HSP 1 Score: 1297.34 bits (3356), Expect = 0.000e+0
Identity = 698/763 (91.48%), Postives = 721/763 (94.50%), Query Frame = 2
Query:   26 MKSIFNESDNTISDDSSMSNRKLSNYIFLNIEENDDTKEKRANRKSIVEKVPNTLIINNQKLDLPNNRNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVKELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLREMMAKKELEIEECNMPEESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVDKDDLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKLINIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHWEPTKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLMNREVLLVNKAFKKHTENIQNIQLKDEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFGIGNSLYNISRKRQSLDCSGD-RVRCKK 2311
            MK++FN+S+++I+DD+S  +R+LS+  FL+IEENDDTKEKRANRKSIVEKVP  LI+N+QK DL N +NDIG HYGNCIKLASENKINSKNAFSLHLID+LQ+FVKEL HFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGNQNEEN +KNNEE P+   LS+ +EE K  KPKRK NKVK TLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSETIIYTDIIDGTDPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLREMMAKKELEIEECNMP ESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVDKDDLITLGTDKT+SCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKLINIDKKKKPAVVKEVKEIKPIFPEKIEFRLNERGICRMIIKKHWEPTKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLMNREVLLVNKAFKKHTENIQNIQLKDEDKVLNYEPNQAND LEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLF                DCSG+ R RCKK
Sbjct:    1 MKNVFNDSEDSITDDASFPSRRLSHSNFLDIEENDDTKEKRANRKSIVEKVPKALIVNDQKSDLANGQNDIGNHYGNCIKLASENKINSKNAFSLHLIDHLQNFVKELRHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGNQNEENPKKNNEETPIEDDLSNPDEEAKITKPKRKANKVKTTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSETIIYTDIIDGTDPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLREMMAKKELEIEECNMPGESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVDKDDLITLGTDKTNSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKLINIDKKKKPAVVKEVKEIKPIFPEKIEFRLNERGICRMIIKKHWEPTKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLMNREVLLVNKAFKKHTENIQNIQLKDEDKVLNYEPNQANDGLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLF----------------DCSGEGRARCKK 747          
BLAST of Condensin complex subunit 2 vs. Planmine SMEST
Match: SMESG000037465.1 (SMESG000037465.1)

HSP 1 Score: 1204.5 bits (3115), Expect = 0.000e+0
Identity = 646/699 (92.42%), Postives = 667/699 (95.42%), Query Frame = 2
Query:  215 LPNNRNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVKELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLREMMAKKELEIEECNMPEESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVDKDDLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKLINIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHWEPTKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLMNREVLLVNKAFKKHTENIQNIQLKDEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFGIGNSLYNISRKRQSLDCSGDRVRCKK 2311
