Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30004608
Length (bp)1094
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30004608) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30004608) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004608

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30004608SMESG000030766.1 dd_Smed_v4_85086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004608SMESG000030766.1 dd_Smed_v4_85086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004608SMESG000030766.1 dd_Smed_v4_85086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30004608SMESG000030766.1 dd_Smed_v4_85086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30004608SMESG000030766.1 dd_Smed_v6_85086_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004608SMESG000030766.1 dd_Smed_v6_85086_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30004608SMESG000030766.1 Contig51415newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30004608SMESG000030766.1 Contig51415uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testis primordiumSMED30004608SMESG000030766.1 Contig4434_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: CAMK4 (calcium/calmodulin dependent protein kinase IV [Source:HGNC Symbol;Acc:HGNC:1464])

HSP 1 Score: 170.629 bits (431), Expect = 3.378e-48
Identity = 93/277 (33.57%), Postives = 154/277 (55.60%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY--NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            YWI D      + + +++  E+ R      GA S+V  C  + T+K +A+ V+KK V       +IG+ L+L+  N++++ E+FET T I+++ E +TG +LF+   + G Y+E       KQIL  + YLHE  I+H ++K ENL+       +  LKI D   S I+ + +   ++   P  C PE+L        +DMW++G+  +ILLCG+EPFY E+  + ++R ++  +Y +   +  E + NA KD +  L+  DPK R+    AL+HPW
Sbjct:   32 YWI-DGSNRDALSDFFEVESELGR------GATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAP-DAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNA-KDLVRKLIVLDPKKRLTTFQALQHPW 299          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: CAMK4 (calcium/calmodulin dependent protein kinase IV [Source:HGNC Symbol;Acc:HGNC:1464])

HSP 1 Score: 170.629 bits (431), Expect = 3.378e-48
Identity = 93/277 (33.57%), Postives = 154/277 (55.60%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY--NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            YWI D      + + +++  E+ R      GA S+V  C  + T+K +A+ V+KK V       +IG+ L+L+  N++++ E+FET T I+++ E +TG +LF+   + G Y+E       KQIL  + YLHE  I+H ++K ENL+       +  LKI D   S I+ + +   ++   P  C PE+L        +DMW++G+  +ILLCG+EPFY E+  + ++R ++  +Y +   +  E + NA KD +  L+  DPK R+    AL+HPW
Sbjct:   32 YWI-DGSNRDALSDFFEVESELGR------GATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAP-DAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNA-KDLVRKLIVLDPKKRLTTFQALQHPW 299          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: PSKH1 (protein serine kinase H1 [Source:HGNC Symbol;Acc:HGNC:9529])

HSP 1 Score: 152.525 bits (384), Expect = 8.663e-42
Identity = 94/286 (32.87%), Postives = 148/286 (51.75%), Query Frame = 2
Query:   47 RRKKMDCYWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKV--GYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHY--DIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFNC-ESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            RR ++  Y  K    +  V   YDI   I R      G+ S V    +R TR+ +A+ +I+ K   G     +++ +  ++   N+++++EVFET   + ++ E  TG +LF+     G +TE    R+ + +L G+RYLH   I H ++K ENL+    G  + I+ I D   ++      D    +    P    PEVL+ +  T ++DMWA+GV  +ILL G  PF  +  T LYR ++   YSY+     S SN  KDF++ LL  DP +RM  + AL+HPW
Sbjct:   79 RRARVAKYRAK---FDPRVTAKYDIKALIGR------GSFSRVVRVEHRATRQPYAIKMIETKYREGREVCESELRVLRRVRHANIIQLVEVFETQERVYMVMELATGGELFDRIIAKGSFTERDATRVLQMVLDGVRYLHALGITHRDLKPENLLYYHPGTDSKII-ITDFGLASARKKGDDCLMKTTCGTPEYIAPEVLVRKPYTNSVDMWALGVIAYILLSGTMPFEDDNRTRLYRQILRGKYSYSGEPWPSVSNLAKDFIDRLLTVDPGARMTALQALRHPW 354          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: CAMK1 (calcium/calmodulin dependent protein kinase I [Source:HGNC Symbol;Acc:HGNC:1459])

