Integrator complex subunit 1

Overview
NameIntegrator complex subunit 1
Smed IDSMED30004622
Length (bp)5876
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Integrator complex subunit 1 (SMED30004622) t-SNE clustered cells

Violin plots show distribution of expression levels for Integrator complex subunit 1 (SMED30004622) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Integrator complex subunit 1 (SMED30004622) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Integrator complex subunit 1 (SMED30004622) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004622

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30004622SMESG000043489.1 SMESG000016870.1 SMESG000016869.1 dd_Smed_v4_2322_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004622SMESG000043489.1 SMESG000016870.1 SMESG000016869.1 dd_Smed_v4_2322_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004622SMESG000043489.1 SMESG000016870.1 SMESG000016869.1 dd_Smed_v4_2322_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004622SMESG000016870.1 Contig42742uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004622SMESG000016870.1 Contig42742newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30004622SMESG000016870.1 SMESG000043668.1 dd_Smed_v4_2837_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004622SMESG000043489.1 SMESG000016870.1 SMESG000016869.1 dd_Smed_v4_2322_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Integrator complex subunit 1 vs. Ensembl Human
Match: INTS1 (integrator complex subunit 1 [Source:HGNC Symbol;Acc:HGNC:24555])

HSP 1 Score: 146.362 bits (368), Expect = 3.824e-34
Identity = 113/408 (27.70%), Postives = 214/408 (52.45%), Query Frame = 3
Query:  795 FKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIART-----LAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFD----ELSNDK---EAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHD 1982
            FK+ +V ++ +++    ML +    V+EA       EK++ E L+S  N +  I+     WL  +   + S ++     + + +VLF              E+Y   D W  E+D+ F +R  +E+PI +  +  ++ +G  + L   P++ + +   L+ RA+A    ++  + V + + +I+ +   C+Y    H  + N+Q+        LA  + +WK    L+V+A+     +G   W  +PT+K LM++++TNN+      L++++   E +++E Q  + + ++I+  E  ++  S    +    +SS L++ L    PQGP R+PP HI++ +KS+NQ +++G  L + RNPDFL  I++ Q  ++  S  W+ DLV ++SE +LD LP+  L EF+ HD
Sbjct:  533 FKERFVVHITDVLAVSMMLGITA-QVKEAGIAWDKGEKRNLEVLRSFQNQIAAIQRDAVWWLHTVVPSI-SKLAPKDYVHCLHKVLFTEQP----------ETYYKWDNWPPESDRNFFLRLCSEVPILEDTLMRILVIGLSRELPLGPADAMELADHLVKRAAAVQADDVEVLKVGRTQ-LIDAVLNLCTY----HHPE-NIQLPPGYQPPNLAISTLYWKAWPLLLVVAAFNPENIGLAAWEEYPTLKMLMEMVMTNNYSYPPCTLTDEETRTEMLNRELQTAQREKQEILAFEGHLAAASTKQTIT--ESSSLLLSQLTSLDPQGPPRRPPPHILDQVKSLNQSLRLGHLLCRSRNPDFLLHIIQRQASSQ--SMPWLADLV-QSSEGSLDVLPVQCLCEFLLHD 917          
BLAST of Integrator complex subunit 1 vs. Ensembl Fly
Match: IntS1 (gene:FBgn0034964 transcript:FBtr0072168)

HSP 1 Score: 159.844 bits (403), Expect = 1.492e-38
Identity = 195/901 (21.64%), Postives = 382/901 (42.40%), Query Frame = 3
Query:  267 KYKLSKPPVQSILLECVRKITETHPCNLRNLLEIYINNEIYGTPTAAAAASNITGTVGNPCPIAYVPQNKSGPASVTFPAVYFRFPSESIKILGELLHEQISVLHHD--IKPVKLFIRDICRWIKLAYINSNGVYTPFASSSSNGALPDSLELHDLAQNLLVDRSNSEALTSRMTDCTFKQLYVENMINIVCELQMLSVVRPTVREA-FKERVDQEKKDYEALKSHFNTLRQIRYFTCKWL----KNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIARTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFDELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHDIYEKIINNLPVVSRNDTKDGSLKRLVHKLRSILCVTETDKRAMDKETLKNIVGALSNSFFNRLSDSSAFIRKVARECLYILLLPISHPIKLMEFSLEFVDTLKSIMNLNILQDNSLICSVAEALRETLKFETDIDVLHSYIDLFALMSTGNHKEWLANTVETLSILILNRPIIADK--LRTADNETLSKGKTSTTLICDSLAEIFLAHINY-TAYQAKVVPLEHRE--EAVMVTIKDK-QFPVVVKVIQSQLALACWGVSKSKKSKKLIDFWFCKVNTSNKYQLTSFTNIESNAPVTDIIPDWLVNAAVHSGIVSVMSGILN 2930
            K +L   P+ +  + C++++    P  L  ++++ + NE+  T               N   +A + Q  +  ++ T   +Y  F                 +L  D  ++ +++F+R++ R ++                         + L    +  L +R   E LT ++    FK+    +M++IVC    LS   P  REA    + +++ K+  AL   +N + QI+  T  W+      +F+I      A +    + ++L L+            E Y   D W +E ++  ++R ++E PI ++ +  +I +G  K++ F  +   +++  +I R S    T I  +  +K + +I+ +F+   Y    +   P       LA  + +WK    L+++++H  ++ GA  W ++PT+K +M+I ITN F    N+  A   E Q+  ++   I++ E+ ++  +    V+ +  +  +  L+L + P G  R+ PS +++ LK +NQ  K+G    +CR PD L +I+  Q Q    S  W+ DLV + SE +   LP+  L EF        ++ N  +++  +++D     LV+ LR+++          D      IV  L +  F RLS +    R  A   L I+           +F  E++  LKS+  +    +      +   LR   + E   +++ +YI      +  +    + + V  ++ LI+ R  +     +   D + +       TL C     +F+   NY    +    P E  E  + +MV   D  Q P+ + +I + + L  +  S   +S  ++D+WF     +    L S    +       ++PDWL    + S +  ++   LN
Sbjct:  388 KMRLKTKPLINHYMSCLKEMIFLQPEILSTVMKLVVQNELSNTRNP-----------NNMGMLATMFQTSADQSAATLAEIYQEF-----------------LLQRDDCLRTLRVFLRELVRMLRF-----------------------DVNLVKFCKTFLSER---EDLTPQIEMFEFKERIFNSMVDIVCLCMFLSAT-PQAREASLSLKTNRDTKNNHALLKLYNQMSQIQLDTVSWMYETVPTLFKI-----PAAEYHQALHKLLLLDSP----------EQYSRCDQWPSEPERGAILRIISETPIHEETLLRIILIGITKDIPFSIANTFDVLLLVIKRVSGMKATNIPAVQANKFD-IIDFLFSMSEYHHPENIRLPAEYEPPKLAIIAFYWKAWLILLMISAHNPSSFGAFCWDHYPTMKMMMEICITNQF----NNSSATKDELQIITMERDHILQFETYLAAQTSPHAVITEETAILITQLMLMD-PMGTPRKVPSMVLDQLKFLNQTYKLGHLFCRCRKPDLLLDII--QRQGTTQSMPWLSDLV-QNSEGDFSHLPVQCLCEF--------LLFNAHIINEENSRDA---ELVNFLRNLI---------FDGNLSHQIVCELLDYIFRRLSSTVKQSRVAALSGLKIIFRHSG------DFENEWL--LKSLQQIPHFYEVKPF--IIPQLRAACQVENCPELIMAYIQFITAHTLNDPVNEMLDHVIDMAQLIVERSTMFQHIIISQEDYDYVPDENRIQTLKC-----LFVMFNNYIIKLREYHEPYEWTEYPDLLMVQFDDGVQLPLHINIIHAFIILLTYSNSNMPESIPILDYWFPPGRPAPVAFLPSMPQEQ-----VQLLPDWLKLKMIRSSVDRLIEAALN 1169          
BLAST of Integrator complex subunit 1 vs. Ensembl Zebrafish
Match: ints1 (integrator complex subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6523])

HSP 1 Score: 139.813 bits (351), Expect = 2.549e-32
Identity = 111/411 (27.01%), Postives = 211/411 (51.34%), Query Frame = 3
Query:  786 DCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIAR-----TLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNF--------DELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYH 1979
            D  FK+ +V  + +++    ML +    V+EA       EKK+ E L+S  N +  I+     WL ++   + S V      + + +VLF              E+Y   D W  E+D+ F +R  +E+P+ +  +  ++ +G  ++L   P++ + +   L+ RA+     ++  + V + + +I+ +   C+Y    H  + N+Q+        LA  + +WK    L+V+A+     +G   W  +PT+K LM++++TNN+        DE     E +++E Q+ + + ++I+  ES ++  S    +    N+S L++ L    P+GP R+PP  +++ +KS+NQ +++G  L + R+PDFL  I++ Q  ++  S  W+ DLV ++SE +LD LP+  L EF+ H
Sbjct:  528 DMEFKERFVIQVTDLLTVSMMLGITA-QVKEAGIAWDKGEKKNLEVLRSFQNQIAAIQRDAVWWLHSVVPTI-SKVGPKDYVHCLHKVLFTEQP----------ETYYKWDNWPPESDRNFFLRLCSEVPLLEDTLMRILVIGLSRDLPLGPADAMELADHLVKRAAGVQSDDLEVLRVERIQ-LIDAVLNLCTY----HHPE-NIQLPAGYQPPNLAISTLYWKAWLLLLVVAAFNPQKIGLAAWDGYPTLKMLMEMVMTNNYSYPPCTVADE-ETKTEMINRELQISQKERQEILAFESHLAAASTKQTIT--ENNSLLLSQLTSLDPKGPPRRPPPLVLDQVKSLNQSLRLGHLLCRSRSPDFLLNIIQRQASSQ--SMPWLADLV-QSSEGSLDVLPVQCLCEFLLH 914          

HSP 2 Score: 81.2629 bits (199), Expect = 1.485e-14
Identity = 122/532 (22.93%), Postives = 227/532 (42.67%), Query Frame = 3
Query: 3966 YSDYFMSDLLHQSNAFCLRQILHSILNRKTITQLNASRVLDFITACLHHPRLQYSVVLPVSNQYIWPQQNSE---IDLSESELIALLNLVVCEAEHLIEQNGPTAKC---VNRSLVK-RSDLIDIC--SSSKSLFQQRNLIINRFIDWK-SPHNEAVDKFGFALYCRLPNLISD-KYQAATNNXXXXXXPMEMEREKEALTVT-DVDRYNLKEIHRIGQRLL--AGLVSPRNDLQDMAIQGCKALVTKHPKLSLQLLPYMCALSDGALDGTDSWNEFRKKRSPVLYSNLLHLLEIMIPVXXXXXXXXXXXRGNMKIILFNFLRVLIRYRDEHKFFIGFVTRLVGFMEKMIPLEKKLVEDIVSXXXXXXXXXXXXXXXXXGDFIIEHATEITALSKIYP---QFRNLIVYVQKNKEICSSLLSASSTGELDDNRASQLPLLKLEL-----LVNFRKKLRETLTGNGI---LMQIKDLDDVSRRDTNIIGLFLDDLRRLINHSMNDVRIAAVQVLARYLNAFPEQANRIIGDFI 5486
            Y  Y ++ L HQSN   L Q + S+LN+    +L+ +  LDF+ AC H PR+              PQ+ +E   + LS  ELI+L++L++ E+E     +G +      V+ SL++ R  L+  C  S   ++ +    +I+    W  S  ++        +Y   P +I   +   AT         +  E   +  T   DV       +HR+   L       S  N + D  +  C+ L   HP L L+ LP + AL  G +    +  E R++     ++++L +LE++ P+   +          ++  L +F++VL  +R   +  I  + + V F++K I        D  S                   F+ +H+  +  LS   P   Q ++L+  +    + C S  S++  G+++++ +  LPL+ +         +  K L++   G  I      + ++D+ S+R+  II  F++DL+RL++      R  A  +  R +   P  A   +  F+
Sbjct: 1651 YRPYLLALLTHQSNWSTLHQCISSLLNKHREQRLDPTSALDFLWACSHIPRIWQG------RDQKTPQKRTEQFVLKLSSEELISLVDLILSESELSCRDSGSSKSALDPVSCSLLQSRLPLLHSCLHSDLDNVKRVSEYLISCVKKWGDSIMSKKCQTLLLQIYLHFPEVIQHIRLPEAT---------LSGEGAADGSTCKLDV------LVHRLITLLADTGDSKSAENRVSDANL-ACRKLAVSHPVLLLRHLPMIAALLHGRIHL--NLQEIRQQNHLGFFTDVLAVLELLQPLVFNSDHQRA-----LQDCLLSFIKVLQNFRRSSRLPI--INKFVQFIQKYI------THDAASAV----------------PFLQKHSDVLQGLSTENPDLVQLKSLLAGLTLPVK-CGSSESSAEDGDVEESSSGSLPLVNISASMSLTAADMTKCLKKISRGEAIEDVFEGLTEVDEKSKRNPEIIQYFVNDLQRLMSSPEEVCRNMAFSLALRCIQNSPSIAAEFLPTFM 2128          
BLAST of Integrator complex subunit 1 vs. Ensembl Zebrafish
Match: ints1 (integrator complex subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6523])

HSP 1 Score: 139.813 bits (351), Expect = 2.549e-32
Identity = 111/411 (27.01%), Postives = 211/411 (51.34%), Query Frame = 3
Query:  786 DCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIAR-----TLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNF--------DELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYH 1979
            D  FK+ +V  + +++    ML +    V+EA       EKK+ E L+S  N +  I+     WL ++   + S V      + + +VLF              E+Y   D W  E+D+ F +R  +E+P+ +  +  ++ +G  ++L   P++ + +   L+ RA+     ++  + V + + +I+ +   C+Y    H  + N+Q+        LA  + +WK    L+V+A+     +G   W  +PT+K LM++++TNN+        DE     E +++E Q+ + + ++I+  ES ++  S    +    N+S L++ L    P+GP R+PP  +++ +KS+NQ +++G  L + R+PDFL  I++ Q  ++  S  W+ DLV ++SE +LD LP+  L EF+ H
Sbjct:  528 DMEFKERFVIQVTDLLTVSMMLGITA-QVKEAGIAWDKGEKKNLEVLRSFQNQIAAIQRDAVWWLHSVVPTI-SKVGPKDYVHCLHKVLFTEQP----------ETYYKWDNWPPESDRNFFLRLCSEVPLLEDTLMRILVIGLSRDLPLGPADAMELADHLVKRAAGVQSDDLEVLRVERIQ-LIDAVLNLCTY----HHPE-NIQLPAGYQPPNLAISTLYWKAWLLLLVVAAFNPQKIGLAAWDGYPTLKMLMEMVMTNNYSYPPCTVADE-ETKTEMINRELQISQKERQEILAFESHLAAASTKQTIT--ENNSLLLSQLTSLDPKGPPRRPPPLVLDQVKSLNQSLRLGHLLCRSRSPDFLLNIIQRQASSQ--SMPWLADLV-QSSEGSLDVLPVQCLCEFLLH 914          