            L  +RNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVKELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGNQNEENFQKNNEEAPMSGHLSDQEEEVKFKKPKRKVNKVKRTLVQNIKKIRINPAQLQSEVDPIFQSQA +FDDGGNSELRLNNLTLLDITYELALDSETIIYTDIIDGTDPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLREMMAKKELEIEECNMP ESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVDKDDLITLGTDKTDSCNG  LMSSV+DMVNSFVEQYGEINEKMLGLWAGPHLWK KAE +K I ID KKKPAVVK+V++ K +FPE IE RLNE GI RM++ K W+ +KNE  STQLTE CL +N+ KDYLLP + QFS+KS+NQLMNREVLLVNKAFKK TE +  IQ+ DEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFGIGNSL+NISRKRQSLDCSGDRV+CKK
Sbjct:   13 LLKSRNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVKELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGNQNEENFQKNNEEAPMSGHLSDQEEEVKFKKPKRKVNKVKRTLVQNIKKIRINPAQLQSEVDPIFQSQAEDFDDGGNSELRLNNLTLLDITYELALDSETIIYTDIIDGTDPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLREMMAKKELEIEECNMPGESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVDKDDLITLGTDKTDSCNGNVLMSSVMDMVNSFVEQYGEINEKMLGLWAGPHLWKVKAEQMKPIKIDNKKKPAVVKQVRDAKQVFPENIETRLNEEGIGRMVLIKEWKISKNEPASTQLTEICLSKNITKDYLLPAKIQFSIKSLNQLMNREVLLVNKAFKKQTELMHQIQITDEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFGIGNSLHNISRKRQSLDCSGDRVQCKK 711          
BLAST of Condensin complex subunit 2 vs. Planmine SMEST
Match: SMESG000037465.1 (SMESG000037465.1)

HSP 1 Score: 1202.96 bits (3111), Expect = 0.000e+0
Identity = 645/695 (92.81%), Postives = 665/695 (95.68%), Query Frame = 2
Query:  227 RNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVKELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGXXXXXXXXXXXXXAPMSGHLSDQXXXXXXXXXXXXXXXXXRTLVQNIKKIRINPAQLQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSEXXXXXXXXXXXXPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLREMMAKKELEIEECNMPEESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVDKDDLITLGTDKTDSCNGEFLMSSVVDMVNSFVEQYGEINEKMLGLWAGPHLWKKKAESLKLINIDXXXXXXXXXXXXXXXXXFPEKIEFRLNERGICRMIIKKHWEPTKNELVSTQLTEACLKRNVDKDYLLPERSQFSLKSINQLMNREVLLVNKAFKKHTENIQNIQLKDEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFGIGNSLYNISRKRQSLDCSGDRVRCKK 2311
            RNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVKELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGNQNEENFQKNNEEAPMSGHLSDQEEEVKFKKPKRKVNKVKRTLVQNIKKIRINPAQLQSEVDPIFQSQA +FDDGGNSELRLNNLTLLDITYELALDSETIIYTDIIDGTDPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLREMMAKKELEIEECNMP ESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVDKDDLITLGTDKTDSCNG  LMSSV+DMVNSFVEQYGEINEKMLGLWAGPHLWK KAE +K I ID KKKPAVVK+V++ K +FPE IE RLNE GI RM++ K W+ +KNE  STQLTE CL +N+ KDYLLP + QFS+KS+NQLMNREVLLVNKAFKK TE +  IQ+ DEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFGIGNSL+NISRKRQSLDCSGDRV+CKK