HSP 1 Score: 145.591 bits (366), Expect = 1.441e-39
Identity = 83/271 (30.63%), Postives = 145/271 (53.51%), Query Frame = 2
Query:   89 KNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDN---NDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            + +++ +IYD     FR      GA S V    ++ T+K  A+  I K+     +    N+I +  K+   N++ + +++E+  H+ +I + ++G +LF+   + G YTE    R+  Q+L  ++YLH+  I+H ++K ENL+     E + I+ I D   S +        +    P    PEVL  +  + A+D W+IGV  +ILLCGY PFY E   +L+  ++ A+Y ++    +  S++ KDF+ HL++ DP+ R     AL+HPW
Sbjct:   12 QAEDIRDIYD-----FRDVLGT-GAFSEVILAEDKRTQKLVAIKCIAKEALEGKEGSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIM-ISDFGLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPW 275          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: CAMK1G (calcium/calmodulin dependent protein kinase IG [Source:HGNC Symbol;Acc:HGNC:14585])

HSP 1 Score: 144.436 bits (363), Expect = 2.492e-38
Identity = 83/247 (33.60%), Postives = 132/247 (53.44%), Query Frame = 2
Query:  158 GALSVVSACYNRTTRKSFAVNVIKKKVGYCPDN--NDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            GA S V     R T K FA+  IKK   +   +  N+I +  K+   N++ + +++E+ TH  ++ + ++G +LF+   + G YTE     + +Q+LS ++YLHE  I+H ++K ENL+ +   E + I+ I D   S +    I   +    P    PEVL  +  + A+D W+IGV  +ILLCGY PFY E  ++L+  +    Y +     +  S + KDF+ HLL+ DP  R     AL HPW
Sbjct:   32 GAFSEVFLVKQRLTGKLFALKCIKKSPAFRDSSLENEIAVLKKIKHENIVTLEDIYESTTHYYLVMQLVSGGELFDRILERGVYTEKDASLVIQQVLSAVKYLHENGIVHRDLKPENLLYLTPEENSKIM-ITDFGLSKMEQNGIMS-TACGTPGYVAPEVLAQKPYSKAVDCWSIGVITYILLCGYPPFYEETESKLFEKIKEGYYEFESPFWDDISESAKDFICHLLEKDPNERYTCEKALSHPW 276          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: cmk-1 (Calcium/calmodulin-dependent protein kinase type 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXJ0])

HSP 1 Score: 131.724 bits (330), Expect = 4.438e-35
Identity = 74/249 (29.72%), Postives = 130/249 (52.21%), Query Frame = 2
Query:  158 GALSVVSACYNRT-TRKSFAVNVIKKKVGYCPDN---NDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            GA S V    +++   + +AV  I KK     +    N+I +  KL   N++++ + ++    + ++ E +TG +LF+     G YTE     + +Q+L  + ++H+  ++H ++K ENL+  +  E + I+ I D   S      +   +    P    PEVL  +    A+D+W+IGV  +ILLCGY PFY E    L+  +I  +Y ++    +  S++ KDF+ HL+  DP++R    +AL HPW
Sbjct:   31 GAFSKVFLAESKSDAGQMYAVKCIDKKALKGKEESLENEIKVLRKLRHNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIRQVLEAVGFMHDNGVVHRDLKPENLLYYNQDEDSKIM-ISDFGLSKTEDSGVM-ATACGTPGYVAPEVLQQKPYGKAVDVWSIGVIAYILLCGYPPFYDESDANLFAQIIKGEYEFDAPYWDQISDSAKDFITHLMCCDPEARFTCQDALSHPW 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: R06A10.4 (pep chromosome:WBcel235:I:1089666:1095796:-1 gene:WBGene00019911.1 transcript:R06A10.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R06A10.4)