HSP 2 Score: 81.2629 bits (199), Expect = 1.485e-14
Identity = 122/532 (22.93%), Postives = 227/532 (42.67%), Query Frame = 3
Query: 3966 YSDYFMSDLLHQSNAFCLRQILHSILNRKTITQLNASRVLDFITACLHHPRLQYSVVLPVSNQYIWPQQNSE---IDLSESELIALLNLVVCEAEHLIEQNGPTAKC---VNRSLVK-RSDLIDIC--SSSKSLFQQRNLIINRFIDWK-SPHNEAVDKFGFALYCRLPNLISD-KYQAATNNXXXXXXPMEMEREKEALTVT-DVDRYNLKEIHRIGQRLL--AGLVSPRNDLQDMAIQGCKALVTKHPKLSLQLLPYMCALSDGALDGTDSWNEFRKKRSPVLYSNLLHLLEIMIPVXXXXXXXXXXXRGNMKIILFNFLRVLIRYRDEHKFFIGFVTRLVGFMEKMIPLEKKLVEDIVSXXXXXXXXXXXXXXXXXGDFIIEHATEITALSKIYP---QFRNLIVYVQKNKEICSSLLSASSTGELDDNRASQLPLLKLEL-----LVNFRKKLRETLTGNGI---LMQIKDLDDVSRRDTNIIGLFLDDLRRLINHSMNDVRIAAVQVLARYLNAFPEQANRIIGDFI 5486
            Y  Y ++ L HQSN   L Q + S+LN+    +L+ +  LDF+ AC H PR+              PQ+ +E   + LS  ELI+L++L++ E+E     +G +      V+ SL++ R  L+  C  S   ++ +    +I+    W  S  ++        +Y   P +I   +   AT         +  E   +  T   DV       +HR+   L       S  N + D  +  C+ L   HP L L+ LP + AL  G +    +  E R++     ++++L +LE++ P+   +          ++  L +F++VL  +R   +  I  + + V F++K I        D  S                   F+ +H+  +  LS   P   Q ++L+  +    + C S  S++  G+++++ +  LPL+ +         +  K L++   G  I      + ++D+ S+R+  II  F++DL+RL++      R  A  +  R +   P  A   +  F+
Sbjct: 1651 YRPYLLALLTHQSNWSTLHQCISSLLNKHREQRLDPTSALDFLWACSHIPRIWQG------RDQKTPQKRTEQFVLKLSSEELISLVDLILSESELSCRDSGSSKSALDPVSCSLLQSRLPLLHSCLHSDLDNVKRVSEYLISCVKKWGDSIMSKKCQTLLLQIYLHFPEVIQHIRLPEAT---------LSGEGAADGSTCKLDV------LVHRLITLLADTGDSKSAENRVSDANL-ACRKLAVSHPVLLLRHLPMIAALLHGRIHL--NLQEIRQQNHLGFFTDVLAVLELLQPLVFNSDHQRA-----LQDCLLSFIKVLQNFRRSSRLPI--INKFVQFIQKYI------THDAASAV----------------PFLQKHSDVLQGLSTENPDLVQLKSLLAGLTLPVK-CGSSESSAEDGDVEESSSGSLPLVNISASMSLTAADMTKCLKKISRGEAIEDVFEGLTEVDEKSKRNPEIIQYFVNDLQRLMSSPEEVCRNMAFSLALRCIQNSPSIAAEFLPTFM 2128          
BLAST of Integrator complex subunit 1 vs. Ensembl Xenopus
Match: exosc5 (exosome component 5 [Source:Xenbase;Acc:XB-GENE-6257997])

HSP 1 Score: 145.206 bits (365), Expect = 6.946e-34
Identity = 111/410 (27.07%), Postives = 211/410 (51.46%), Query Frame = 3
Query:  774 SRMTDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIARTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFD-------ELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHD 1982
            ++ TD  FK+ +V ++ +++    ML +    V+EA       EKK+ E L+S  N +  I+     WL  +   +   +S     + + +VLF              E+Y   D W  E+D+ F +R  +E+P+ +  +  ++ +G  ++L   P++ + +   L+ RA+A    ++  + + + + +++ +   C+Y    +   P       LA  + +WK    L+V+A+     +G   W  +PT+K LM++++TNN+        E     E +++E Q+ + + ++I+  ES ++  S    +    ++S L++ L    PQGP R+PP H +E +KS+NQ +++G  L + RNPDFL  I++ Q  ++  S  W+ DLV ++SE +LD LP+  L EF+ HD
Sbjct:  551 AQYTDMEFKERFVIHITDLLAVSMMLGITA-QVKEAGVAWDKGEKKNLEVLRSFQNQIAAIQRDAVWWLHTVVPTI-CKLSPKDYVHCLHKVLFTEQP----------ETYYKWDNWPPESDRNFFLRLCSEVPLLEDTLMRILVIGLSRDLPLGPADAMELADHLVKRAAAVQADDLEVLRIERIQ-LLDAVLNLCTYHHPENIQLPPGYQPPNLAISTLYWKAWPLLLVVAAFNPENLGLAAWEEYPTLKMLMEMVMTNNYSFPPCTVTEEETRTEIINRELQISQREKQEILAFESHLAAASTKQTIT--ESNSLLLSQLTSLDPQGPPRRPPPHAIEQVKSLNQSLRLGHLLCRSRNPDFLLNIIQRQASSQ--SMPWLADLV-QSSEGSLDVLPVQCLCEFLLHD 942          
BLAST of Integrator complex subunit 1 vs. Ensembl Xenopus
Match: exosc5 (exosome component 5 [Source:Xenbase;Acc:XB-GENE-6257997])

HSP 1 Score: 145.206 bits (365), Expect = 7.586e-34
Identity = 111/410 (27.07%), Postives = 211/410 (51.46%), Query Frame = 3
Query:  774 SRMTDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIARTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFD-------ELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHD 1982
            ++ TD  FK+ +V ++ +++    ML +    V+EA       EKK+ E L+S  N +  I+     WL  +   +   +S     + + +VLF              E+Y   D W  E+D+ F +R  +E+P+ +  +  ++ +G  ++L   P++ + +   L+ RA+A    ++  + + + + +++ +   C+Y    +   P       LA  + +WK    L+V+A+     +G   W  +PT+K LM++++TNN+        E     E +++E Q+ + + ++I+  ES ++  S    +    ++S L++ L    PQGP R+PP H +E +KS+NQ +++G  L + RNPDFL  I++ Q  ++  S  W+ DLV ++SE +LD LP+  L EF+ HD
Sbjct:  528 AQYTDMEFKERFVIHITDLLAVSMMLGIT-AQVKEAGVAWDKGEKKNLEVLRSFQNQIAAIQRDAVWWLHTVVPTI-CKLSPKDYVHCLHKVLFTEQP----------ETYYKWDNWPPESDRNFFLRLCSEVPLLEDTLMRILVIGLSRDLPLGPADAMELADHLVKRAAAVQADDLEVLRIERIQ-LLDAVLNLCTYHHPENIQLPPGYQPPNLAISTLYWKAWPLLLVVAAFNPENLGLAAWEEYPTLKMLMEMVMTNNYSFPPCTVTEEETRTEIINRELQISQREKQEILAFESHLAAASTKQTIT--ESNSLLLSQLTSLDPQGPPRRPPPHAIEQVKSLNQSLRLGHLLCRSRNPDFLLNIIQRQASSQ--SMPWLADLV-QSSEGSLDVLPVQCLCEFLLHD 919          
BLAST of Integrator complex subunit 1 vs. Ensembl Xenopus
Match: exosc5 (exosome component 5 [Source:Xenbase;Acc:XB-GENE-6257997])

HSP 1 Score: 145.206 bits (365), Expect = 7.615e-34
Identity = 111/410 (27.07%), Postives = 211/410 (51.46%), Query Frame = 3
Query:  774 SRMTDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIARTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFD-------ELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHD 1982
            ++ TD  FK+ +V ++ +++    ML +    V+EA       EKK+ E L+S  N +  I+     WL  +   +   +S     + + +VLF              E+Y   D W  E+D+ F +R  +E+P+ +  +  ++ +G  ++L   P++ + +   L+ RA+A    ++  + + + + +++ +   C+Y    +   P       LA  + +WK    L+V+A+     +G   W  +PT+K LM++++TNN+        E     E +++E Q+ + + ++I+  ES ++  S    +    ++S L++ L    PQGP R+PP H +E +KS+NQ +++G  L + RNPDFL  I++ Q  ++  S  W+ DLV ++SE +LD LP+  L EF+ HD
Sbjct:  526 AQYTDMEFKERFVIHITDLLAVSMMLGITA-QVKEAGVAWDKGEKKNLEVLRSFQNQIAAIQRDAVWWLHTVVPTI-CKLSPKDYVHCLHKVLFTEQP----------ETYYKWDNWPPESDRNFFLRLCSEVPLLEDTLMRILVIGLSRDLPLGPADAMELADHLVKRAAAVQADDLEVLRIERIQ-LLDAVLNLCTYHHPENIQLPPGYQPPNLAISTLYWKAWPLLLVVAAFNPENLGLAAWEEYPTLKMLMEMVMTNNYSFPPCTVTEEETRTEIINRELQISQREKQEILAFESHLAAASTKQTIT--ESNSLLLSQLTSLDPQGPPRRPPPHAIEQVKSLNQSLRLGHLLCRSRNPDFLLNIIQRQASSQ--SMPWLADLV-QSSEGSLDVLPVQCLCEFLLHD 917          
BLAST of Integrator complex subunit 1 vs. Ensembl Xenopus
Match: exosc5 (exosome component 5 [Source:Xenbase;Acc:XB-GENE-6257997])

HSP 1 Score: 141.354 bits (355), Expect = 1.016e-32
Identity = 114/410 (27.80%), Postives = 206/410 (50.24%), Query Frame = 3
Query:  774 SRMTDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIARTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFD-------ELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHD 1982
            ++ TD  FK+ +V ++ +++    ML +    V+EA       EKK+ E L+S  N +  I+     WL  +   +   +S     + + +VLF              E+Y   D W  E+D+ F +R  +E+P+ +  +  ++ +G  ++L   P++ + +   L+ RA+A     +   N S         F C  +  +     PNL I+      + +WK    L+V+A+     +G   W  +PT+K LM++++TNN+        E     E +++E Q+ + + ++I+  ES ++  S    +    ++S L++ L    PQGP R+PP H +E +KS+NQ +++G  L + RNPDFL  I++ Q  ++  S  W+ DLV ++SE +LD LP+  L EF+ HD
Sbjct:  515 AQYTDMEFKERFVIHITDLLAVSMMLGIT-AQVKEAGVAWDKGEKKNLEVLRSFQNQIAAIQRDAVWWLHTVVPTI-CKLSPKDYVHCLHKVLFTEQP----------ETYYKWDNWPPESDRNFFLRLCSEVPLLEDTLMRILVIGLSRDLPLGPADAMELADHLVKRAAAVQLAFLALKNASS--------FQCVLF--LFRYQPPNLAIS------TLYWKAWPLLLVVAAFNPENLGLAAWEEYPTLKMLMEMVMTNNYSFPPCTVTEEETRTEIINRELQISQREKQEILAFESHLAAASTKQTIT--ESNSLLLSQLTSLDPQGPPRRPPPHAIEQVKSLNQSLRLGHLLCRSRNPDFLLNIIQRQASSQ--SMPWLADLV-QSSEGSLDVLPVQCLCEFLLHD 891          
BLAST of Integrator complex subunit 1 vs. Ensembl Xenopus
Match: exosc5 (exosome component 5 [Source:Xenbase;Acc:XB-GENE-6257997])

HSP 1 Score: 120.168 bits (300), Expect = 3.181e-26
Identity = 103/410 (25.12%), Postives = 197/410 (48.05%), Query Frame = 3
Query:  774 SRMTDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIARTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFD-------ELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHD 1982
            ++ TD  FK+ +V ++ +++    ML +    V+EA       EKK+ E L+S  N +  I+     WL  +   +      D                     Y+                  F +R  +E+P+ +  +  ++ +G  ++L   P++ + +   L+ RA+A    ++  + + + + +++ +   C+Y    +   P       LA  + +WK    L+V+A+     +G   W  +PT+K LM++++TNN+        E     E +++E Q+ + + ++I+  ES ++  S    +    ++S L++ L    PQGP R+PP H +E +KS+NQ +++G  L + RNPDFL  I++ Q  ++  S  W+ DLV ++SE +LD LP+  L EF+ HD
Sbjct:  526 AQYTDMEFKERFVIHITDLLAVSMMLGITA-QVKEAGVAWDKGEKKNLEVLRSFQNQIAAIQRDAVWWLHTVVPTICKLSPKD---------------------YV----------------HCFFLRLCSEVPLLEDTLMRILVIGLSRDLPLGPADAMELADHLVKRAAAVQADDLEVLRIERIQ-LLDAVLNLCTYHHPENIQLPPGYQPPNLAISTLYWKAWPLLLVVAAFNPENLGLAAWEEYPTLKMLMEMVMTNNYSFPPCTVTEEETRTEIINRELQISQREKQEILAFESHLAAASTKQTIT--ESNSLLLSQLTSLDPQGPPRRPPPHAIEQVKSLNQSLRLGHLLCRSRNPDFLLNIIQRQASSQ--SMPWLADLV-QSSEGSLDVLPVQCLCEFLLHD 891          
BLAST of Integrator complex subunit 1 vs. Ensembl Mouse
Match: Ints1 (integrator complex subunit 1 [Source:MGI Symbol;Acc:MGI:1915760])

HSP 1 Score: 145.206 bits (365), Expect = 6.343e-34
Identity = 112/408 (27.45%), Postives = 215/408 (52.70%), Query Frame = 3
Query:  795 FKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIART-----LAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFD----ELSNDK---EAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHD 1982
            FK+ +V ++ +++    ML +    V+EA       EK++ E L++  N +  I+     WL  +   V S ++     + + +VLF              E+Y   D W  E+D+ F +R  +E+PI +  +  ++ +G  + L   P++ + +   L+ RA+A    ++  + V + + +I+ +   C+Y    H  + N+Q+        LA  + +WK    L+V+A+     +G   W  +PT+K LM++++TNN+      L++++   E +++E Q+ + + ++I+  E  ++  S    +    +SS L++ L    PQGP R+PP HI++ +K++NQ +++G  L + RNPDFL  I++ Q  ++  S  W+ DLV ++SE +LD LP+  L EF+ HD
Sbjct:  560 FKERFVVHITDVLAVSMMLGIT-AQVKEAGVAWDKGEKRNLEVLRTFQNQIAAIQRDAVWWLHTVVPSV-SKLAPKDYVHCLHKVLFTEQP----------ETYYKWDNWPPESDRNFFLRLCSEVPILEDTLMRVLVIGLSRELPLGPADAMELADHLVKRAAAVQADDVEVLKVERIQ-LIDAVLNLCTY----HHPE-NIQLPPGYQPPNLAISTLYWKAWPLLLVVAAFNPENIGLAAWEEYPTLKMLMEMVMTNNYSYPPCTLTDEETRTEMINRELQISQREKQEILAFEGHLAAASTKQTIT--ESSSLLLSQLTSLDPQGPPRRPPPHILDQVKALNQSLRLGHLLCRSRNPDFLLHIIQRQASSQ--SMPWLADLV-QSSEGSLDVLPVQCLCEFLLHD 944          
BLAST of Integrator complex subunit 1 vs. Ensembl Mouse
Match: Ints1 (integrator complex subunit 1 [Source:MGI Symbol;Acc:MGI:1915760])

HSP 1 Score: 145.206 bits (365), Expect = 6.346e-34
Identity = 112/408 (27.45%), Postives = 215/408 (52.70%), Query Frame = 3
Query:  795 FKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIART-----LAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFD----ELSNDK---EAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHD 1982
            FK+ +V ++ +++    ML +    V+EA       EK++ E L++  N +  I+     WL  +   V S ++     + + +VLF              E+Y   D W  E+D+ F +R  +E+PI +  +  ++ +G  + L   P++ + +   L+ RA+A    ++  + V + + +I+ +   C+Y    H  + N+Q+        LA  + +WK    L+V+A+     +G   W  +PT+K LM++++TNN+      L++++   E +++E Q+ + + ++I+  E  ++  S    +    +SS L++ L    PQGP R+PP HI++ +K++NQ +++G  L + RNPDFL  I++ Q  ++  S  W+ DLV ++SE +LD LP+  L EF+ HD
Sbjct:  562 FKERFVVHITDVLAVSMMLGIT-AQVKEAGVAWDKGEKRNLEVLRTFQNQIAAIQRDAVWWLHTVVPSV-SKLAPKDYVHCLHKVLFTEQP----------ETYYKWDNWPPESDRNFFLRLCSEVPILEDTLMRVLVIGLSRELPLGPADAMELADHLVKRAAAVQADDVEVLKVERIQ-LIDAVLNLCTY----HHPE-NIQLPPGYQPPNLAISTLYWKAWPLLLVVAAFNPENIGLAAWEEYPTLKMLMEMVMTNNYSYPPCTLTDEETRTEMINRELQISQREKQEILAFEGHLAAASTKQTIT--ESSSLLLSQLTSLDPQGPPRRPPPHILDQVKALNQSLRLGHLLCRSRNPDFLLHIIQRQASSQ--SMPWLADLV-QSSEGSLDVLPVQCLCEFLLHD 946          
BLAST of Integrator complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q9W1C5|INT1_DROME (Integrator complex subunit 1 OS=Drosophila melanogaster OX=7227 GN=IntS1 PE=1 SV=2)