Sbjct:   16 RNDIGKHYGNCIKLASENKINSKNAFSLHLIDYLQDFVKELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGNQNEENFQKNNEEAPMSGHLSDQEEEVKFKKPKRKVNKVKRTLVQNIKKIRINPAQLQSEVDPIFQSQAEDFDDGGNSELRLNNLTLLDITYELALDSETIIYTDIIDGTDPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGSETMNSMTAESLREMMAKKELEIEECNMPGESICGMDDYQHDGVDMEYSAIVPEINEPIIAEKEAVEVDKDDLITLGTDKTDSCNGNVLMSSVMDMVNSFVEQYGEINEKMLGLWAGPHLWKVKAEQMKPIKIDNKKKPAVVKQVRDAKQVFPENIETRLNEEGIGRMVLIKEWKISKNEPASTQLTEICLSKNITKDYLLPAKIQFSIKSLNQLMNREVLLVNKAFKKQTELMHQIQITDEDKVLNYEPNQANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGASFHDNFEGDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEIKTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLLLANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFGIGNSLHNISRKRQSLDCSGDRVQCKK 710          
BLAST of Condensin complex subunit 2 vs. Planmine SMEST
Match: SMESG000059177.1 (SMESG000059177.1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.702e-11
Identity = 31/38 (81.58%), Postives = 33/38 (86.84%), Query Frame = 2
Query:  341 KELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGL 454
            KEL +FQT  S LDAGTKIYASRVDSVF NTYQ+LTGL
Sbjct:   43 KELRNFQTASSLLDAGTKIYASRVDSVFINTYQILTGL 80          
The following BLAST results are available for this feature:
BLAST of Condensin complex subunit 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NCAPH3.807e-3027.70non-SMC condensin I complex subunit H [Source:HGNC... [more]
NCAPH4.616e-3028.17non-SMC condensin I complex subunit H [Source:HGNC... [more]
NCAPH5.820e-3027.70non-SMC condensin I complex subunit H [Source:HGNC... [more]
NCAPH1.179e-1525.91non-SMC condensin I complex subunit H [Source:HGNC... [more]
NCAPH2.252e-1237.10non-SMC condensin I complex subunit H [Source:HGNC... [more]
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
barr2.191e-838.03gene:FBgn0014127 transcript:FBtr0081349[more]
barr2.191e-838.03gene:FBgn0014127 transcript:FBtr0343850[more]
barr2.191e-838.03gene:FBgn0014127 transcript:FBtr0081348[more]
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ncaph1.090e-3724.52non-SMC condensin I complex, subunit H [Source:ZFI... [more]
ncaph2.936e-3624.52non-SMC condensin I complex, subunit H [Source:ZFI... [more]
ncaph2.936e-3624.52non-SMC condensin I complex, subunit H [Source:ZFI... [more]
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncaph6.479e-4426.15non-SMC condensin I complex subunit H [Source:NCBI... [more]
ncaph1.145e-4225.52non-SMC condensin I complex subunit H [Source:NCBI... [more]
ncaph2.626e-4226.27non-SMC condensin I complex subunit H [Source:NCBI... [more]
ncaph6.463e-4125.82non-SMC condensin I complex subunit H [Source:NCBI... [more]
ncaph3.856e-3525.71non-SMC condensin I complex subunit H [Source:NCBI... [more]
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ncaph1.017e-4026.22non-SMC condensin I complex, subunit H [Source:MGI... [more]
back to top
BLAST of Condensin complex subunit 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O13067|CND2_XENLA1.097e-4325.42Condensin complex subunit 2 OS=Xenopus laevis OX=8... [more]