HSP 1 Score: 122.479 bits (306), Expect = 2.954e-31
Identity = 75/255 (29.41%), Postives = 128/255 (50.20%), Query Frame = 2
Query:  140 CPFQV-----EGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            C ++V     +G+ S V    +R TRK FAV V+    G    NN++ I  +L+   ++R+ EVF++ + + ++ +  +G ++++     G Y+E +     K +L+G+ YLH   + H ++K ENL+  DS     +L     +       +         P    PE+LL    T  +DMWA+GV  +IL+ G  PF  +  + LY  +ITA+Y Y     S S   K F++ LL+ +   R++   A+KH W
Sbjct:   69 CKYEVLAVVGKGSFSQVLRVQHRVTRKYFAVKVVNGDCGAV--NNELNILSRLSHPFVIRLEEVFKSSSKLFIVMQMASGGEMYDRVVAKGRYSEEEARNALKMLLTGLTYLHSIRVTHRDLKPENLLYADSRPEARLLITDFGLAYQATKPNETMTETCGTPEYIAPELLLRVPYTQKVDMWAVGVIAYILMSGIMPFDDDCRSRLYTHIITANYVYYPQFWSGSELAKQFVDSLLETNSVERLSSSAAMKHEW 321          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 114.775 bits (286), Expect = 3.546e-29
Identity = 83/299 (27.76%), Postives = 134/299 (44.82%), Query Frame = 2
Query:  113 YDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPD----NNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPWNEICIMKNQPLESIYQQYVKCVGSIEDRMHEKVMD 994
            YD+  E+ +      GA SVV  C ++TT   FA  +I  K     D      +  I  KL   N++R+ +  +  +   ++ + +TG +LF        Y+E+      +QIL  I Y H   I+H ++K ENL++    +G  + K+ D   +  ++           P    PEVL     +  +D+WA GV ++ILL GY PF+ E    LY  +    Y Y +   ++ +   K  ++ +L  +PK R+    ALK PW  IC  +        Q  V C+     R   KV+D
Sbjct:   12 YDVKEELGK------GAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAV-KLADFGLAIEVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPW--ICNRERVASAIHRQDTVDCLKKFNARRKLKVVD 301          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 114.775 bits (286), Expect = 3.546e-29
Identity = 83/299 (27.76%), Postives = 134/299 (44.82%), Query Frame = 2
Query:  113 YDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPD----NNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPWNEICIMKNQPLESIYQQYVKCVGSIEDRMHEKVMD 994
            YD+  E+ +      GA SVV  C ++TT   FA  +I  K     D      +  I  KL   N++R+ +  +  +   ++ + +TG +LF        Y+E+      +QIL  I Y H   I+H ++K ENL++    +G  + K+ D   +  ++           P    PEVL     +  +D+WA GV ++ILL GY PF+ E    LY  +    Y Y +   ++ +   K  ++ +L  +PK R+    ALK PW  IC  +        Q  V C+     R   KV+D
Sbjct:   12 YDVKEELGK------GAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAV-KLADFGLAIEVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPW--ICNRERVASAIHRQDTVDCLKKFNARRKLKVVD 301          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 114.775 bits (286), Expect = 3.546e-29
Identity = 83/299 (27.76%), Postives = 134/299 (44.82%), Query Frame = 2
Query:  113 YDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPD----NNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPWNEICIMKNQPLESIYQQYVKCVGSIEDRMHEKVMD 994
            YD+  E+ +      GA SVV  C ++TT   FA  +I  K     D      +  I  KL   N++R+ +  +  +   ++ + +TG +LF        Y+E+      +QIL  I Y H   I+H ++K ENL++    +G  + K+ D   +  ++           P    PEVL     +  +D+WA GV ++ILL GY PF+ E    LY  +    Y Y +   ++ +   K  ++ +L  +PK R+    ALK PW  IC  +        Q  V C+     R   KV+D
Sbjct:   12 YDVKEELGK------GAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAV-KLADFGLAIEVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPW--ICNRERVASAIHRQDTVDCLKKFNARRKLKVVD 301          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0333670)

HSP 1 Score: 122.865 bits (307), Expect = 2.074e-31
Identity = 81/284 (28.52%), Postives = 142/284 (50.00%), Query Frame = 2
Query:   53 KKMDCYWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNR-TTRKSFAVNVIKKKVGYCPDN---NDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            KK     +K+  K  ++EE Y++ H +        GA S V    ++ +  + FAV +I KK     +    N+I +  +L   N+++++E +E  + + ++ E +TG +LF+   + G YTE     + +QIL  + Y+HE  ++H ++K ENL+     + + I+ I D   S +    I   +    P    PEVL  +    A+D+W+IGV  +ILLCGY PFY E    L+  ++  D+ ++    +  S + K F+ +L+    + R     AL H W
Sbjct:   11 KKAKAKDLKELNKQVSIEEKYNL-HGLLGT-----GAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIRVLRRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIM-ISDFGLSKMEDSGIM-ATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAW 286          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CaMKII (gene:FBgn0264607 transcript:FBtr0333675)