HSP 1 Score: 159.844 bits (403), Expect = 1.495e-37
Identity = 195/901 (21.64%), Postives = 382/901 (42.40%), Query Frame = 3
Query:  267 KYKLSKPPVQSILLECVRKITETHPCNLRNLLEIYINNEIYGTPTAAAAASNITGTVGNPCPIAYVPQNKSGPASVTFPAVYFRFPSESIKILGELLHEQISVLHHD--IKPVKLFIRDICRWIKLAYINSNGVYTPFASSSSNGALPDSLELHDLAQNLLVDRSNSEALTSRMTDCTFKQLYVENMINIVCELQMLSVVRPTVREA-FKERVDQEKKDYEALKSHFNTLRQIRYFTCKWL----KNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIARTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFDELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHDIYEKIINNLPVVSRNDTKDGSLKRLVHKLRSILCVTETDKRAMDKETLKNIVGALSNSFFNRLSDSSAFIRKVARECLYILLLPISHPIKLMEFSLEFVDTLKSIMNLNILQDNSLICSVAEALRETLKFETDIDVLHSYIDLFALMSTGNHKEWLANTVETLSILILNRPIIADK--LRTADNETLSKGKTSTTLICDSLAEIFLAHINY-TAYQAKVVPLEHRE--EAVMVTIKDK-QFPVVVKVIQSQLALACWGVSKSKKSKKLIDFWFCKVNTSNKYQLTSFTNIESNAPVTDIIPDWLVNAAVHSGIVSVMSGILN 2930
            K +L   P+ +  + C++++    P  L  ++++ + NE+  T               N   +A + Q  +  ++ T   +Y  F                 +L  D  ++ +++F+R++ R ++                         + L    +  L +R   E LT ++    FK+    +M++IVC    LS   P  REA    + +++ K+  AL   +N + QI+  T  W+      +F+I      A +    + ++L L+            E Y   D W +E ++  ++R ++E PI ++ +  +I +G  K++ F  +   +++  +I R S    T I  +  +K + +I+ +F+   Y    +   P       LA  + +WK    L+++++H  ++ GA  W ++PT+K +M+I ITN F    N+  A   E Q+  ++   I++ E+ ++  +    V+ +  +  +  L+L + P G  R+ PS +++ LK +NQ  K+G    +CR PD L +I+  Q Q    S  W+ DLV + SE +   LP+  L EF        ++ N  +++  +++D     LV+ LR+++          D      IV  L +  F RLS +    R  A   L I+           +F  E++  LKS+  +    +      +   LR   + E   +++ +YI      +  +    + + V  ++ LI+ R  +     +   D + +       TL C     +F+   NY    +    P E  E  + +MV   D  Q P+ + +I + + L  +  S   +S  ++D+WF     +    L S    +       ++PDWL    + S +  ++   LN
Sbjct:  388 KMRLKTKPLINHYMSCLKEMIFLQPEILSTVMKLVVQNELSNTRNP-----------NNMGMLATMFQTSADQSAATLAEIYQEF-----------------LLQRDDCLRTLRVFLRELVRMLRF-----------------------DVNLVKFCKTFLSER---EDLTPQIEMFEFKERIFNSMVDIVCLCMFLSAT-PQAREASLSLKTNRDTKNNHALLKLYNQMSQIQLDTVSWMYETVPTLFKI-----PAAEYHQALHKLLLLDSP----------EQYSRCDQWPSEPERGAILRIISETPIHEETLLRIILIGITKDIPFSIANTFDVLLLVIKRVSGMKATNIPAVQANKFD-IIDFLFSMSEYHHPENIRLPAEYEPPKLAIIAFYWKAWLILLMISAHNPSSFGAFCWDHYPTMKMMMEICITNQF----NNSSATKDELQIITMERDHILQFETYLAAQTSPHAVITEETAILITQLMLMD-PMGTPRKVPSMVLDQLKFLNQTYKLGHLFCRCRKPDLLLDII--QRQGTTQSMPWLSDLV-QNSEGDFSHLPVQCLCEF--------LLFNAHIINEENSRDA---ELVNFLRNLI---------FDGNLSHQIVCELLDYIFRRLSSTVKQSRVAALSGLKIIFRHSG------DFENEWL--LKSLQQIPHFYEVKPF--IIPQLRAACQVENCPELIMAYIQFITAHTLNDPVNEMLDHVIDMAQLIVERSTMFQHIIISQEDYDYVPDENRIQTLKC-----LFVMFNNYIIKLREYHEPYEWTEYPDLLMVQFDDGVQLPLHINIIHAFIILLTYSNSNMPESIPILDYWFPPGRPAPVAFLPSMPQEQ-----VQLLPDWLKLKMIRSSVDRLIEAALN 1169          
BLAST of Integrator complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q8N201|INT1_HUMAN (Integrator complex subunit 1 OS=Homo sapiens OX=9606 GN=INTS1 PE=1 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 1.836e-33
Identity = 113/408 (27.70%), Postives = 214/408 (52.45%), Query Frame = 3
Query:  795 FKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIART-----LAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFD----ELSNDK---EAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHD 1982
            FK+ +V ++ +++    ML +    V+EA       EK++ E L+S  N +  I+     WL  +   + S ++     + + +VLF              E+Y   D W  E+D+ F +R  +E+PI +  +  ++ +G  + L   P++ + +   L+ RA+A    ++  + V + + +I+ +   C+Y    H  + N+Q+        LA  + +WK    L+V+A+     +G   W  +PT+K LM++++TNN+      L++++   E +++E Q  + + ++I+  E  ++  S    +    +SS L++ L    PQGP R+PP HI++ +KS+NQ +++G  L + RNPDFL  I++ Q  ++  S  W+ DLV ++SE +LD LP+  L EF+ HD
Sbjct:  533 FKERFVVHITDVLAVSMMLGITA-QVKEAGIAWDKGEKRNLEVLRSFQNQIAAIQRDAVWWLHTVVPSI-SKLAPKDYVHCLHKVLFTEQP----------ETYYKWDNWPPESDRNFFLRLCSEVPILEDTLMRILVIGLSRELPLGPADAMELADHLVKRAAAVQADDVEVLKVGRTQ-LIDAVLNLCTY----HHPE-NIQLPPGYQPPNLAISTLYWKAWPLLLVVAAFNPENIGLAAWEEYPTLKMLMEMVMTNNYSYPPCTLTDEETRTEMLNRELQTAQREKQEILAFEGHLAAASTKQTIT--ESSSLLLSQLTSLDPQGPPRRPPPHILDQVKSLNQSLRLGHLLCRSRNPDFLLHIIQRQASSQ--SMPWLADLV-QSSEGSLDVLPVQCLCEFLLHD 917          
BLAST of Integrator complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q6P4S8|INT1_MOUSE (Integrator complex subunit 1 OS=Mus musculus OX=10090 GN=Ints1 PE=1 SV=2)