sp|Q8C156|CND2_MOUSE7.115e-4026.22Condensin complex subunit 2 OS=Mus musculus OX=100... [more]
sp|Q15003|CND2_HUMAN2.795e-2927.70Condensin complex subunit 2 OS=Homo sapiens OX=960... [more]
sp|Q564K3|CND2_ARATH2.908e-1534.15Condensin complex subunit 2 OS=Arabidopsis thalian... [more]
sp|Q9Y7R3|CND2_SCHPO2.062e-1230.00Condensin complex subunit 2 OS=Schizosaccharomyces... [more]
back to top
BLAST of Condensin complex subunit 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068YGG51.593e-5127.96Condensin complex subunit 2 OS=Echinococcus multil... [more]
U6IY343.640e-5127.86Condensin complex subunit OS=Echinococcus granulos... [more]
A0A0R3X4T55.433e-5025.28Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A4E0RIN31.372e-4934.26Condensin complex subunit 2 OS=Fasciola hepatica O... [more]
A0A0R3S9F71.456e-4725.76Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ncaph2.800e-4426.04non-SMC condensin I complex subunit H [Source:NCBI... [more]
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ncaph4.432e-2141.01non-SMC condensin I complex, subunit H [Source:ZFI... [more]
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BRN16.846e-1228.50Subunit of the condensin complex; required for chr... [more]
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Condensin complex subunit 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ncaph6.501e-3927.61non-SMC condensin I complex subunit H [Source:NCBI... [more]
back to top
BLAST of Condensin complex subunit 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000037461.10.000e+091.48SMESG000037461.1[more]
SMESG000037465.10.000e+092.42SMESG000037465.1[more]
SMESG000037465.10.000e+092.81SMESG000037465.1[more]
SMESG000059177.11.702e-1181.58SMESG000059177.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004629 ID=SMED30004629|Name=Condensin complex subunit 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2458bp
GTGAAATTTAAACCTTGATAGAATTATGAAATCTATTTTTAATGAGAGTG
ATAATACGATTTCAGATGATTCTTCTATGTCAAATCGCAAATTAAGCAAT
TACATTTTTTTAAACATTGAAGAGAACGATGACACCAAAGAAAAACGAGC
AAATAGAAAATCGATTGTTGAAAAGGTTCCAAATACATTGATAATAAATA
ACCAAAAATTAGATTTACCTAATAACAGAAATGATATAGGTAAACATTAT
GGAAATTGTATCAAATTGGCTTCTGAAAATAAAATCAATTCTAAAAATGC
ATTCAGTTTGCATTTAATCGATTATCTTCAAGACTTTGTAAAAGAATTAA
ATCATTTTCAAACGGTTGGATCATCATTAGATGCAGGCACAAAAATTTAT
GCTAGCAGAGTAGATTCAGTTTTTACGAATACATATCAAGTTTTGACTGG
CCTTGGAAATCAAAATGAGGAAAACTTTCAGAAAAATAACGAGGAGGCTC
CAATGAGTGGTCATTTATCGGATCAAGAAGAAGAAGTAAAATTTAAAAAA
CCAAAACGGAAAGTCAACAAGGTTAAAAGAACCCTTGTTCAAAATATCAA
AAAAATCCGTATTAACCCGGCTCAGTTACAAAGTGAAGTTGATCCAATAT
TTCAAAGTCAAGCGGGAAACTTTGACGACGGAGGAAATTCAGAGTTACGC
CTTAACAATTTAACTCTGTTGGATATAACCTATGAATTAGCTTTGGATTC
CGAAACAATCATCTACACAGATATAATAGATGGCACAGATCCGAAAGCCG
ATGAAAATGAAGTTATCTATGACATTTCTTCGTTTATGTCGCAATTTAAA
GAAATAAGCGAAGGAAATATTCCTATGTGCGACCAATTTGAAGATTTTCA
ATTTTGTGGATGGAAAGAAGGCAGTGAAACCATGAATTCCATGACTGCCG