HSP 1 Score: 114.39 bits (285), Expect = 8.249e-28
Identity = 78/293 (26.62%), Postives = 134/293 (45.73%), Query Frame = 2
Query:  113 YDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPD----NNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYR-LSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPWNEICIMKNQPLESIYQQYVKCVGSIEDR 973
            YDI  E+ +      GA S+V  C  ++T   FA  +I  K     D      +  I  KL+  N++R+ +  +   +  ++ + +TG +LF        Y+E+      +QIL  + + H+  ++H ++K ENL++    +G  + K+ D   +  +  D          P    PEVL  +    ++D+WA GV ++ILL GY PF+ E    LY  +    Y Y +   ++ +   K+ +N +L  +P  R+    ALKHPW  IC  +        Q+ V C+     R
Sbjct:   14 YDIKEELGK------GAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAV-KLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPW--ICQRERVASVVHRQETVDCLKKFNAR 297          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CaMKII (gene:FBgn0264607 transcript:FBtr0300377)

HSP 1 Score: 114.39 bits (285), Expect = 8.254e-28
Identity = 78/293 (26.62%), Postives = 134/293 (45.73%), Query Frame = 2
Query:  113 YDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPD----NNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYR-LSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPWNEICIMKNQPLESIYQQYVKCVGSIEDR 973
            YDI  E+ +      GA S+V  C  ++T   FA  +I  K     D      +  I  KL+  N++R+ +  +   +  ++ + +TG +LF        Y+E+      +QIL  + + H+  ++H ++K ENL++    +G  + K+ D   +  +  D          P    PEVL  +    ++D+WA GV ++ILL GY PF+ E    LY  +    Y Y +   ++ +   K+ +N +L  +P  R+    ALKHPW  IC  +        Q+ V C+     R
Sbjct:   14 YDIKEELGK------GAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAV-KLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPW--ICQRERVASVVHRQETVDCLKKFNAR 297          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CaMKII (gene:FBgn0264607 transcript:FBtr0089217)

HSP 1 Score: 114.39 bits (285), Expect = 8.254e-28
Identity = 78/293 (26.62%), Postives = 134/293 (45.73%), Query Frame = 2
Query:  113 YDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPD----NNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYR-LSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPWNEICIMKNQPLESIYQQYVKCVGSIEDR 973
            YDI  E+ +      GA S+V  C  ++T   FA  +I  K     D      +  I  KL+  N++R+ +  +   +  ++ + +TG +LF        Y+E+      +QIL  + + H+  ++H ++K ENL++    +G  + K+ D   +  +  D          P    PEVL  +    ++D+WA GV ++ILL GY PF+ E    LY  +    Y Y +   ++ +   K+ +N +L  +P  R+    ALKHPW  IC  +        Q+ V C+     R
Sbjct:   14 YDIKEELGK------GAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAV-KLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPW--ICQRERVASVVHRQETVDCLKKFNAR 297          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CaMKII (gene:FBgn0264607 transcript:FBtr0089218)

HSP 1 Score: 114.39 bits (285), Expect = 8.254e-28
Identity = 78/293 (26.62%), Postives = 134/293 (45.73%), Query Frame = 2
Query:  113 YDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPD----NNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYR-LSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPWNEICIMKNQPLESIYQQYVKCVGSIEDR 973
            YDI  E+ +      GA S+V  C  ++T   FA  +I  K     D      +  I  KL+  N++R+ +  +   +  ++ + +TG +LF        Y+E+      +QIL  + + H+  ++H ++K ENL++    +G  + K+ D   +  +  D          P    PEVL  +    ++D+WA GV ++ILL GY PF+ E    LY  +    Y Y +   ++ +   K+ +N +L  +P  R+    ALKHPW  IC  +        Q+ V C+     R
Sbjct:   14 YDIKEELGK------GAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAV-KLADFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVNPNKRITAAEALKHPW--ICQRERVASVVHRQETVDCLKKFNAR 297          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: si:ch73-60h1.1 (si:ch73-60h1.1 [Source:ZFIN;Acc:ZDB-GENE-140106-152])

HSP 1 Score: 182.57 bits (462), Expect = 4.312e-53
Identity = 99/277 (35.74%), Postives = 158/277 (57.04%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY--NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            YW+  S ++  VE+ Y++G E+ R      GA SVV  C  + T K +AV V+KK +       +IG+ L+L+  N++R+ E+FET T I +I E +TG +LF+   + G Y+E     + KQIL  + YLHE  ++H ++K ENL+  D    +  LKI D   S I+   +   ++   P  C PE+L        +DMW++GV ++ILLCG+EPF+ ++  + +Y  ++  DY +   +  E + NA KD +N L+  DP  R+ +  AL+HPW
Sbjct:   13 YWVDGSRRDATVEDFYNMGPELGR------GATSVVLRCEEKQTEKPYAVKVLKKTIDKKIVRTEIGVLLRLSHPNIIRLKEIFETETEIFLILELVTGGELFDRIVERGYYSERDAAHVIKQILEAVAYLHENGVVHRDLKPENLLYADLSI-DAPLKIADFGLSKIIDEQVTMKTVCGTPGYCAPEILRGNAYGPEVDMWSVGVILYILLCGFEPFFDQRGDQYMYSRILNCDYEFVSPWWDEVSLNA-KDLVNKLIVLDPHKRLTVKQALEHPW 281          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:ZFIN;Acc:ZDB-GENE-050417-76])