HSP 1 Score: 145.206 bits (365), Expect = 4.234e-33
Identity = 112/408 (27.45%), Postives = 215/408 (52.70%), Query Frame = 3
Query:  795 FKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIART-----LAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFD----ELSNDK---EAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHD 1982
            FK+ +V ++ +++    ML +    V+EA       EK++ E L++  N +  I+     WL  +   V S ++     + + +VLF              E+Y   D W  E+D+ F +R  +E+PI +  +  ++ +G  + L   P++ + +   L+ RA+A    ++  + V + + +I+ +   C+Y    H  + N+Q+        LA  + +WK    L+V+A+     +G   W  +PT+K LM++++TNN+      L++++   E +++E Q+ + + ++I+  E  ++  S    +    +SS L++ L    PQGP R+PP HI++ +K++NQ +++G  L + RNPDFL  I++ Q  ++  S  W+ DLV ++SE +LD LP+  L EF+ HD
Sbjct:  535 FKERFVVHITDVLAVSMMLGITA-QVKEAGVAWDKGEKRNLEVLRTFQNQIAAIQRDAVWWLHTVVPSV-SKLAPKDYVHCLHKVLFTEQP----------ETYYKWDNWPPESDRNFFLRLCSEVPILEDTLMRVLVIGLSRELPLGPADAMELADHLVKRAAAVQADDVEVLKVERIQ-LIDAVLNLCTY----HHPE-NIQLPPGYQPPNLAISTLYWKAWPLLLVVAAFNPENIGLAAWEEYPTLKMLMEMVMTNNYSYPPCTLTDEETRTEMINRELQISQREKQEILAFEGHLAAASTKQTIT--ESSSLLLSQLTSLDPQGPPRRPPPHILDQVKALNQSLRLGHLLCRSRNPDFLLHIIQRQASSQ--SMPWLADLV-QSSEGSLDVLPVQCLCEFLLHD 919          
BLAST of Integrator complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q54NC8|INT1_DICDI (Integrator complex subunit 1 homolog OS=Dictyostelium discoideum OX=44689 GN=ints1 PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.537e-14
Identity = 78/289 (26.99%), Postives = 142/289 (49.13%), Query Frame = 3
Query: 1164 TEIPISDKLVQTLINLGFEKNLCFRPSE--IVNMISELIVRASASACTE---IIPMN-VSKCEAMINNMFACCSYDVVLHESDPNLQIARTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFD-------ELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHDIYE 1991
            TEIPI + ++  L+ +GFE      PSE  IV  + E +++ + S   +   ++P+  V+  E+++       S   + + S+P L      AY S FW+      ++     + +G+  W+N PT++ L+++IIT ++         ++N+        Q   I+ KK++   S+I + +  D +++D  S K  N        G IRQPP  I+E L+ ++    +G  L  CR+PDFL +I+  QD  +  S  W+  ++    +  LD LP + L+E +    +E
Sbjct:  686 TEIPIQENILDILLTIGFE-----YPSEKKIVLELCEALLKRAISIVHKFNVLVPLTKVTFAESIL-------SLSRIENTSEPQL------AYTSLFWQSTILACLLICLSPSIIGSYYWNNCPTIRILIEMIITRSWKFPPYLPKAVANNPSYFQLIEQNQRIEEKKLL---SRIPQLTSIDFMILD--SIKGTN--------GVIRQPPEEIIEKLQKLDNDFHLGFILCNCRSPDFLLDIMSNQDSKQ--SMMWLNPIIHNDPK-TLDILPPICLSEILLSTQFE 940          
BLAST of Integrator complex subunit 1 vs. TrEMBL
Match: A0A4E0QZC9 (DUF3677 domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_008746 PE=4 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 5.260e-73
Identity = 259/1037 (24.98%), Postives = 479/1037 (46.19%), Query Frame = 3
Query:  153 KLQSSTLNMLTIMANSCAQNVMHNTHDVNFCAYFMLKFKYKLSKPPVQSILLECVRKITETHPCNLRNLLEI------------------------YINNEIYGTPTAAAAASNITGTVGNPCPIAYVPQNK---------------------SGPASV--TFPAVYFRFPSESIKILGELLHEQ----------------------ISVLHHDIKPVKLFIRDICRWIKLAYINSNGVYTPFASSSSNGALPDSLEL--------HDLAQNLLVDR-------------------SNSEALTSR----MTDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIF-RIVESHVSADQMTN-------------------YIKQVLFLN----VTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNL-CFRPSEIVNMISELIVRASASAC-TEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIART-LAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFDELSNDKE-----AMDKERQL-CEIDSKKIIELESKI----SENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHDIYEKI----INNLPVVSR-NDTKDGSLKRLVHKLRSILCVTETDKRA-----MDKETLK-----------------NIVGALSNSFFNRLSDSSAFIRKVARECLYILLLP-ISHPIKLMEFSLEFVDTLKSIMNLNILQDNSLICSVAEALRE-------TLKFETDIDVL-HSYIDLFALMSTGNHKEWLANTVETLSILILNRPIIADKL-----RTADNETLSKGKTS-TTLICDSLAEIFLAHINYTAYQAKVVPLEHREEAVMVTIKDKQFPVVVKVIQSQLAL 2726
            K+Q   + ++ I+A++C      + HD++     + + +YKL KP +Q+  LEC+  + + +P NL  L+ +                        YI+  +        + S  T   G         Q +                      G ASV    P ++ RF ++ I+I+G LLHE+                      +  L   + PV  F+R++ R  +   +  +G+     SSSS+  + +  +L         +LA  LL DR                   S++E+  S     +      Q Y+  +I +VC LQMLS  RP +  A   R  +     +A+K+H   LRQIR    +W K I   +V + + +    N                    I++   L+    + R N   Y +   Y + +IW N+ +   L+R +T+  + +KL   L+ LG E +   F P + ++M+ ELI RA+  A  + + P+NV+K + +I+ +FA C+Y   + E D  L    T LAY S++W+V    V++A+HC+ T G  LW+++PT++ L+++++T++F+ +S D +      +++  QL  +++++ I+ LES +      N    +  V   +SKL+  L+ N P+GPIR PP+  + SL++I Q + +G RL + R+PDFL E++  Q  +  + + W++ LV ++S  + + LP+  L E++  D   ++    ++ LP+V     T +G  +R      S  C+T + K +     M+K +L+                     AL++SFF RL++   +IR+  RECLY L  P  S  I+L +  L++++ L +++ L +L+      + AEA +        +L  ETD+++L  S + L  +  + +   W    + +L+  I +RP I   L        D +  +      + L  ++L+E+ + ++ Y    A  +P++ R+   +    +++ P+ +++IQ+QL L
Sbjct:  467 KIQMYAIGLVAILASNCRLG-GRSPHDLDVMISVIFRIRYKLLKPNIQAAFLECLAHMVKANPLNLYCLIHLCAMSESRPVVTAVPTSDMKTTSGQYISQMVIKIAETVQSMSTATSADGTEDRTGKTNQQQLQLNTATIAAVAAGASNIVATRGAASVYTILPFLFQRFGAQWIRIMGNLLHERLLLSTTSTTFGAMSSALTSTQVVDELTATMVPVYAFLRELARNSR-PNLTDSGLLGMNQSSSSSVPMANQPQLLQQTYLPCAELAGALLQDRNYRINTTATAAANAIIRALSSNESHASTDQPIIVGVGRIQFYLNGLIGLVCALQMLSASRPHLVGASASR--RTTTHVDAMKAHQTALRQIRLAVVRWAKTILPSLVNAAMQSTSSPNVTQTRTQLLSCVDALKPSLLIRRAFMLDSNASLGRTNSIVYELPAFYPVKEIWANDQEHNLLIRLVTDTVLPEKLAHQLLILGLEPSRQLFNPLDSLDMVCELIWRAALLARDSGLEPLNVTKPQQLIDLLFASCTY---VGEQDQQLPSDVTELAYASAYWRVSATTVILAAHCLQTCGLHLWTHYPTIRRLIEMVMTDDFETVSTDTKSNLDTGVEEAAQLNSQLETQLILRLESYLLNPDPNNPNSPVATVTPETSKLLGRLVRNNPRGPIRLPPAEQLTSLRAIAQELGLGRRLWRSRDPDFLLELLHSQAGHP-AVQPWLVRLV-ESSGADFELLPIECLCEYLLRDTLTRMRQSCVHVLPLVKTIESTNNGRRQRTSST--SSDCLTTSTKESKTESYMNKSSLRTHLVAKLRESLRTFGNCTTADALAHSFFARLNNQHTWIRQAVRECLYTLTEPHTSAEIRLQDSVLDWLNVLHTLLQLPVLRAEPRSTAPAEAAQNLLSSLLDSLLVETDLNILTGSLLFLSHVTRSPSFVSWRP-LITSLAQFIQSRPKILSALLHRPIAVPDEQHWTDSNLDWSYLALEALSEMHVRYVEYNCTVAGAIPVDERKSVFVTWPTERECPLELELIQAQLLL 1491          
BLAST of Integrator complex subunit 1 vs. TrEMBL
Match: A0A183AME3 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS8128 PE=4 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 1.770e-65
Identity = 240/996 (24.10%), Postives = 456/996 (45.78%), Query Frame = 3
Query:  222 NTHDVNFCAYFMLKFKYKLSKPPVQSILLECVRKITETHPCNLRNLLEIYI-----------NNEIYGTP------TAAAAASNITGTVG-----------------NPCPIAYVPQNKS------GPASV--TFPAVYFRFPSESIKILGELLHEQ----------------------ISVLHHDIKPVKLFIRDICRWIKLAYINS-----NGVYTPFASSSSNGALPDSLELHDLA--------QNLLVDRSNSEALTSRMTDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIF------RIVESHVSADQMTN-------------YIKQVLFLN----VTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNL-CFRPSEIVNMISELIVRASASAC-TEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIART-LAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNF----DELSNDKEAMDK-ERQLCEIDSKKIIELESKIS---ENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHDIYEKI----INNLPVVSRNDTKDGSLKRLVHKLR-----SILCVTETDKRAMD-----------------KETLK-----NIVGALSNSFFNRLSDSSAFIRKVARECLYILLLP-ISHPIKLMEFSLEFVDTLKSIMNLNILQDNSLICSVAEALRETLK-----------FETDIDVL-HSYIDLFALMSTGNHKEWLANTVETLSILILNRPIIADKL------RTADNETLSKGKTSTTLICDSLAEIFLAHINYTAYQAKVVPLEHREEAVMVTIKDKQFPVVVKVIQSQLAL 2726
            ++HD++     + + +YKL KP +Q+  LEC+  + + +P NL  L+ +             ++E    P      T    A  +  T G                 N   +  V  + S      G ASV    P ++ RF ++ I+I+G LLHE+                      +  L   + PV  F+R++ R  +    +S     N   + F    + G    +  ++  A        + L  D  ++    +        Q Y+  +I +VC LQMLS  RP +  A   R  +     +ALK+H   LRQIR    +W K I        +  +  S    TN              I++   L+    + R N   Y +   Y + +IW N+ +    VR + +  + +KL   ++ +G E N   F P + ++M+ EL+ RA+  A  + + P+NV+K + +I+ ++A C+Y  V  + +  L    T LAY S++W+V    V++ASHC+ T G+ LW+++PT++ LM++++T++F    D  S  +  M++ ER   +++ + I+ LES  +   E++    V+V   +SKL+  L+ N P+GP R PP+  + +L+++ Q + +G RL + R+PDFL E++R Q  +  S + W++ LV ++S    + LP+  L E++  D   K+    ++ LP+ +   T +      VH        S + ++ T++ +                   +E+L+         AL++SFF RL++   +IRK  R+CLY+L    ++  ++  +   ++++ L ++  L +L+      +  + + E+ +            ETD+D+L  S + L  +  + +   W    + +L+  I +RP I   L        A++  ++     + L  ++LAE+ + ++ Y    A  +P++ R+   +    +++ P+ + +IQ+QL L
Sbjct:   20 SSHDLDVMISVVFRIRYKLLKPNIQAAFLECLAHMVKANPLNLYCLVHLCAMPESKPPLTGDSSETKMAPGQFLSQTVMKIAETVRSTSGDVSEERTGKTIQQQLQLNMATMTAVATSASNAVATRGSASVYTILPFLFQRFSAQWIRIMGNLLHERLLLAVTATKFGALSNALTSTQVVDELFGAMSPVYTFLRELSRNCRPNLTDSGPLGVNQTASLFTVCRTGGXQDRNYRVNTTAIAAANAIIRALSSDVEHTSTEQAPAVGVGRIQFYLNGLIGLVCALQMLSASRPHLVGASASR--RTAAHLDALKAHQTALRQIRLAVIRWAKTILPSLVNASMQATGSSGATQTNQLLSCLDAVKPSLLIRRAFMLDSNVPLKRPNAVVYELPPFYPVKEIWANDQEHSLFVRLVADTVLPEKLAHQILIMGLEPNRQLFNPLDSLDMVCELVRRAALLARDSGLEPLNVAKPQQLIDLLYASCTY--VGEQQNQQLPSDVTELAYASAYWRVSTTAVILASHCLQTCGSHLWTHYPTIRRLMEMVMTDDFTVSKDSASTVETDMEEAERLNSQLEVQLILRLESFXTPNPESTETPPVVVTPETSKLLGRLVRNNPRGPCRLPPAEHLTNLRTLAQDLGLGRRLWRSRDPDFLLELLRSQTGHA-SVQPWLVRLV-ESSGTEFELLPIQCLCEYLLRDTLAKMHQSRVHILPLSAMKSTMNSFAAGRVHHASTSSTDSFVSISTTNRESKSESNTNKSHLRAHLIAKLRESLRVFDSSTTADALAHSFFARLNNRHNWIRKAVRQCLYLLTESDVNTTVRNQDSVFDWLNVLHTLQQLPVLRAQPATGAHGDMVTESAQHLLSALLDSLLVETDLDILAGSLLFLSHVTRSSSFVSWRP-VITSLTRFIQSRPNILSSLLHRSPEHVAESLQVNSAVDISYLSLEALAEMHVRYVEYNCTVAGAIPVDERKSVFVTWSAERECPLELDLIQAQLIL 1008          
BLAST of Integrator complex subunit 1 vs. TrEMBL
Match: A0A419PGG8 (Integrator complex subunit 1 (Fragment) OS=Clonorchis sinensis OX=79923 GN=Ints1 PE=4 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 2.044e-60
Identity = 223/863 (25.84%), Postives = 401/863 (46.47%), Query Frame = 3
Query:  519 FPSESIKILGELLHEQ----------------------ISVLHHDIKPVKLFIRDICRWIKLAYINSNGVYTP-----FASSSSNGALPDSLELHDLAQNLLVDRSNSEAL--------------------TSRMTDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDY-EALKSHFNTLRQIRYFTCKWLKNIFRIV---ESHVSADQM---------------------TNYIKQVLFLN----VTRNNDFTYIVDESYGIGDIWNNETDKMFL-VRGLTEIPISDKLVQTLINLGFEKNLCFRPS-EIVNMISELIVRASASAC-TEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIARTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFDELSN------DKEAMDKERQLCEIDSKKIIELESKI------SENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHDIYEKIINNLPVVSRNDT-----KDGSLKRLVHKLRSILC---VTETDKRAMD-----KETLKNIVG-----ALSNSFFNRLSDSSAFIRKVARECLYILLLPIS--------HPIKLMEFSLEFVDTL---KSIMNLNILQDNSLICSVA---EALRETLKFETDIDVLHSYIDLFALMSTGNHKEWLANTVETLSILILNRPIIADKLRTADNETLSKGKTSTTLIC----DSLAEIFLAHINYTAYQAKVVPLEHREEAVMVTIKDKQFPVVVKVIQSQLAL 2726
            F  + ++++G LLH++                      I  L+ ++ P+  F+R+ICR  +L+  +S  V  P     F SS+++  LP +    +LA  L+ DR++                        TS        Q Y+  +++++  LQMLS  RP +         +   +Y EA+K+H  TLRQIR    +W+K I  ++        +D M                        I++ L L     VT+     Y +   Y +  IW  E +++ L  R +T++ + +KL   L+ LG E       S + V M+ EL+ RA++ A  + +  ++V K E +I+ M+A C+Y  V  +  P  ++A  LAY S +W V    VV+A+HC+ T G  LWSN+PT++ LM+++IT  F   +       D    + ER   E++ + I+ LE+ +      + N+    V+V  ++SKLV  L+ N P+GP R PP+ ++E+ + +   +++G RL +CR+PDFL E++R Q    +S++ W++ LV ++S    + LP+  L E++ +D     + NL VV          + G   R     R+ +C   +    +R M      +E ++         AL + FF RLSD    +R   R+CL+ L  P S        HP+      L+ + TL   ++ +N  I   ++ + +      A+  +L  ETD+D++ +Y+   + ++           +  L+  +L RP I   L    ++ ++   +S+ L      +SLA++F+ ++ Y    A+ +P++  +   +    ++Q P+    IQ+QL L
Sbjct:  586 FGLQWVRVMGNLLHDRLLSSATSCFVPRDHLSLSNDQLIDQLNSELSPLYHFLREICRNWRLS--SSESVANPSLPAIFHSSAAHSYLPCA----ELANALMHDRAHRGTTTAAAAANTIVASLLNSPPDKTSSGGHIASFQFYLSGLVSLIAALQMLSASRPYLTN--NSTSSRRASNYNEAMKAHQTTLRQIRLGFVRWIKTILPLIINAAVQTVSDVMDPNGSGNMDSAVVTCFTLLKPATLIRRALLLESVTPVTKAKS-DYELAPEYPVRSIWLGEQEQISLQTRLVTDVCLPEKLCHQLLILGLEPTWQLLSSVDAVEMVCELVWRAASLARDSGMDTISVVKAEQLIDLMYASCTY--VCEQQLPA-ELAE-LAYASVYWHVSTTTVVLAAHCIQTCGFHLWSNYPTIRRLMEMVITGEFTSSTRSVSAAWDASVRETERLNAEMELQLIVRLETMLLNPPDNAGNAPFTPVVVTPDTSKLVGRLVHNNPRGPCRLPPADVLENFQFLAGKLELGRRLWRCRHPDFLLELLRSQSLTCVSAQPWLMRLV-ESSGSEFELLPVQCLCEYLLYD----TLRNLDVVQEEFIPLLVDESGHPGRSESSGRNTVCANAIRNQSQRNMQLICRLREEIRTFANVSTSDALVHCFFTRLSDLRYMVRWAVRQCLHRLTGPTSQSQTPQPQHPVCSWLQVLQCLKTLPVFRNDLNTEISGRDTSVEAFQHFLSAILASLLVETDLDIVTAYLIFLSQLTNDTGFISWRPVITGLTSFVLRRPTILSALLHRQSK-ITVDSSSSLLTAYAGFESLADVFVRYLEYNCTAAEAIPVDENKSVFVTWSPERQCPLEFDCIQAQLIL 1429          
BLAST of Integrator complex subunit 1 vs. TrEMBL
Match: A0A4S2LWW2 (DUF3677 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004321 PE=4 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 1.133e-58
Identity = 224/863 (25.96%), Postives = 398/863 (46.12%), Query Frame = 3
Query:  519 FPSESIKILGELLHEQ----------------------ISVLHHDIKPVKLFIRDICRWIKLAYINSNGVYTP-----FASSSSNGALPDSLELHDLAQNLLVDRSNSEAL--------------------TSRMTDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDY-EALKSHFNTLRQIRYFTCKWLKNIF--------RIVESHVSADQMTNY----------------IKQVLFLN----VTRNNDFTYIVDESYGIGDIWNNETDKMFL-VRGLTEIPISDKLVQTLINLGFEKNLCFRPS-EIVNMISELIVRASASAC-TEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIARTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFDELSN------DKEAMDKERQLCEIDSKKIIELESKI------SENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHDIYEKIINNLPVVSRN-----DTKDGSLKRLVHKLRSILC---VTETDKRAMD-----KETLKNIVG-----ALSNSFFNRLSDSSAFIRKVARECLYILLLPIS--------HPIKLMEFSLEFVDTL---KSIMNLNILQDNSLICSVAE---ALRETLKFETDIDVLHSYIDLFALMSTGNHKEWLANTVETLSILILNRPIIADKLRTADNETLSKGKTSTTLIC----DSLAEIFLAHINYTAYQAKVVPLEHREEAVMVTIKDKQFPVVVKVIQSQLAL 2726
            F  + ++++G LLH++                      I  L+ ++ P   F+R++ R  +L+  +S  V  P     F SS+++  LP +    +LA  L+ DR++                        TS        Q Y+  +++++  LQMLS  RP +         +   +Y EA+K+H  TLRQIR    +W+K I         + V   +  D   N                 I++ L L     VT+     Y +   Y +  IW  E +++ L  R +T++ + +KL   L+ LG E       S + V M+ EL+ RA++ A  + +  ++V K E +I+ M+A C+Y  V  +  P  ++A  LAY S +W V    VV+A+HC+ T G  LWSN+PT++ LM+++IT  F   +       D    + ER   E++ + II LE+ +      + N+    V+V  ++SKLV  L+ N P+GP R PP  ++E+ + +   +++G RL +CR+PDFL E++R Q    +S++ W++ LV ++S    + LP+  L E++ +D     + NL VV          + G   R     R+ +C   +    +R M      +E ++         AL + FF RLSD    +R   R+CL+ L  P S        HP+      L+ + TL   ++  N+ I   +S + +      A+  +L  ETD+D++ +Y+   + ++           +  L+  +L RP I   L    ++ ++   +S+ L      +SLA++F+ ++ Y    A+ +P++  +   +    ++Q P+    IQ+QL L
Sbjct:  573 FGLQWVRVMGNLLHDRLLSSAISCFVPRDHLSLSNDQLIDQLNSELSPSYHFLRELSRNWRLS--SSESVANPSLPAIFHSSATHSYLPCA----ELANALMHDRTHRGTTTAAAAANTIVASLLNSPLDKTSSGGHIASFQFYLNGLVSLIAALQMLSASRPYLTN--NSTSSRRASNYNEAMKAHQTTLRQIRLGFVRWIKTILPLIINAAVQTVSDAMDPDGSGNMDSAVVTCFTLLKPATLIRRALLLESVTPVTKAKS-DYELAPEYPVRSIWLGEQEQISLQTRLVTDVCLPEKLCHQLLILGLEPTWQLLSSVDAVEMVCELVWRAASLARDSGMDTISVIKAEQLIDLMYASCTY--VCEQQLPA-ELAE-LAYASVYWHVSTTTVVLAAHCIQTCGFHLWSNYPTIRRLMEMVITGEFTSSTRSVSATWDTSVRETERLNAELELQLIIRLETMLLNPPDNAGNAPFTPVVVTPDTSKLVGRLVHNNPRGPCRLPPPDVLENFQFLAGKLELGRRLWRCRHPDFLLELLRSQSLTCVSAQPWLMRLV-ESSGSEFELLPVQCLCEYLLYD----TLRNLDVVQEEFIPLLADESGHSGRSESSGRNTVCSNAIRNQSQRNMQLICRLREEIRTFANVSTSDALVHCFFTRLSDLRYMVRWAVRQCLHRLTGPTSQSQTSQPQHPVCSWLQVLQCLKTLPVFRNDPNIEIPGRDSSVEAFQHFLSAILASLLVETDLDIVTAYLIFLSQLTNDTGFISWRPVITGLTSFVLRRPTILSALLHRQSK-ITVDSSSSILTAYAGFESLADVFVRYLEYNCTAAEAIPVDENKSVFVTWSAERQCPLEFDCIQAQLIL 1416          
BLAST of Integrator complex subunit 1 vs. TrEMBL
Match: A0A074ZS20 (DUF3677 domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_03337 PE=4 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 3.245e-58
Identity = 221/862 (25.64%), Postives = 396/862 (45.94%), Query Frame = 3
Query:  519 FPSESIKILGELLHEQ----------------------ISVLHHDIKPVKLFIRDICRWIKLAYINSNGVYTP-----FASSSSNGALPDSLELHDLAQNLLVDRSNSEAL--------------------TSRMTDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDY-EALKSHFNTLRQIRYFTCKWLKNIFRIV---ESHVSADQM---------------------TNYIKQVLFLN----VTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGL-TEIPISDKLVQTLINLGFEKNLCFRPS-EIVNMISELIVRASASAC-TEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIARTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFDELSN------DKEAMDKERQLCEIDSKKIIELESKI------SENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHD-------IYEKII----------NNLPVVSRNDTKDGSLKRLVHKLRSILCVTETDKRAMDKETLKNIVGALSNSFFNRLSDSSAFIRKVARECLYILLLPIS--------HPIKLMEFSLEFVDTLKSIMN-LNI---LQDNSL--ICSVAEALRETLKFETDIDVLHSYIDLFALMSTGNHKEWLANTVETLSILILNRPIIADKLRTADNETLSKGKTSTTLIC----DSLAEIFLAHINYTAYQAKVVPLEHREEAVMVTIKDKQFPVVVKVIQSQLAL 2726
            F  + ++++G LLH++                      I  L+ ++ P+  F+R++ R  +L+  +S  V  P     F SS+++  LP +    +LA  L+ DR++                        TS        Q Y+  +++++  LQMLS  RP +      +  +   +Y EA+K+H  TLRQIR    +W+K I  ++        +D M                        I++ L L     VT+     Y +   Y +  IW  E +++ L   L T++ + +KL   L+ LG E       S + V M+ EL+ RA++ A  + +  ++V K E +I+ M+A C+Y  V  +  P  ++A  LAY S +W V    VV+A+HC+ T G  LWSN+PT++ LM+++IT  F   +       D    + ER   E++ + II LE+ +      + N+    V+V  ++SKLV  L+ N P+GP R PP  ++E+ + +   +++  RL +CR+PDFL E++R Q    +S++ W++ LV ++S    + LP+  L E++ +D       + E+ I          +      RN     +++    +   ++C    + R     +  +   AL + FF RLSD    +R   R+CL+ L  P S        HP+      L+ + TL    N LNI    +DNS+        A+  +L  ETD+D++ +Y+   + ++           +  L+  +L RP I   L    ++ ++   +S+ L      +SLA++F+ ++ Y    A+ +P++  +   +    ++Q P+    IQ+QL L
Sbjct:  697 FGLQWVRVMGNLLHDRLLSSATSCFVPRDHLSLSNDQLIDQLNSELSPLYHFLRELSRNWRLS--SSESVPNPSLPAIFHSSTAHSYLPCA----ELANVLMHDRAHRGTTTAAAAANTIVTSLLNSPPDKTSSGGHIASFQFYLNGLVSLIAALQMLSASRPYLTN--NSQSSRRASNYNEAMKAHQTTLRQIRLGFVRWIKTILPLIINAAVQTVSDGMNPEGSGNMDSAVVTCFTLLKPATLIRRALLLESVTPVTKAKS-DYELAPEYPVRSIWLGEQEQISLQTPLVTDVCLPEKLCHQLLILGLEPTWQLLSSVDAVEMVCELVWRAASLARDSGMDTISVVKAEQLIDLMYASCTY--VCEQQLPA-ELAE-LAYASVYWHVSTTTVVLAAHCIQTCGFHLWSNYPTIRRLMEMVITGEFTSSTRSVSAAWDASVRETERLNAELELQLIIRLETMLLNPPDNAGNAPFTPVVVTPDTSKLVGRLVHNNPRGPCRLPPPDVLENFQFLAGKLELSRRLWRCRHPDFLLELLRNQSLTCVSAQPWLMRLV-ESSGPEFELLPVQCLCEYLLYDTLRNLDIVQEEFIPLLVDESGHPDRFESSGRNTVGSNAIRNQSQRNMQLICRLREEIRTFANVSTSD---ALVHCFFTRLSDLRYRVRWAVRQCLHRLTGPTSQSQTSQPQHPVCSWLQVLQCLKTLPVFRNDLNIEIPGRDNSVEAFQHFLSAILASLLVETDLDIVTAYLIFLSQLTNDTGFISWRPVITGLTSFVLRRPTILSALLHRQSK-ITVDSSSSILTAYAGFESLADVFVRYLEYNCTAAEAIPVDENKSVFVTWSPERQCPLEFDCIQAQLVL 1540          