AATCATTGAGAGAAATGATGGCAAAAAAAGAACTGGAGATTGAAGAATGC
AACATGCCGGAGGAATCGATTTGTGGGATGGACGATTACCAACACGACGG
CGTGGATATGGAATATAGCGCCATTGTGCCGGAAATAAATGAGCCAATTA
TAGCTGAAAAGGAAGCTGTGGAAGTAGATAAAGATGATCTTATAACTCTC
GGGACTGACAAAACTGACAGTTGCAATGGTGAGTTTCTCATGTCGAGCGT
AGTTGACATGGTGAACTCGTTTGTCGAGCAGTATGGTGAGATCAATGAAA
AGATGCTCGGATTGTGGGCGGGGCCTCATTTATGGAAGAAAAAAGCTGAG
AGTTTGAAGCTAATCAACATCGATAAGAAGAAAAAGCCTGCCGTTGTAAA
AGAAGTAAAAGAAATTAAGCCAATTTTCCCTGAAAAAATTGAGTTTCGTC
TAAATGAACGAGGTATCTGTCGAATGATAATAAAGAAACATTGGGAACCC
ACGAAAAATGAACTTGTCTCAACACAATTAACGGAAGCATGTCTAAAGAG
AAATGTCGACAAAGATTATTTACTTCCTGAGAGATCTCAATTCTCACTGA
AATCGATCAATCAGTTGATGAACCGTGAAGTATTATTGGTAAATAAAGCT
TTTAAAAAGCACACAGAAAACATTCAAAATATTCAATTAAAAGATGAAGA
TAAAGTTTTGAACTACGAACCGAATCAAGCAAACGACGTGCTTGAAATGC
AGTCAGTGACTTTAGTAACTGATGATGCGGGCAATGTCAATAATAATTAT
CAGGAGCAGGAGGAGGCGGATTATATATCAGATTGTGATGCTTACATGGG
GGCCTCATTTCATGATAATTTCGAGGGCGATTTTGAAGACCCAGTCACTG
CAAATGTCAAGCATGTCGAACAAATAGATATTGATTATGCCAAAACTGCC
AAGCGAATTGACGTGAAGAATATCAAGGCTAAAATGTGGTCCATTTTACA
AGCGTCAATTGACGCAATCGAAATTAAGACTATCCAGGCGAAAAAATACC
CGAATCTCCATTTATCCTCGAAAACCTGTTTATTTTCTCAGTTAATCATT
GCTCTAATTGCGGAACTGAAACCGGAACAATCTAAAGATCTGAGTGTAGC
TATATTGACTACATGTCTTTTGCTGTTGGCAAATGAAACGGGGCTGAATA
TTACAATGACTGATGATAACAATGATCTCCTTATCGGGCAAGGATATTCA
GAATATGACATTGAGCAGATCAAATTATTTGGTATTGGAAATTCATTATA
TAATATCTCCCGTAAACGCCAATCACTAGATTGCTCAGGAGATCGAGTTC
GATGTAAAAAGAATATCAGTATTTTTTCCGACGAAGAAGAAAACGAGGAT
GACTTTTAGATTTCTTTATTTGCTCATGTTTAAATTGTAATTACCTAATG
GATTTGTAAAGCAGATTATAATTGTAAACCTGTGTAAATACATTTTTACA
TTCTTTTA
back to top

protein sequence of SMED30004629-orf-1

>SMED30004629-orf-1 ID=SMED30004629-orf-1|Name=SMED30004629-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=778bp
MKSIFNESDNTISDDSSMSNRKLSNYIFLNIEENDDTKEKRANRKSIVEK
VPNTLIINNQKLDLPNNRNDIGKHYGNCIKLASENKINSKNAFSLHLIDY
LQDFVKELNHFQTVGSSLDAGTKIYASRVDSVFTNTYQVLTGLGNQNEEN
FQKNNEEAPMSGHLSDQEEEVKFKKPKRKVNKVKRTLVQNIKKIRINPAQ
LQSEVDPIFQSQAGNFDDGGNSELRLNNLTLLDITYELALDSETIIYTDI
IDGTDPKADENEVIYDISSFMSQFKEISEGNIPMCDQFEDFQFCGWKEGS
ETMNSMTAESLREMMAKKELEIEECNMPEESICGMDDYQHDGVDMEYSAI
VPEINEPIIAEKEAVEVDKDDLITLGTDKTDSCNGEFLMSSVVDMVNSFV
EQYGEINEKMLGLWAGPHLWKKKAESLKLINIDKKKKPAVVKEVKEIKPI
FPEKIEFRLNERGICRMIIKKHWEPTKNELVSTQLTEACLKRNVDKDYLL
PERSQFSLKSINQLMNREVLLVNKAFKKHTENIQNIQLKDEDKVLNYEPN
QANDVLEMQSVTLVTDDAGNVNNNYQEQEEADYISDCDAYMGASFHDNFE
GDFEDPVTANVKHVEQIDIDYAKTAKRIDVKNIKAKMWSILQASIDAIEI
KTIQAKKYPNLHLSSKTCLFSQLIIALIAELKPEQSKDLSVAILTTCLLL
LANETGLNITMTDDNNDLLIGQGYSEYDIEQIKLFGIGNSLYNISRKRQS
LDCSGDRVRCKKNISIFSDEEENEDDF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR022816Condensin_barren_su2
Vocabulary: biological process
TermDefinition
GO:0007076mitotic chromosome condensation
GO:0007049cell cycle
GO:0007067mitotic nuclear division
GO:0030261chromosome condensation
GO:0051301cell division
Vocabulary: cellular component
TermDefinition
GO:0000796condensin complex