HSP 1 Score: 168.318 bits (425), Expect = 1.739e-48
Identity = 90/276 (32.61%), Postives = 154/276 (55.80%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            YWI D  K + + + Y++  E+ R      GA SVV  C  + T+K +AV ++KK V       +IG+ L+L+  N++++ E+FET   I+++ E +TG +LF+   + G Y+E       KQ+L  + YLHE  ++H ++K ENL+   S   +  LKI D   S I+   +   ++   P  C PE+L        +DMW++GV  +ILLCG+EPF+ ++  + +++ ++  +Y + +   ++ S   KD +  L+  DPK R+    AL+HPW
Sbjct:   15 YWI-DGSKKETLADFYELESELGR------GATSVVYRCRQKGTQKHYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPAEISLVLELVTGGELFDRVVEKGYYSERDAADAVKQVLEAVAYLHENGVVHRDLKPENLLYATSAP-DAPLKIADFGLSKIVDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGVITYILLCGFEPFFDDRGDQYMFKRILNCEYEFVSPWWDNVSLNAKDLVKKLIVQDPKKRLTTQQALQHPW 282          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:ZFIN;Acc:ZDB-GENE-050417-76])

HSP 1 Score: 168.318 bits (425), Expect = 1.739e-48
Identity = 90/276 (32.61%), Postives = 154/276 (55.80%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            YWI D  K + + + Y++  E+ R      GA SVV  C  + T+K +AV ++KK V       +IG+ L+L+  N++++ E+FET   I+++ E +TG +LF+   + G Y+E       KQ+L  + YLHE  ++H ++K ENL+   S   +  LKI D   S I+   +   ++   P  C PE+L        +DMW++GV  +ILLCG+EPF+ ++  + +++ ++  +Y + +   ++ S   KD +  L+  DPK R+    AL+HPW
Sbjct:   15 YWI-DGSKKETLADFYELESELGR------GATSVVYRCRQKGTQKHYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPAEISLVLELVTGGELFDRVVEKGYYSERDAADAVKQVLEAVAYLHENGVVHRDLKPENLLYATSAP-DAPLKIADFGLSKIVDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGVITYILLCGFEPFFDDRGDQYMFKRILNCEYEFVSPWWDNVSLNAKDLVKKLIVQDPKKRLTTQQALQHPW 282          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: pnck (pregnancy up-regulated nonubiquitous CaM kinase [Source:ZFIN;Acc:ZDB-GENE-081105-127])

HSP 1 Score: 157.532 bits (397), Expect = 7.892e-45
Identity = 89/276 (32.25%), Postives = 148/276 (53.62%), Query Frame = 2
Query:   74 IKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDN---NDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            ++D  K  ++  +Y++  ++       EG+ S V    +R T+K  AV  I+K+     ++   N++ +  ++N  N++ + E FET T + ++   LTG +L N   + G YTE    R+  Q+L  ++YLH+  ++H ++K ENLI     E + I+ I D   S +        +    P+   PE+L  +     +D+WAIGV  FILLCGY PFY +  T+LY+ +I A+Y ++       S++ KDF+ HLL+ DP  R N   A +HPW
Sbjct:    4 LRDLRKKDDINAVYELKEKLG------EGSFSEVRVAQHRCTQKLVAVKCIRKRALKGKESMLENEVAVLRRINHENIVSLEETFETPTKLYLVMTLLTGGELLNRILERGSYTEKDASRVIYQVLQAVKYLHQLGVVHRDLKPENLIFETPLEDSKIV-ISDFGLSKMEEQGALS-TACGTPAYVAPELLQQKTYGKEVDLWAIGVITFILLCGYPPFYDDNDTQLYKLIIKAEYEFDSPYWNDISDSAKDFIVHLLQKDPAKRFNCEQASQHPW 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: camk1b (calcium/calmodulin-dependent protein kinase Ib [Source:ZFIN;Acc:ZDB-GENE-141014-1])