HSP 2 Score: 86.2705 bits (212), Expect = 1.078e-12
Identity = 93/316 (29.43%), Postives = 148/316 (46.84%), Query Frame = 3
Query: 3969 SDYFMSDLLHQSNAFCLRQILHSILNRKTITQLNASRVLDFITACLHHPRLQYSVVLPVSNQYIWPQQNSEI----DLSESELIALLNLVVCEAEHLIEQNGPTAKCVNRSLVKRSDLIDICSSSKS----LFQQRNL-------IINR--FIDWKSPHNEAVDKFGFA----------------LYCRLPNLISDKYQAATNNXXXXXXPMEMEREKEALTVT-DVDRY-NLKEIHRIGQRLLAGLVSPRNDLQDMAIQGCKALVTKHPKLSLQLLPYMCALSDGALDGTDSWNEFRKKRSPVLYSNLLHLLEIM 4811
             DY +++LL+Q+N   LRQ  + +L  + I   N++R+L+FI A L  PR+ +SV  P S     P   + +     L+ SE + L++ V+ E  +L E    T   ++  L KR+ L+D+  +  S    L+ + N        I N+  ++  +S H  +  K G A                LY R P  I     A                   A  VT D DR  N  EI R+G  +L G+ S  + +++ A    K+LV  HP+  L LLP +  LSDG ++   +  +F  K S +L+S++LHLLE++
Sbjct: 1974 GDYVLTELLNQANPDLLRQCFYRLLQHEDINSANSTRLLNFIQAALTLPRVSFSV--PRSEARGRPDTATALAELAQLTWSEALCLVSHVLNECRNLCET---TVHELDLLLSKRTPLLDLAITRWSKECFLYLEYNADFLTIEDIQNQLPYLQPESIHLFSKLKDGNAHIGQSLVRISQRLMLYLYMRWPGSIQQLTSAGARRLVSF----------PATEVTSDSDRLLNRPEIDRLGPLILVGMTSTNSQVRETARLASKSLVIYHPRAFLSLLPILSTLSDGLVERNRT--QFSSKGSHLLFSSILHLLELL 2272          
BLAST of Integrator complex subunit 1 vs. Ensembl Cavefish
Match: ints1 (integrator complex subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6523])

HSP 1 Score: 148.673 bits (374), Expect = 3.863e-35
Identity = 143/579 (24.70%), Postives = 273/579 (47.15%), Query Frame = 3
Query:  786 DCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIAR-----TLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNF--------DELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHDIYEKIINNLPVVSRNDTKDGSLKR--------------LVHKLRSILCVTETDKRAMDKETLKNIVGALSNSFFNRLSDSSAFIRKVARECLYILLL------------PISHPIKLMEFSLEFVDTLKSIMNLNILQDNSLICSVAEALRETLKFETDIDVLHSYI 2405
            D  FK+ +V  + +++    ML +    V+EA       EKK+ E L+S  N +  I+     WL  +   + S +      + + +VLF              E+Y   D W  E+D+ F +R  +E+P+ +  +  ++ +G  ++L   P++ + +   L+ RA+     ++  + V + + +I+ +   C+Y    H  + N+Q+        LA  + +WK    L+V+A+     +G   W  +PT+K LM++++TNN+        DE     E + +E Q+ + + ++I+  ES ++  S    +    ++S L++ L    P+GP R+PP H+ E +KS+NQ +++G  L + RNPDFL  I++ Q  ++  S  W+ DLV ++SE +LD LP+  L EF+ HD  ++        S +D ++G  K               L+ +L+ +L   +      D++T   ++    + F  RLS S    R +A + L ++L             P+    +  E    +   L+ +  L +   +S+    A AL++ +  ETD   + +Y+
Sbjct:  528 DMEFKERFVIQVTDLLTVSMMLGITA-QVKEAGIAWDKGEKKNLEVLRSFQNQIAAIQRDAVWWLHTVVPTI-SKLGPKDYVHCLHKVLFTEQP----------ETYYKWDNWPPESDRNFFLRLCSEVPLLEDTLMRILVIGLSRDLPLGPADAMELADHLVKRAAGVQSDDLNVLRVERIQ-LIDAVLNLCTY----HHPE-NIQLPAGYQPPNLAISTLYWKAWLLLLVVAAFNPQKIGLAAWDGYPTLKMLMEMVMTNNYSYPPCTVADE-ETKTEMISRELQVSQKERQEILAFESHLAAASTKQTIT--ESNSLLLSQLTSLEPKGPPRRPPPHVQEQVKSLNQSLRLGHLLCRSRNPDFLLNIIQRQASSQ--SMPWLADLV-QSSEGSLDVLPVQCLCEFLLHDAADE------TPSADDEEEGESKEQRAKKRQRQQKQRQLLGRLQDLLVGPKA-----DEQTTHEVL----DYFLRRLSSSQVASRVLAMKGLSLVLTEGGLKDGEERDQPMEEDSRDAELLPAYQWLLQDMPKLPLF--DSVRSMTASALQQAVHMETDPQTISAYL 1065          

HSP 2 Score: 68.5514 bits (166), Expect = 9.675e-11
Identity = 92/353 (26.06%), Postives = 157/353 (44.48%), Query Frame = 3
Query: 3966 YSDYFMSDLLHQSNAFCLRQILHSILNRKTITQLNASRVLDFITACLHHPRLQYSVVLPVSNQYIWPQQNSE---IDLSESELIALLNLVVCEAEHLIEQNGPTAKCVNR---SLVK-RSDLIDICSSS--KSLFQQRNLIINRFIDWK-SPHNEAVDKFGFALYCRLPNLISDKYQAATNNXXXXXXPM-EMEREKEALTVTDVDRYNLKEIHRIGQRLLAGLV---SPRNDLQDMAIQGCKALVTKHPKLSLQLLPYMCALSDGALDGTDSWNEFRKKRSP---VLYSNLLHLLEIMIPVXXXXXXXXXXXRGNMKIILFNFLRVLIRYRDEHKFFIGFVTRLVGFMEKMI 4973
            Y  Y ++ L HQSN   L Q + S+LNR    +++ S  LDF+ AC H PR+         +Q   PQ+ +E   + LS  ELI+L++L++CE+E      G     +++   SL++ R  L+  C     +S+ +    +IN    W  S  ++  +     +Y + P +I                PM +     EA       + ++  +HR+   LLA      S  N   D  +  C+ L   HP L L+ LP + AL    L G    N    KR       +S++L +LE++ P+   +          ++  L +F++VL  +R   +  I  +++ V F++K I
Sbjct: 1619 YRPYLLALLTHQSNWSTLHQCISSLLNRPREHRVDPSSALDFLWACSHIPRIWQG-----RDQKT-PQKRTEKFVLKLSADELISLVDLILCESELSWRDTGQAKDTLDQASCSLIQSRLPLLQSCCHGDLQSVRKVSEYLINCVKKWGDSVMSKRCENLLLQIYLQFPEVIQ-------------HVPMPDATLSGEAAGDGSTCKLDVL-VHRL-ITLLADTGESKSTENRASDANL-ACRKLAVSHPVLLLRHLPMIAAL----LHGRTHLNLQELKRQQHHLTFFSDVLAILELLQPMVFQSDHQRA-----LQDCLLSFIKVLQNFRRLSR--IPIISKFVQFIQKYI 1938          
BLAST of Integrator complex subunit 1 vs. Ensembl Nematostella
Match: EDO38544 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCM5])

HSP 1 Score: 77.7962 bits (190), Expect = 3.987e-14
Identity = 94/482 (19.50%), Postives = 192/482 (39.83%), Query Frame = 3
Query:  198 SCAQNVMHNTH-DVNFCAYFMLKFKYKLSKPPVQSILLECVRKITETHPCNLRNLLEIYINNEIYGTPTAAAAASNITGTVGNPCPIAYVPQNKSGPASVTFPAVYFRFPSESIKILGELLHEQISVLHHDIKPVKLFIRDICRWIKLAYINSNGVYTPFASSSSNGALPDSLELHDLAQNLLVDRSNSEALTSRMTDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIARTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNN---------FDELSNDKEAMDKERQLC 1613
            S AQN   ++H DV   +  +   + +L   P+ +  + C+R++   H  NL  +L+  I NE+  T                       P N S         +Y   P    K+L  +  + ++     ++  +  +R++ R ++      N V                     L +  + +R+ S+    +  D   K+  + ++ +++    MLSV  P V++        +KKD   L      +  I+     WL  +   +  +++A +    +++VLFL    N          Y   D W +E DK  L    +++P+ +  +  ++ +G    L     E +++   L  RA++      +  +V++ E +++ +   C+Y        P   +   LA  + +WK    L ++AS   +++G   W NFP +K +M++I+TN           D+L    +++   + LC
Sbjct:  270 SLAQNCNSHSHEDVEVISNLI---RMRLKTKPLANHYVTCIRELIGQHTENLGTVLKHVIYNELSTTRN---------------------PNNMS-----LLGMMYLHKPDTVAKLLAMVFQDLLANRDDYLRACRALLREVMRSLR---YEVNCVV--------------------LCRGFMSERTESQF---KDLDSPLKERMLISLTDLIAMTTMLSVT-PAVKDVAAAFARGDKKDLSVLHQFQKNVSTIQRDAVWWLHTVVPKM-FNLTAKEYNACLQKVLFLEPVEN----------YSGKDNWPSEADKGLLYSLASDVPVQEDTLMRVVIIGLSAELPVTAPEALDIADRLTRRAASLKSGTHLKAHVNRLE-LLDAVLNLCAYHYPNEIQLPAGYVPPKLAIANLYWKAWTLLAIVASLNPSSIGHAGWENFPMLKCMMEMILTNGPARRPPQAVLDQLKTINKSLKLGQMLC 683          

HSP 2 Score: 70.8626 bits (172), Expect = 4.610e-12
Identity = 34/81 (41.98%), Postives = 55/81 (67.90%), Query Frame = 3
Query: 1731 LPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFI 1973
            L  GP R+PP  +++ LK+IN+ +K+G  L + R+PDFL +I++ Q  ++  S  W+ DLV ++SE +LD LP+  L EF+
Sbjct:  653 LTNGPARRPPQAVLDQLKTINKSLKLGQMLCRSRSPDFLLDIIQRQGASQ--SMPWLADLV-QSSEGSLDVLPVQCLCEFL 730          
BLAST of Integrator complex subunit 1 vs. Ensembl Nematostella
Match: EDO26218 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCK4])

HSP 1 Score: 70.0922 bits (170), Expect = 5.703e-13
Identity = 33/78 (42.31%), Postives = 54/78 (69.23%), Query Frame = 3
Query: 1740 GPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFI 1973
            GP R+PP  +++ LK+IN+ +K+G  L + R+PDFL +I++ Q  ++  S  W+ DLV ++SE +LD LP+  L EF+
Sbjct:    1 GPARRPPQAVLDQLKTINKSLKLGQMLCRSRSPDFLLDIIQRQGASQ--SMPWLADLV-QSSEGSLDVLPVQCLCEFL 75          
BLAST of Integrator complex subunit 1 vs. Ensembl Medaka
Match: ints1 (integrator complex subunit 1 [Source:NCBI gene;Acc:100304460])

HSP 1 Score: 136.346 bits (342), Expect = 2.407e-31
Identity = 106/411 (25.79%), Postives = 196/411 (47.69%), Query Frame = 3
Query:  783 TDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIA---RTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNF--------DELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHD 1982
             D  FK+ +V  + +++    ML +    V+EA       EKK+ E L+S  N +  I+     WL  +   + S VS     + + +VLF              E+Y   D W  E+D+ F +R  +E+P+ +  +  ++ +G  ++L   P++ + +   L+ RA+     ++  + V + + +I+ +   C+Y    H  +  L +      LA  + +WK    L+V+A+     +G   W  +PT+K LM++++TNN+        DE     E +++E Q+ + + ++I+  ES ++  S    +    +        L              I E +KS+NQ +++G  L + RNPDFL  I++ Q  ++  S  W+ DLV ++SE +LD LP+  L EF+ HD
Sbjct:  528 ADMEFKERFVIQVTDLLTVSMMLGITA-QVKEAGIAWDKGEKKNLEVLRSFQNQIAAIQRDAVWWLHTVVPTI-SKVSPKDYIHCLHKVLFTEQP----------ETYYKWDNWPPESDRNFFLRLCSEVPLLEDTLMRILVIGLSRDLPLGPADAMELADHLVKRAAGVHSDDLEVLRVERIQ-LIDAVLNLCTYH---HPENIQLPVGYQPPNLAISTLYWKAWLLLLVVAAFNPQKIGLAAWDGYPTLKMLMEMVMTNNYTYPPCTITDE-DTKTEMINRELQISQREKQEILAFESHLAAASTKQTITESNSLLLSQLTSLDPQGPPRRPP--PQIQEQVKSLNQSLRLGHLLCRSRNPDFLLNIIQRQASSQ--SMPWLADLV-QSSEGSLDVLPVQCLCEFLLHD 916          
BLAST of Integrator complex subunit 1 vs. Ensembl Medaka
Match: ints1 (integrator complex subunit 1 [Source:NCBI gene;Acc:100304460])