HSP 1 Score: 156.762 bits (395), Expect = 6.537e-44
Identity = 89/271 (32.84%), Postives = 146/271 (53.87%), Query Frame = 2
Query:   89 KNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDN---NDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            K  N+++IYD   E+        GA S V     + TRK  AV  I KK     +N   N+I +  K+   N++ + ++FE+ +H+ ++ + ++G +LF+   + G YTE    ++ +QIL  ++YLH+  I+H ++K ENL+     E + I+ I D   S I        +    P    PEVL  +  + A+D W+IGV  +ILLCGY PFY E   +L+  ++ A+Y ++    +  S++ KDF+ HL++ DP  R     AL+HPW
Sbjct:   13 KTANIKDIYDF-KEVLGT-----GAFSEVMLAEEKRTRKLVAVKCIAKKALEGKENSIENEIAVLHKIKHANIVSLEDIFESKSHLYLVMQLVSGGELFDRIVEKGFYTEKDASKLIQQILDAVKYLHDMGIVHRDLKPENLLYYSMDEESKIM-ISDFGLSKIEGSGSVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILRAEYEFDSPYWDDISDSAKDFIVHLMEKDPNQRYTCEQALQHPW 276          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: foxf2 (forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646])

HSP 1 Score: 167.933 bits (424), Expect = 9.715e-49
Identity = 93/276 (33.70%), Postives = 152/276 (55.07%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            YWI  S K+  +   Y++  E+ R      GA SVV  C  + T++ +AV ++KK V       +IG+ L+L+  N++++ E+FET T I+++ E +TG +LF+   + G Y+E       KQIL  + YLHE  I+H ++K ENL+       +  LKI D   S I+   +   ++   P  C PE+L        +DMW++G+  +ILLCG+EPFY E+  + +++ ++  DY + +   +  S   KD +  L+  DPK R+    AL+HPW
Sbjct:   10 YWIDGSNKD-TLAHYYELESELGR------GATSVVYRCRQKGTQRPYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAP-DAPLKIADFGLSKIVDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQYMFKRILNCDYDFVSPWWDDVSLNAKDLVKKLIVFDPKKRLTTQQALQHPW 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: foxf2 (forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646])

HSP 1 Score: 167.933 bits (424), Expect = 4.897e-48
Identity = 93/276 (33.70%), Postives = 152/276 (55.07%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            YWI  S K+  +   Y++  E+ R      GA SVV  C  + T++ +AV ++KK V       +IG+ L+L+  N++++ E+FET T I+++ E +TG +LF+   + G Y+E       KQIL  + YLHE  I+H ++K ENL+       +  LKI D   S I+   +   ++   P  C PE+L        +DMW++G+  +ILLCG+EPFY E+  + +++ ++  DY + +   +  S   KD +  L+  DPK R+    AL+HPW
Sbjct:   22 YWIDGSNKD-TLAHYYELESELGR------GATSVVYRCRQKGTQRPYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAP-DAPLKIADFGLSKIVDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQYMFKRILNCDYDFVSPWWDDVSLNAKDLVKKLIVFDPKKRLTTQQALQHPW 289          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: foxf2 (forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646])

HSP 1 Score: 167.548 bits (423), Expect = 5.008e-48
Identity = 93/276 (33.70%), Postives = 152/276 (55.07%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            YWI  S K+  +   Y++  E+ R      GA SVV  C  + T++ +AV ++KK V       +IG+ L+L+  N++++ E+FET T I+++ E +TG +LF+   + G Y+E       KQIL  + YLHE  I+H ++K ENL+       +  LKI D   S I+   +   ++   P  C PE+L        +DMW++G+  +ILLCG+EPFY E+  + +++ ++  DY + +   +  S   KD +  L+  DPK R+    AL+HPW
Sbjct:   18 YWIDGSNKD-TLAHYYELESELGR------GATSVVYRCRQKGTQRPYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAP-DAPLKIADFGLSKIVDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQYMFKRILNCDYDFVSPWWDDVSLNAKDLVKKLIVFDPKKRLTTQQALQHPW 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: foxf2 (forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646])

HSP 1 Score: 167.548 bits (423), Expect = 1.016e-47
Identity = 93/276 (33.70%), Postives = 152/276 (55.07%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            YWI  S K+  +   Y++  E+ R      GA SVV  C  + T++ +AV ++KK V       +IG+ L+L+  N++++ E+FET T I+++ E +TG +LF+   + G Y+E       KQIL  + YLHE  I+H ++K ENL+       +  LKI D   S I+   +   ++   P  C PE+L        +DMW++G+  +ILLCG+EPFY E+  + +++ ++  DY + +   +  S   KD +  L+  DPK R+    AL+HPW
Sbjct:    9 YWIDGSNKD-TLAHYYELESELGR------GATSVVYRCRQKGTQRPYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAP-DAPLKIADFGLSKIVDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQYMFKRILNCDYDFVSPWWDDVSLNAKDLVKKLIVFDPKKRLTTQQALQHPW 276          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: foxf2 (forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646])

HSP 1 Score: 167.548 bits (423), Expect = 1.016e-47
Identity = 93/276 (33.70%), Postives = 152/276 (55.07%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            YWI  S K+  +   Y++  E+ R      GA SVV  C  + T++ +AV ++KK V       +IG+ L+L+  N++++ E+FET T I+++ E +TG +LF+   + G Y+E       KQIL  + YLHE  I+H ++K ENL+       +  LKI D   S I+   +   ++   P  C PE+L        +DMW++G+  +ILLCG+EPFY E+  + +++ ++  DY + +   +  S   KD +  L+  DPK R+    AL+HPW
Sbjct:    9 YWIDGSNKD-TLAHYYELESELGR------GATSVVYRCRQKGTQRPYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAP-DAPLKIADFGLSKIVDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQYMFKRILNCDYDFVSPWWDDVSLNAKDLVKKLIVFDPKKRLTTQQALQHPW 276          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Camk4 (calcium/calmodulin-dependent protein kinase IV [Source:MGI Symbol;Acc:MGI:88258])

HSP 1 Score: 170.629 bits (431), Expect = 2.540e-48
Identity = 93/277 (33.57%), Postives = 154/277 (55.60%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY--NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            YWI D      + + +++  E+ R      GA S+V  C  + T+K +A+ V+KK V       +IG+ L+L+  N++++ E+FET T I+++ E +TG +LF+   + G Y+E       KQIL  + YLHE  I+H ++K ENL+       +  LKI D   S I+ + +   ++   P  C PE+L        +DMW++G+  +ILLCG+EPFY E+  + ++R ++  +Y +   +  E + NA KD +  L+  DPK R+    AL+HPW
Sbjct:   28 YWI-DGSNRDPLGDFFEVESELGR------GATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAP-DAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNA-KDLVKKLIVLDPKKRLTTFQALQHPW 295          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Camk4 (calcium/calmodulin-dependent protein kinase IV [Source:MGI Symbol;Acc:MGI:88258])

HSP 1 Score: 170.629 bits (431), Expect = 2.540e-48
Identity = 93/277 (33.57%), Postives = 154/277 (55.60%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY--NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            YWI D      + + +++  E+ R      GA S+V  C  + T+K +A+ V+KK V       +IG+ L+L+  N++++ E+FET T I+++ E +TG +LF+   + G Y+E       KQIL  + YLHE  I+H ++K ENL+       +  LKI D   S I+ + +   ++   P  C PE+L        +DMW++G+  +ILLCG+EPFY E+  + ++R ++  +Y +   +  E + NA KD +  L+  DPK R+    AL+HPW
Sbjct:   28 YWI-DGSNRDPLGDFFEVESELGR------GATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAP-DAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNA-KDLVKKLIVLDPKKRLTTFQALQHPW 295          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Camk4 (calcium/calmodulin-dependent protein kinase IV [Source:MGI Symbol;Acc:MGI:88258])

HSP 1 Score: 170.629 bits (431), Expect = 2.540e-48
Identity = 93/277 (33.57%), Postives = 154/277 (55.60%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY--NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            YWI D      + + +++  E+ R      GA S+V  C  + T+K +A+ V+KK V       +IG+ L+L+  N++++ E+FET T I+++ E +TG +LF+   + G Y+E       KQIL  + YLHE  I+H ++K ENL+       +  LKI D   S I+ + +   ++   P  C PE+L        +DMW++G+  +ILLCG+EPFY E+  + ++R ++  +Y +   +  E + NA KD +  L+  DPK R+    AL+HPW
Sbjct:   28 YWI-DGSNRDPLGDFFEVESELGR------GATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAP-DAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNA-KDLVKKLIVLDPKKRLTTFQALQHPW 295          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Pskh1 (protein serine kinase H1 [Source:MGI Symbol;Acc:MGI:3528383])