HSP 1 Score: 135.961 bits (341), Expect = 2.605e-31
Identity = 106/411 (25.79%), Postives = 196/411 (47.69%), Query Frame = 3
Query:  783 TDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIA---RTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNF--------DELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHD 1982
             D  FK+ +V  + +++    ML +    V+EA       EKK+ E L+S  N +  I+     WL  +   + S VS     + + +VLF              E+Y   D W  E+D+ F +R  +E+P+ +  +  ++ +G  ++L   P++ + +   L+ RA+     ++  + V + + +I+ +   C+Y    H  +  L +      LA  + +WK    L+V+A+     +G   W  +PT+K LM++++TNN+        DE     E +++E Q+ + + ++I+  ES ++  S    +    +        L              I E +KS+NQ +++G  L + RNPDFL  I++ Q  ++  S  W+ DLV ++SE +LD LP+  L EF+ HD
Sbjct:  528 ADMEFKERFVIQVTDLLTVSMMLGITA-QVKEAGIAWDKGEKKNLEVLRSFQNQIAAIQRDAVWWLHTVVPTI-SKVSPKDYIHCLHKVLFTEQP----------ETYYKWDNWPPESDRNFFLRLCSEVPLLEDTLMRILVIGLSRDLPLGPADAMELADHLVKRAAGVHSDDLEVLRVERIQ-LIDAVLNLCTYH---HPENIQLPVGYQPPNLAISTLYWKAWLLLLVVAAFNPQKIGLAAWDGYPTLKMLMEMVMTNNYTYPPCTITDE-DTKTEMINRELQISQREKQEILAFESHLAAASTKQTITESNSLLLSQLTSLDPQGPPRRPP--PQIQEQVKSLNQSLRLGHLLCRSRNPDFLLNIIQRQASSQ--SMPWLADLV-QSSEGSLDVLPVQCLCEFLLHD 916          
BLAST of Integrator complex subunit 1 vs. Planmine SMEST
Match: SMESG000016870.1 (SMESG000016870.1)

HSP 1 Score: 3598.91 bits (9331), Expect = 0.000e+0
Identity = 1873/1915 (97.81%), Postives = 1878/1915 (98.07%), Query Frame = 3
Query:  147 TGKLQSSTLNMLTIMANSCAQNVMHNTHDVNFCAYFMLKFKYKLSKPPVQSILLECVRKITETHPCNLRNLLEIYINNEIYGTPTAAAAASNITGTVGNPCPIA-YVPQNKSGPAS--VTFPAVYFRFPSE----------------SIKILGELLHEQISVLHHDIKPVKLFIRDICRWIKLAYINSNGVYTPFASSSSNGALPDSLELHDLAQNLLVDRSNSEALTSRMTDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIARTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFDELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHDIYEKIINNLPVVSRNDTKDGSLKRLVHKLRSILCVTETDKRAMDKETLKNIVGALSNSFFNRLSDSSAFIRKVARECLYILLLPISHPIKLMEFSLEFVDTLKSIMNLNILQDNSLICSVAEALRETLKFETDIDVLHSYIDLFALMSTGNHKEWLANTVETLSILILNRPIIADKLRTADNETLSKGKTSTTLICDSLAEIFLAHINYTAYQAKVVPLEHREEAVMVTIKDKQFPVVVKVIQSQLALACWGVSKSKKSKKLIDFWFCKVNTSNKYQLTSFTNIESNAPVTDIIPDWLVNAAVHSGIVSVMSGILNHHVAVNGKISHSLTPALYFMSNDFIKSYLNYMNSIVKSELTMIETWLSQCSEKLLSGMLATVTRMYSKVVKPXXXXXXVDILFKTTLETHHHHLVPKYQNLKTAKMPNLEPKIIVKPIENRRKIENPEITARMEIDDIDNVWSTVVQAYSIGTITECISKLLASKSIEIVKGIENLFKLLKDPKTHSETLKILNKSDFKLMPLLKLSFRSYDQESFDFGMQSFRYLFKSYPHIEKSSLWKMIYNLSLVQGLTXXXXXXXXXXXXXXXXXXXXXEMSDVDQYHHHHHQLQWKSLAKSIMQGGTEDAGQIGPKIDQLTILGLGNGHFTEXXXXXXXXXXXXXXXXNQYSDYFMSDLLHQSNAFCLRQILHSILNRKTITQLNASRVLDFITACLHHPRLQYSVVLPVSNQYIWPQQNSEIDLSESELIALLNLVVCEAEHLIEQNGPTAKCVNRSLVKRSDLIDICSSSKSLFQQRNLIINRFIDWKSPHNEAVDKFGFALYCRLPNLISDKYQAATNNXXXXXXPMEMEREKEALTVTDVDRYNLKEIHRIGQRLLAGLVSPRNDLQDMAIQGCKALVTKHPKLSLQLLPYMCALSDGALDGTDSWNEFRKKRSPVLYSNLLHLLEIMIPVXXXXXXXXXXXRGNMKIILFNFLRVLIRYRDEHKFFIGFVTRLVGFMEKMIPLEKKLVEDIVSXXXXXXXXXXXXXXXXXGDFIIEHATEITALSKIYPQFRNLIVYVQKNKEICSSLLSASSTGELDDNRASQLPLLKLELLVNFRKKLRETLTGNGILMQIKDLDDVSRRDTNIIGLFLDDLRRLINHSMNDVRIAAVQVLARYLNAFPEQANRIIGDFILSNMLKSVSYWSRPFVNLTLKTLCQTGMLTPNVVPLCLTNHARLYVTGNNGRGNYRESIELLEVIIDNISLESFMESVGSYNGKPMLKKDNINQAQKRGFLDNDGDSHKAKRSRFK 5834
            TGKLQSSTLNMLTIMANSCAQNVMHNTHDVNFCAYFMLKFKYKLSKPPVQSILLECVRKITETHPCNLRNLLEIYINNEIYGTPTAAAAASNITGTVGN  P+  Y+  N     S  + F   + R PS                 S +ILGELLHEQISVLHHDIKPVKLFIRDICRWIKLAYINSNGVYTPFASSSSNGALPDSLELHDLAQNLLVDRSNSEALTSRMTDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIARTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFDELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHDIYEKIINNLPVVSRNDTKDGSLKRLVHKLRSILCVTETDKRAMDKETLKNIVGALSNSFFNRLSDSSAFIRKVARECLYILLLPISHPIKLMEFSLEFVDTLKSIMNLNILQDNSLICSVAEALRETLKFETDIDVLHSYIDLFALMSTGNHKEWLANTVETLSILILNRPIIADKLRTADNETLSKGKTSTTLICDSLAEIFLAHINYTAYQAKVVPLEHREEAVMVTIKDKQFPVVVKVIQSQLALACWGVSKSKKSKKLIDFWFCKVNTSNKYQLTSFTNIESNAPVTDIIPDWLVNAAVHSGIVSVMSGILNHHVAVNGKISHSLTPALYFMSNDFIKSYLNYMNSIVKSELTMIETWLSQCSEKLLSGMLATVTRMYSKVVKPAAAAAAVDILFKTTLETHHHHLVPKYQNLKTAKMPNLEPKIIVKPIENRRKIENPEITARMEIDDIDNVWSTVVQAYSIGTITECISKLLASKSIEIVKGIENLFKLLKDPKTHSETLKILNKSDFKLMPLLKLSFRSYDQESFDFGMQSFRYLFKSYPHIEKSSLWKMIYNLSLVQGLTVGNIGNVGNGGGGDVAVAVAVEMSDVDQYHHHHHQLQWKSLAKSIMQGGTEDAGQIGPKIDQLTILGLGNGHFTESHFDLLHKLLFSSHSLNQYSDYFMSDLLHQSNAFCLRQILHSILNRKTITQLNASRVLDFITACLHHPRLQYSVVLPVSNQYIWPQQNSEIDLSESELIALLNLVVCEAEHLIEQNGPTAKCVNRSLVKRSDLIDICSSSKSLFQQRNLIINRFIDWKSPHNEAVDKFGFALYCRLPNLISDKYQAATNNQQQQQQPMEMEREKEALTVTDVDRYNLKEIHRIGQRLLAGLVSPRNDLQDMAIQGCKALVTKHPKLSLQLLPYMCALSDGALDGTDSWNEFRKKRSPVLYSNLLHLLEIMIPVSNINSTTSTTIRGNMKIILFNFLRVLIRYRDEHKFFIGFVTRLVGFMEKMIPLEKKLVEDIVSCCCEEEVKNENREEKENGDFIIEHATEITALSKIYPQFRNLIVYVQKNKEICSSLLSASSTGELDDNRASQLPLLKLELLVNFRKKLRETLTGNGILMQIKDLDDVSRRDTNIIGLFLDDLRRLINHSMNDVRIAAVQVLARYLNAFPEQANRIIGDFILSNMLKSVSYWSRPFVNLTLKTLCQTGMLTPNVVPLCLTNHARLYVTGNNGRGNYRESIELLEVIIDNISLESFMESVGSYNGKPMLKKDNINQAQKRGFLDNDGDSHKAKRSRFK
Sbjct:  227 TGKLQSSTLNMLTIMANSCAQNVMHNTHDVNFCAYFMLKFKYKLSKPPVQSILLECVRKITETHPCNLRNLLEIYINNEIYGTPTAAAAASNITGTVGNLVPLPMYLRINPGRHLSRFLRFTFAFLRNPSRFFLLLCRALIASPGYNSFQILGELLHEQISVLHHDIKPVKLFIRDICRWIKLAYINSNGVYTPFASSSSNGALPDSLELHDLAQNLLVDRSNSEALTSRMTDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIARTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFDELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHDIYEKIINNLPVVSRNDTKDGSLKRLVHKLRSILCVTETDKRAMDKETLKNIVGALSNSFFNRLSDSSAFIRKVARECLYILLLPISHPIKLMEFSLEFVDTLKSIMNLNILQDNSLICSVAEALRETLKFETDIDVLHSYIDLFALMSTGNHKEWLANTVETLSILILNRPIIADKLRTADNETLSKGKTSTTLICDSLAEIFLAHINYTAYQAKVVPLEHREEAVMVTIKDKQFPVVVKVIQSQLALACWGVSKSKKSKKLIDFWFCKVNTSNKYQLTSFTNIESNAPVTDIIPDWLVNAAVHSGIVSVMSGILNHHVAVNGKISHSLTPALYFMSNDFIKSYLNYMNSIVKSELTMIETWLSQCSEKLLSGMLATVTRMYSKVVKPAAAAAAVDILFKTTLETHHHHLVPKYQNLKTAKMPNLEPKIIVKPIENRRKIENPEITARMEIDDIDNVWSTVVQAYSIGTITECISKLLASKSIEIVKGIENLFKLLKDPKTHSETLKILNKSDFKLMPLLKLSFRSYDQESFDFGMQSFRYLFKSYPHIEKSSLWKMIYNLSLVQGLTVGNIGNVGNGGGGDVAVAVAVEMSDVDQYHHHHHQLQWKSLAKSIMQGGTEDAGQIGPKIDQLTILGLGNGHFTESHFDLLHKLLFSSHSLNQYSDYFMSDLLHQSNAFCLRQILHSILNRKTITQLNASRVLDFITACLHHPRLQYSVVLPVSNQYIWPQQNSEIDLSESELIALLNLVVCEAEHLIEQNGPTAKCVNRSLVKRSDLIDICSSSKSLFQQRNLIINRFIDWKSPHNEAVDKFGFALYCRLPNLISDKYQAATNNQQQQQQPMEMEREKEALTVTDVDRYNLKEIHRIGQRLLAGLVSPRNDLQDMAIQGCKALVTKHPKLSLQLLPYMCALSDGALDGTDSWNEFRKKRSPVLYSNLLHLLEIMIPVSNINSTTSTTIRGNMKIILFNFLRVLIRYRDEHKFFIGFVTRLVGFMEKMIPLEKKLVEDIVSCCCEEEVKNENREEKENGDFIIEHATEITALSKIYPQFRNLIVYVQKNKEICSSLLSASSTGELDDNRASQLPLLKLELLVNFRKKLRETLTGNGILMQIKDLDDVSRRDTNIIGLFLDDLRRLINHSMNDVRIAAVQVLARYLNAFPEQANRIIGDFILSNMLKSVSYWSRPFVNLTLKTLCQTGMLTPNVVPLCLTNHARLYVTGNNGRGNYRESIELLEVIIDNISLESFMESVGSYNGKPMLKKDNINQAQKRGFLDNDGDSHKAKRSRFK 2141          

HSP 2 Score: 481.1 bits (1237), Expect = 9.571e-139
Identity = 226/226 (100.00%), Postives = 226/226 (100.00%), Query Frame = 3
Query:  177 MLTIMANSCAQNVMHNTHDVNFCAYFMLKFKYKLSKPPVQSILLECVRKITETHPCNLRNLLEIYINNEIYGTPTAAAAASNITGTVGNPCPIAYVPQNKSGPASVTFPAVYFRFPSESIKILGELLHEQISVLHHDIKPVKLFIRDICRWIKLAYINSNGVYTPFASSSSNGALPDSLELHDLAQNLLVDRSNSEALTSRMTDCTFKQLYVENMINIVCELQMLS 854
            MLTIMANSCAQNVMHNTHDVNFCAYFMLKFKYKLSKPPVQSILLECVRKITETHPCNLRNLLEIYINNEIYGTPTAAAAASNITGTVGNPCPIAYVPQNKSGPASVTFPAVYFRFPSESIKILGELLHEQISVLHHDIKPVKLFIRDICRWIKLAYINSNGVYTPFASSSSNGALPDSLELHDLAQNLLVDRSNSEALTSRMTDCTFKQLYVENMINIVCELQMLS
Sbjct:    1 MLTIMANSCAQNVMHNTHDVNFCAYFMLKFKYKLSKPPVQSILLECVRKITETHPCNLRNLLEIYINNEIYGTPTAAAAASNITGTVGNPCPIAYVPQNKSGPASVTFPAVYFRFPSESIKILGELLHEQISVLHHDIKPVKLFIRDICRWIKLAYINSNGVYTPFASSSSNGALPDSLELHDLAQNLLVDRSNSEALTSRMTDCTFKQLYVENMINIVCELQMLS 226          
BLAST of Integrator complex subunit 1 vs. Planmine SMEST
Match: SMESG000016870.1 (SMESG000016870.1)

HSP 1 Score: 3598.91 bits (9331), Expect = 0.000e+0
Identity = 1873/1915 (97.81%), Postives = 1878/1915 (98.07%), Query Frame = 3
Query:  147 TGKLQSSTLNMLTIMANSCAQNVMHNTHDVNFCAYFMLKFKYKLSKPPVQSILLECVRKITETHPCNLRNLLEIYINNEIYGTPTAAAAASNITGTVGNPCPIA-YVPQNKSGPAS--VTFPAVYFRFPSE----------------SIKILGELLHEQISVLHHDIKPVKLFIRDICRWIKLAYINSNGVYTPFASSSSNGALPDSLELHDLAQNLLVDRSNSEALTSRMTDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIARTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFDELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHDIYEKIINNLPVVSRNDTKDGSLKRLVHKLRSILCVTETDKRAMDKETLKNIVGALSNSFFNRLSDSSAFIRKVARECLYILLLPISHPIKLMEFSLEFVDTLKSIMNLNILQDNSLICSVAEALRETLKFETDIDVLHSYIDLFALMSTGNHKEWLANTVETLSILILNRPIIADKLRTADNETLSKGKTSTTLICDSLAEIFLAHINYTAYQAKVVPLEHREEAVMVTIKDKQFPVVVKVIQSQLALACWGVSKSKKSKKLIDFWFCKVNTSNKYQLTSFTNIESNAPVTDIIPDWLVNAAVHSGIVSVMSGILNHHVAVNGKISHSLTPALYFMSNDFIKSYLNYMNSIVKSELTMIETWLSQCSEKLLSGMLATVTRMYSKVVKPXXXXXXVDILFKTTLETHHHHLVPKYQNLKTAKMPNLEPKIIVKPIENRRKIENPEITARMEIDDIDNVWSTVVQAYSIGTITECISKLLASKSIEIVKGIENLFKLLKDPKTHSETLKILNKSDFKLMPLLKLSFRSYDQESFDFGMQSFRYLFKSYPHIEKSSLWKMIYNLSLVQGLTXXXXXXXXXXXXXXXXXXXXXEMSDVDQYHHHHHQLQWKSLAKSIMQGGTEDAGQIGPKIDQLTILGLGNGHFTEXXXXXXXXXXXXXXXXNQYSDYFMSDLLHQSNAFCLRQILHSILNRKTITQLNASRVLDFITACLHHPRLQYSVVLPVSNQYIWPQQNSEIDLSESELIALLNLVVCEAEHLIEQNGPTAKCVNRSLVKRSDLIDICSSSKSLFQQRNLIINRFIDWKSPHNEAVDKFGFALYCRLPNLISDKYQAATNNXXXXXXPMEMEREKEALTVTDVDRYNLKEIHRIGQRLLAGLVSPRNDLQDMAIQGCKALVTKHPKLSLQLLPYMCALSDGALDGTDSWNEFRKKRSPVLYSNLLHLLEIMIPVXXXXXXXXXXXRGNMKIILFNFLRVLIRYRDEHKFFIGFVTRLVGFMEKMIPLEKKLVEDIVSXXXXXXXXXXXXXXXXXGDFIIEHATEITALSKIYPQFRNLIVYVQKNKEICSSLLSASSTGELDDNRASQLPLLKLELLVNFRKKLRETLTGNGILMQIKDLDDVSRRDTNIIGLFLDDLRRLINHSMNDVRIAAVQVLARYLNAFPEQANRIIGDFILSNMLKSVSYWSRPFVNLTLKTLCQTGMLTPNVVPLCLTNHARLYVTGNNGRGNYRESIELLEVIIDNISLESFMESVGSYNGKPMLKKDNINQAQKRGFLDNDGDSHKAKRSRFK 5834
            TGKLQSSTLNMLTIMANSCAQNVMHNTHDVNFCAYFMLKFKYKLSKPPVQSILLECVRKITETHPCNLRNLLEIYINNEIYGTPTAAAAASNITGTVGN  P+  Y+  N     S  + F   + R PS                 S +ILGELLHEQISVLHHDIKPVKLFIRDICRWIKLAYINSNGVYTPFASSSSNGALPDSLELHDLAQNLLVDRSNSEALTSRMTDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIARTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFDELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHDIYEKIINNLPVVSRNDTKDGSLKRLVHKLRSILCVTETDKRAMDKETLKNIVGALSNSFFNRLSDSSAFIRKVARECLYILLLPISHPIKLMEFSLEFVDTLKSIMNLNILQDNSLICSVAEALRETLKFETDIDVLHSYIDLFALMSTGNHKEWLANTVETLSILILNRPIIADKLRTADNETLSKGKTSTTLICDSLAEIFLAHINYTAYQAKVVPLEHREEAVMVTIKDKQFPVVVKVIQSQLALACWGVSKSKKSKKLIDFWFCKVNTSNKYQLTSFTNIESNAPVTDIIPDWLVNAAVHSGIVSVMSGILNHHVAVNGKISHSLTPALYFMSNDFIKSYLNYMNSIVKSELTMIETWLSQCSEKLLSGMLATVTRMYSKVVKPAAAAAAVDILFKTTLETHHHHLVPKYQNLKTAKMPNLEPKIIVKPIENRRKIENPEITARMEIDDIDNVWSTVVQAYSIGTITECISKLLASKSIEIVKGIENLFKLLKDPKTHSETLKILNKSDFKLMPLLKLSFRSYDQESFDFGMQSFRYLFKSYPHIEKSSLWKMIYNLSLVQGLTVGNIGNVGNGGGGDVAVAVAVEMSDVDQYHHHHHQLQWKSLAKSIMQGGTEDAGQIGPKIDQLTILGLGNGHFTESHFDLLHKLLFSSHSLNQYSDYFMSDLLHQSNAFCLRQILHSILNRKTITQLNASRVLDFITACLHHPRLQYSVVLPVSNQYIWPQQNSEIDLSESELIALLNLVVCEAEHLIEQNGPTAKCVNRSLVKRSDLIDICSSSKSLFQQRNLIINRFIDWKSPHNEAVDKFGFALYCRLPNLISDKYQAATNNQQQQQQPMEMEREKEALTVTDVDRYNLKEIHRIGQRLLAGLVSPRNDLQDMAIQGCKALVTKHPKLSLQLLPYMCALSDGALDGTDSWNEFRKKRSPVLYSNLLHLLEIMIPVSNINSTTSTTIRGNMKIILFNFLRVLIRYRDEHKFFIGFVTRLVGFMEKMIPLEKKLVEDIVSCCCEEEVKNENREEKENGDFIIEHATEITALSKIYPQFRNLIVYVQKNKEICSSLLSASSTGELDDNRASQLPLLKLELLVNFRKKLRETLTGNGILMQIKDLDDVSRRDTNIIGLFLDDLRRLINHSMNDVRIAAVQVLARYLNAFPEQANRIIGDFILSNMLKSVSYWSRPFVNLTLKTLCQTGMLTPNVVPLCLTNHARLYVTGNNGRGNYRESIELLEVIIDNISLESFMESVGSYNGKPMLKKDNINQAQKRGFLDNDGDSHKAKRSRFK
Sbjct:  223 TGKLQSSTLNMLTIMANSCAQNVMHNTHDVNFCAYFMLKFKYKLSKPPVQSILLECVRKITETHPCNLRNLLEIYINNEIYGTPTAAAAASNITGTVGNLVPLPMYLRINPGRHLSRFLRFTFAFLRNPSRFFLLLCRALIASPGYNSFQILGELLHEQISVLHHDIKPVKLFIRDICRWIKLAYINSNGVYTPFASSSSNGALPDSLELHDLAQNLLVDRSNSEALTSRMTDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEALKSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNNDFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKNLCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDVVLHESDPNLQIARTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTVKNLMQIIITNNFDELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDDIVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQCRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIYHDIYEKIINNLPVVSRNDTKDGSLKRLVHKLRSILCVTETDKRAMDKETLKNIVGALSNSFFNRLSDSSAFIRKVARECLYILLLPISHPIKLMEFSLEFVDTLKSIMNLNILQDNSLICSVAEALRETLKFETDIDVLHSYIDLFALMSTGNHKEWLANTVETLSILILNRPIIADKLRTADNETLSKGKTSTTLICDSLAEIFLAHINYTAYQAKVVPLEHREEAVMVTIKDKQFPVVVKVIQSQLALACWGVSKSKKSKKLIDFWFCKVNTSNKYQLTSFTNIESNAPVTDIIPDWLVNAAVHSGIVSVMSGILNHHVAVNGKISHSLTPALYFMSNDFIKSYLNYMNSIVKSELTMIETWLSQCSEKLLSGMLATVTRMYSKVVKPAAAAAAVDILFKTTLETHHHHLVPKYQNLKTAKMPNLEPKIIVKPIENRRKIENPEITARMEIDDIDNVWSTVVQAYSIGTITECISKLLASKSIEIVKGIENLFKLLKDPKTHSETLKILNKSDFKLMPLLKLSFRSYDQESFDFGMQSFRYLFKSYPHIEKSSLWKMIYNLSLVQGLTVGNIGNVGNGGGGDVAVAVAVEMSDVDQYHHHHHQLQWKSLAKSIMQGGTEDAGQIGPKIDQLTILGLGNGHFTESHFDLLHKLLFSSHSLNQYSDYFMSDLLHQSNAFCLRQILHSILNRKTITQLNASRVLDFITACLHHPRLQYSVVLPVSNQYIWPQQNSEIDLSESELIALLNLVVCEAEHLIEQNGPTAKCVNRSLVKRSDLIDICSSSKSLFQQRNLIINRFIDWKSPHNEAVDKFGFALYCRLPNLISDKYQAATNNQQQQQQPMEMEREKEALTVTDVDRYNLKEIHRIGQRLLAGLVSPRNDLQDMAIQGCKALVTKHPKLSLQLLPYMCALSDGALDGTDSWNEFRKKRSPVLYSNLLHLLEIMIPVSNINSTTSTTIRGNMKIILFNFLRVLIRYRDEHKFFIGFVTRLVGFMEKMIPLEKKLVEDIVSCCCEEEVKNENREEKENGDFIIEHATEITALSKIYPQFRNLIVYVQKNKEICSSLLSASSTGELDDNRASQLPLLKLELLVNFRKKLRETLTGNGILMQIKDLDDVSRRDTNIIGLFLDDLRRLINHSMNDVRIAAVQVLARYLNAFPEQANRIIGDFILSNMLKSVSYWSRPFVNLTLKTLCQTGMLTPNVVPLCLTNHARLYVTGNNGRGNYRESIELLEVIIDNISLESFMESVGSYNGKPMLKKDNINQAQKRGFLDNDGDSHKAKRSRFK 2137          

HSP 2 Score: 474.167 bits (1219), Expect = 2.010e-136
Identity = 222/222 (100.00%), Postives = 222/222 (100.00%), Query Frame = 3
Query:  189 MANSCAQNVMHNTHDVNFCAYFMLKFKYKLSKPPVQSILLECVRKITETHPCNLRNLLEIYINNEIYGTPTAAAAASNITGTVGNPCPIAYVPQNKSGPASVTFPAVYFRFPSESIKILGELLHEQISVLHHDIKPVKLFIRDICRWIKLAYINSNGVYTPFASSSSNGALPDSLELHDLAQNLLVDRSNSEALTSRMTDCTFKQLYVENMINIVCELQMLS 854
            MANSCAQNVMHNTHDVNFCAYFMLKFKYKLSKPPVQSILLECVRKITETHPCNLRNLLEIYINNEIYGTPTAAAAASNITGTVGNPCPIAYVPQNKSGPASVTFPAVYFRFPSESIKILGELLHEQISVLHHDIKPVKLFIRDICRWIKLAYINSNGVYTPFASSSSNGALPDSLELHDLAQNLLVDRSNSEALTSRMTDCTFKQLYVENMINIVCELQMLS
Sbjct:    1 MANSCAQNVMHNTHDVNFCAYFMLKFKYKLSKPPVQSILLECVRKITETHPCNLRNLLEIYINNEIYGTPTAAAAASNITGTVGNPCPIAYVPQNKSGPASVTFPAVYFRFPSESIKILGELLHEQISVLHHDIKPVKLFIRDICRWIKLAYINSNGVYTPFASSSSNGALPDSLELHDLAQNLLVDRSNSEALTSRMTDCTFKQLYVENMINIVCELQMLS 222          
The following BLAST results are available for this feature:
BLAST of Integrator complex subunit 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
INTS13.824e-3427.70integrator complex subunit 1 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Integrator complex subunit 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrator complex subunit 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
IntS11.492e-3821.64gene:FBgn0034964 transcript:FBtr0072168[more]
back to top
BLAST of Integrator complex subunit 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ints12.549e-3227.01integrator complex subunit 1 [Source:ZFIN;Acc:ZDB-... [more]
ints12.549e-3227.01integrator complex subunit 1 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Integrator complex subunit 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exosc56.946e-3427.07exosome component 5 [Source:Xenbase;Acc:XB-GENE-62... [more]
exosc57.586e-3427.07exosome component 5 [Source:Xenbase;Acc:XB-GENE-62... [more]
exosc57.615e-3427.07exosome component 5 [Source:Xenbase;Acc:XB-GENE-62... [more]
exosc51.016e-3227.80exosome component 5 [Source:Xenbase;Acc:XB-GENE-62... [more]
exosc53.181e-2625.12exosome component 5 [Source:Xenbase;Acc:XB-GENE-62... [more]
back to top
BLAST of Integrator complex subunit 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ints16.343e-3427.45integrator complex subunit 1 [Source:MGI Symbol;Ac... [more]
Ints16.346e-3427.45integrator complex subunit 1 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Integrator complex subunit 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q9W1C5|INT1_DROME1.495e-3721.64Integrator complex subunit 1 OS=Drosophila melanog... [more]
sp|Q8N201|INT1_HUMAN1.836e-3327.70Integrator complex subunit 1 OS=Homo sapiens OX=96... [more]
sp|Q6P4S8|INT1_MOUSE4.234e-3327.45Integrator complex subunit 1 OS=Mus musculus OX=10... [more]
sp|Q54NC8|INT1_DICDI1.537e-1426.99Integrator complex subunit 1 homolog OS=Dictyostel... [more]
back to top
BLAST of Integrator complex subunit 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0QZC95.260e-7324.98DUF3677 domain-containing protein OS=Fasciola hepa... [more]
A0A183AME31.770e-6524.10Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A419PGG82.044e-6025.84Integrator complex subunit 1 (Fragment) OS=Clonorc... [more]
A0A4S2LWW21.133e-5825.96DUF3677 domain-containing protein OS=Opisthorchis ... [more]
A0A074ZS203.245e-5825.64DUF3677 domain-containing protein OS=Opisthorchis ... [more]
back to top
BLAST of Integrator complex subunit 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ints13.863e-3524.70integrator complex subunit 1 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Integrator complex subunit 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrator complex subunit 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrator complex subunit 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO385443.987e-1419.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO262185.703e-1342.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Integrator complex subunit 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ints12.407e-3125.79integrator complex subunit 1 [Source:NCBI gene;Acc... [more]
ints12.605e-3125.79integrator complex subunit 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Integrator complex subunit 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000016870.19.571e-13997.81SMESG000016870.1[more]
SMESG000016870.12.010e-13697.81SMESG000016870.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004622 ID=SMED30004622|Name=Integrator complex subunit 1|organism=Schmidtea mediterranea sexual|type=transcript|length=5876bp
TAATAACAACGATAATAATAACAATAATAATGATTAATGAATGACGTAAT
AACAATGGTAATGATTAATAAATGACATAATAACAATAATAATGATTACT
AAATTACGTAATAATAATAACAATGATCACATAACATCCTCATAAGACCG
GCAAGCTGCAATCATCCACATTAAACATGCTCACCATCATGGCCAACTCA
TGCGCACAGAATGTCATGCACAATACTCATGATGTCAATTTCTGTGCGTA
TTTCATGCTCAAATTCAAGTACAAGCTCTCCAAGCCTCCGGTGCAATCGA
TATTGCTAGAATGCGTGCGGAAGATCACCGAAACTCACCCGTGCAATTTG
CGCAACTTGCTAGAAATCTACATCAACAATGAAATATACGGAACGCCAAC
CGCCGCCGCCGCAGCCAGTAACATCACCGGCACCGTCGGTAACCCTTGTC
CCATTGCCTATGTACCTCAGAATAAATCCGGGCCGGCATCTGTCACGTTT
CCTGCGGTTTACTTTCGCTTTCCTTCGGAATCCATCAAGATCCTCGGCGA
GCTGCTGCACGAGCAAATCTCCGTCCTGCATCATGATATCAAGCCCGTCA
AATTGTTCATCAGGGATATTTGCCGCTGGATTAAATTGGCATACATCAAC
TCCAATGGAGTTTACACGCCTTTTGCATCCTCCTCGTCCAATGGCGCCCT
TCCTGATTCCTTGGAGCTTCACGACTTGGCACAAAATCTGTTGGTTGATC
GCTCAAATAGTGAAGCTCTCACCTCCCGCATGACCGACTGCACATTTAAA
CAGCTCTATGTGGAGAATATGATAAATATCGTTTGTGAATTACAGATGCT
CTCGGTTGTTAGGCCGACTGTCAGAGAGGCTTTTAAGGAACGCGTTGACC
AGGAAAAGAAAGATTACGAAGCTCTAAAATCTCATTTCAACACCCTTCGA
CAAATCCGATACTTTACATGTAAATGGCTGAAGAACATATTCCGAATAGT
CGAATCTCACGTGTCAGCAGATCAAATGACAAATTACATTAAGCAGGTTC
TCTTCTTGAATGTTACAAGGAACAATGATTTCACATATATTGTCGATGAG
AGTTACGGCATTGGAGATATCTGGAATAATGAAACCGATAAAATGTTTCT
GGTTAGGGGCTTGACGGAAATCCCGATATCGGATAAACTGGTTCAAACTC
TCATTAATTTGGGGTTTGAAAAGAACTTGTGCTTCAGACCTTCAGAAATT
GTCAATATGATCTCAGAGCTTATTGTTCGAGCGTCTGCTAGCGCGTGTAC
GGAAATCATTCCGATGAACGTTTCTAAATGTGAGGCAATGATCAATAATA
TGTTTGCCTGCTGTAGCTATGATGTCGTATTGCATGAAAGCGATCCAAAT
CTTCAAATCGCTAGAACTCTTGCTTATAAATCGTCTTTTTGGAAAGTCTG
TCAAGCTCTAGTAGTTATGGCCAGTCATTGCATGACAACAGTTGGAGCTT
TGCTGTGGAGTAATTTCCCCACCGTCAAAAATCTCATGCAGATTATAATA
ACAAACAATTTCGATGAATTATCCAACGATAAAGAAGCAATGGATAAAGA
GCGTCAGCTCTGTGAAATTGACTCTAAAAAGATTATCGAATTAGAATCTA
AAATAAGTGAAAACTCCTTAGATGATATTGTGATGGTCGATGCTAACAGT
TCTAAGCTTGTGAATTTGCTGCTGTTCAATCTGCCACAAGGTCCAATAAG
GCAGCCACCATCGCATATTGTTGAATCACTGAAAAGCATTAATCAAATCA
TGAAAATCGGTGATCGACTGTCACAATGCAGAAATCCCGATTTTTTGTTC
GAAATAGTTCGCGAGCAGGATCAAAATAAAATCTCCTCTCGGAAGTGGAT
TATTGACTTAGTCAAGAAGACATCTGAGCACAATCTCGATTGTCTGCCAT
TGTTGGTTCTCACAGAATTCATTTATCATGACATCTACGAGAAAATCATT
AATAATCTGCCAGTTGTATCTCGCAACGATACAAAGGATGGCAGCTTGAA
GCGCTTGGTCCATAAGCTCAGGTCAATATTGTGCGTGACAGAAACTGATA
AAAGGGCCATGGATAAAGAAACTTTGAAAAATATTGTTGGTGCCCTTTCA
AATTCGTTTTTCAATCGACTGAGCGATTCTTCTGCATTCATCAGGAAAGT
TGCTAGAGAATGTCTTTATATCTTACTTTTGCCAATATCTCATCCAATCA
AACTGATGGAATTTTCACTCGAATTCGTTGACACTCTAAAATCCATAATG
AATCTAAATATTCTCCAAGATAATTCTCTAATCTGTTCCGTTGCAGAAGC
TTTAAGAGAAACCCTAAAATTTGAAACCGACATTGACGTATTACACAGTT
ATATTGATTTATTCGCCTTGATGTCCACAGGTAACCACAAAGAATGGCTA
GCGAATACCGTTGAAACGCTATCGATCTTGATTCTTAATCGACCAATTAT
AGCCGATAAGTTACGAACAGCCGACAACGAGACGTTATCGAAAGGAAAAA
CCTCAACAACATTGATTTGTGATTCATTAGCGGAAATATTCCTCGCTCAC
ATAAACTACACTGCTTACCAGGCGAAAGTCGTTCCGTTGGAACACCGAGA
GGAGGCCGTTATGGTCACCATAAAAGACAAGCAATTCCCAGTTGTCGTCA
AAGTCATTCAAAGTCAACTGGCGCTCGCGTGTTGGGGCGTTTCAAAATCG
AAAAAATCGAAAAAATTAATCGATTTTTGGTTTTGCAAAGTGAACACCAG
CAACAAATACCAACTTACCAGCTTCACAAATATCGAATCCAACGCTCCGG
TAACCGACATTATCCCAGACTGGTTGGTAAATGCAGCAGTTCACAGCGGT
ATCGTTTCGGTGATGAGCGGCATTTTGAACCACCACGTCGCGGTGAACGG
CAAAATCTCCCACTCGCTCACTCCAGCTCTCTATTTCATGTCGAACGATT
TCATAAAGTCCTACCTGAATTACATGAACTCAATAGTGAAATCGGAACTC
ACAATGATAGAAACTTGGTTATCGCAATGTTCCGAGAAACTGTTATCGGG
AATGTTAGCAACCGTTACTAGAATGTATTCCAAGGTGGTGAAACCAGCAG
CAGCAGCAGCAGCAGTTGATATCCTATTCAAAACGACACTGGAAACTCAT
CATCATCATCTCGTACCGAAATATCAAAACCTCAAAACCGCAAAAATGCC
GAATCTTGAACCGAAAATCATTGTCAAACCAATAGAAAACCGGCGGAAAA
TCGAAAACCCAGAAATCACCGCCAGAATGGAAATCGATGATATTGACAAC
GTGTGGAGCACAGTTGTGCAAGCGTACAGTATCGGCACAATCACCGAGTG
CATCAGCAAGCTATTGGCTTCCAAATCTATCGAAATCGTCAAAGGAATTG
AAAATCTCTTCAAACTCCTCAAAGATCCAAAAACCCACTCGGAAACATTG
AAAATCCTCAACAAATCCGATTTCAAATTGATGCCTCTTTTGAAACTGAG
TTTTCGGAGTTACGATCAGGAATCTTTCGATTTTGGAATGCAATCGTTTC
GATATCTCTTCAAATCGTATCCGCACATTGAGAAATCGAGTTTGTGGAAA
ATGATTTACAATCTCTCATTGGTGCAGGGATTGACAGTGGGAAATATCGG
TAACGTTGGCAACGGTGGTGGTGGTGACGTGGCGGTGGCGGTGGCGGTGG
AAATGTCCGATGTAGATCAATATCACCACCACCACCATCAATTGCAATGG
AAATCACTGGCAAAATCGATAATGCAAGGCGGAACTGAAGATGCGGGACA
AATCGGCCCAAAAATCGATCAATTAACAATATTAGGATTGGGCAACGGAC
ATTTCACCGAATCCCATTTCGACTTGCTCCACAAACTTCTCTTTTCCAGC
CATTCTCTCAATCAATATAGCGACTATTTCATGAGCGATTTACTCCACCA
ATCAAACGCGTTTTGTTTGCGGCAAATTCTCCACTCGATTCTCAACAGGA
AAACAATCACCCAATTGAACGCATCTCGAGTTCTCGATTTCATAACGGCT
TGCCTTCATCACCCTCGGCTGCAGTACTCGGTGGTTTTGCCGGTCTCCAA
TCAATATATCTGGCCTCAGCAGAATTCAGAAATCGATTTATCCGAATCCG
AATTGATTGCACTTTTAAATCTCGTCGTATGCGAGGCGGAACATTTAATC
GAACAAAACGGCCCGACTGCAAAATGTGTCAATCGATCTCTCGTCAAACG
CAGCGATCTAATCGATATTTGCTCCTCGTCGAAATCTCTGTTCCAGCAGC
GCAATCTCATTATCAATCGATTTATCGACTGGAAATCTCCTCACAACGAA
GCAGTCGATAAATTCGGATTTGCGCTCTATTGTCGATTGCCGAATTTAAT
CAGTGACAAATATCAAGCCGCCACCAATAATCAACAGCAGCAGCAACAGC
CAATGGAAATGGAAAGGGAAAAAGAAGCACTCACAGTGACAGATGTCGAT
CGATACAATCTCAAGGAAATCCATCGGATCGGTCAGCGATTATTAGCGGG
ATTAGTCAGTCCGAGAAATGATTTGCAAGACATGGCAATTCAAGGTTGCA
AAGCGCTCGTTACGAAACATCCGAAACTCTCGCTGCAATTGCTGCCGTAT
ATGTGTGCCTTGAGTGACGGTGCTCTCGATGGCACAGATTCCTGGAATGA
GTTCCGCAAGAAACGCAGTCCCGTACTCTACTCGAATCTCTTGCATTTGC
TGGAAATCATGATTCCCGTCTCAAATATAAACAGCACCACCAGCACGACT
ATTCGAGGAAACATGAAAATCATTCTCTTCAATTTTCTGCGCGTTCTCAT
CAGATATCGCGATGAGCATAAGTTTTTCATCGGTTTCGTTACTCGACTTG
TCGGATTTATGGAGAAAATGATTCCGTTGGAGAAAAAACTCGTCGAAGAT
ATTGTGAGTTGTTGTTGTGAGGAGGAGGTAAAAAATGAAAACCGAGAAGA
AAAAGAAAATGGAGATTTCATAATCGAGCACGCAACAGAAATTACAGCTC
TCTCGAAAATCTATCCCCAGTTTAGGAATCTCATCGTTTATGTGCAGAAA
AACAAAGAAATCTGCTCGAGTCTCCTGTCTGCCTCGTCTACCGGGGAATT
GGATGATAATCGCGCATCTCAGTTGCCTCTGTTGAAGTTGGAGTTGTTGG
TGAACTTTCGTAAGAAACTCAGAGAAACTCTAACGGGAAATGGAATTCTC
ATGCAAATCAAAGATCTCGATGATGTTTCTCGGAGGGATACGAATATCAT
TGGATTGTTTCTCGATGATTTGCGCCGATTGATCAATCACTCGATGAATG
ATGTGAGGATTGCGGCGGTTCAGGTGTTAGCGCGCTATTTGAATGCGTTC
CCGGAACAGGCGAATCGGATTATCGGGGATTTCATTCTGAGTAATATGTT
GAAATCTGTTTCTTATTGGTCGAGGCCTTTTGTTAATTTGACTTTGAAAA
CACTTTGCCAAACCGGAATGTTGACTCCGAATGTTGTGCCGTTGTGTTTG
ACGAATCATGCAAGACTCTATGTGACCGGTAACAATGGACGGGGAAACTA
TCGGGAATCGATTGAACTGTTAGAGGTAATTATCGATAATATCAGTTTAG
AGTCGTTTATGGAGTCGGTGGGATCTTATAATGGCAAGCCGATGTTGAAG
AAAGATAACATTAATCAAGCGCAAAAACGGGGTTTCCTTGATAATGATGG
CGACAGTCACAAGGCCAAAAGATCTAGATTTAAATAATTTTGTTTAATGA
AATAAATTTTGTTGTTGTCTTTAAAA
back to top

protein sequence of SMED30004622-orf-1

>SMED30004622-orf-1 ID=SMED30004622-orf-1|Name=SMED30004622-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1887bp
MLTIMANSCAQNVMHNTHDVNFCAYFMLKFKYKLSKPPVQSILLECVRKI
TETHPCNLRNLLEIYINNEIYGTPTAAAAASNITGTVGNPCPIAYVPQNK
SGPASVTFPAVYFRFPSESIKILGELLHEQISVLHHDIKPVKLFIRDICR
WIKLAYINSNGVYTPFASSSSNGALPDSLELHDLAQNLLVDRSNSEALTS
RMTDCTFKQLYVENMINIVCELQMLSVVRPTVREAFKERVDQEKKDYEAL
KSHFNTLRQIRYFTCKWLKNIFRIVESHVSADQMTNYIKQVLFLNVTRNN
DFTYIVDESYGIGDIWNNETDKMFLVRGLTEIPISDKLVQTLINLGFEKN
LCFRPSEIVNMISELIVRASASACTEIIPMNVSKCEAMINNMFACCSYDV
VLHESDPNLQIARTLAYKSSFWKVCQALVVMASHCMTTVGALLWSNFPTV
KNLMQIIITNNFDELSNDKEAMDKERQLCEIDSKKIIELESKISENSLDD
IVMVDANSSKLVNLLLFNLPQGPIRQPPSHIVESLKSINQIMKIGDRLSQ
CRNPDFLFEIVREQDQNKISSRKWIIDLVKKTSEHNLDCLPLLVLTEFIY
HDIYEKIINNLPVVSRNDTKDGSLKRLVHKLRSILCVTETDKRAMDKETL
KNIVGALSNSFFNRLSDSSAFIRKVARECLYILLLPISHPIKLMEFSLEF
VDTLKSIMNLNILQDNSLICSVAEALRETLKFETDIDVLHSYIDLFALMS
TGNHKEWLANTVETLSILILNRPIIADKLRTADNETLSKGKTSTTLICDS
LAEIFLAHINYTAYQAKVVPLEHREEAVMVTIKDKQFPVVVKVIQSQLAL
ACWGVSKSKKSKKLIDFWFCKVNTSNKYQLTSFTNIESNAPVTDIIPDWL
VNAAVHSGIVSVMSGILNHHVAVNGKISHSLTPALYFMSNDFIKSYLNYM
NSIVKSELTMIETWLSQCSEKLLSGMLATVTRMYSKVVKPAAAAAAVDIL
FKTTLETHHHHLVPKYQNLKTAKMPNLEPKIIVKPIENRRKIENPEITAR
MEIDDIDNVWSTVVQAYSIGTITECISKLLASKSIEIVKGIENLFKLLKD
PKTHSETLKILNKSDFKLMPLLKLSFRSYDQESFDFGMQSFRYLFKSYPH
IEKSSLWKMIYNLSLVQGLTVGNIGNVGNGGGGDVAVAVAVEMSDVDQYH
HHHHQLQWKSLAKSIMQGGTEDAGQIGPKIDQLTILGLGNGHFTESHFDL
LHKLLFSSHSLNQYSDYFMSDLLHQSNAFCLRQILHSILNRKTITQLNAS
RVLDFITACLHHPRLQYSVVLPVSNQYIWPQQNSEIDLSESELIALLNLV
VCEAEHLIEQNGPTAKCVNRSLVKRSDLIDICSSSKSLFQQRNLIINRFI
DWKSPHNEAVDKFGFALYCRLPNLISDKYQAATNNQQQQQQPMEMEREKE
ALTVTDVDRYNLKEIHRIGQRLLAGLVSPRNDLQDMAIQGCKALVTKHPK
LSLQLLPYMCALSDGALDGTDSWNEFRKKRSPVLYSNLLHLLEIMIPVSN
INSTTSTTIRGNMKIILFNFLRVLIRYRDEHKFFIGFVTRLVGFMEKMIP
LEKKLVEDIVSCCCEEEVKNENREEKENGDFIIEHATEITALSKIYPQFR
NLIVYVQKNKEICSSLLSASSTGELDDNRASQLPLLKLELLVNFRKKLRE
TLTGNGILMQIKDLDDVSRRDTNIIGLFLDDLRRLINHSMNDVRIAAVQV
LARYLNAFPEQANRIIGDFILSNMLKSVSYWSRPFVNLTLKTLCQTGMLT
PNVVPLCLTNHARLYVTGNNGRGNYRESIELLEVIIDNISLESFMESVGS
YNGKPMLKKDNINQAQKRGFLDNDGDSHKAKRSRFK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0032039integrator complex
Vocabulary: biological process
TermDefinition
GO:0034474U2 snRNA 3'-end processing
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR038902INTS1
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 233..253
IPR038902Integrator complex subunit 1PANTHERPTHR21224UNCHARACTERIZEDcoord: 27..1769