HSP 1 Score: 151.754 bits (382), Expect = 1.434e-41
Identity = 94/286 (32.87%), Postives = 147/286 (51.40%), Query Frame = 2
Query:   47 RRKKMDCYWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKV--GYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHY--DIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            RR ++  Y  K    +  V   YDI   I R      G+ S V    +R TR+ +A+ +I+ K   G     +++ +  ++   N+++++EVFET   + ++ E  TG +LF+     G +TE    R+ + +L G+RYLH   I H ++K ENL+    G  + I+ I D   ++      D    +    P    PEVL+ +  T ++DMWA+GV  +ILL G  PF  +  T LYR ++   YSY      S SN  KDF++ LL  DP +RM  + AL+HPW
Sbjct:   79 RRARVAKYRAK---FDPRVTAKYDIKALIGR------GSFSRVVRVEHRATRQPYAIKMIETKYREGREVCESELRVLRRVRHANIIQLVEVFETQERVYMVMELATGGELFDRIIAKGSFTERDATRVLQMVLDGVRYLHALGITHRDLKPENLLYYHPGTDSKII-ITDFGLASARKKGDDCLMKTTCGTPEYIAPEVLVRKPYTNSVDMWALGVIAYILLSGTMPFEDDNRTRLYRQILRGKYSYLGEPWPSVSNLAKDFIDRLLTVDPGARMTALQALRHPW 354          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Camk1 (calcium/calmodulin-dependent protein kinase I [Source:MGI Symbol;Acc:MGI:1098535])

HSP 1 Score: 147.132 bits (370), Expect = 2.899e-40
Identity = 84/271 (31.00%), Postives = 145/271 (53.51%), Query Frame = 2
Query:   89 KNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDN---NDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            + +++ +IYD     FR      GA S V    ++ T+K  A+  I KK     +    N+I +  K+   N++ + +++E+  H+ +I + ++G +LF+   + G YTE    R+  Q+L  ++YLH+  I+H ++K ENL+     E + I+ I D   S +        +    P    PEVL  +  + A+D W+IGV  +ILLCGY PFY E   +L+  ++ A+Y ++    +  S++ KDF+ HL++ DP+ R     AL+HPW
Sbjct:   12 QAEDIRDIYD-----FRDVLGT-GAFSEVILAEDKRTQKLVAIKCIAKKALEGKEGSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIM-ISDFGLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPW 275          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P13234|KCC4_RAT (Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus OX=10116 GN=Camk4 PE=1 SV=3)

HSP 1 Score: 172.94 bits (437), Expect = 2.701e-48
Identity = 94/277 (33.94%), Postives = 155/277 (55.96%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY--NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            YWI D  K   + + +++  E+ R      GA S+V  C  + T+K +A+ V+KK V       +IG+ L+L+  N++++ E+FET T I+++ E +TG +LF+   + G Y+E       KQIL  + YLHE  I+H ++K ENL+       +  LKI D   S I+ + +   ++   P  C PE+L        +DMW++G+  +ILLCG+EPFY E+  + ++R ++  +Y +   +  E + NA KD +  L+  DPK R+    AL+HPW
Sbjct:   28 YWI-DGSKRDPLSDFFEVESELGR------GATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAP-DAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNA-KDLVKKLIVLDPKKRLTTFQALQHPW 295          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q16566|KCC4_HUMAN (Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens OX=9606 GN=CAMK4 PE=1 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.622e-47
Identity = 93/277 (33.57%), Postives = 154/277 (55.60%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY--NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            YWI D      + + +++  E+ R      GA S+V  C  + T+K +A+ V+KK V       +IG+ L+L+  N++++ E+FET T I+++ E +TG +LF+   + G Y+E       KQIL  + YLHE  I+H ++K ENL+       +  LKI D   S I+ + +   ++   P  C PE+L        +DMW++G+  +ILLCG+EPFY E+  + ++R ++  +Y +   +  E + NA KD +  L+  DPK R+    AL+HPW
Sbjct:   32 YWI-DGSNRDALSDFFEVESELGR------GATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAP-DAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNA-KDLVRKLIVLDPKKRLTTFQALQHPW 299          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P08414|KCC4_MOUSE (Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus OX=10090 GN=Camk4 PE=1 SV=2)

HSP 1 Score: 169.474 bits (428), Expect = 4.875e-47
Identity = 93/277 (33.57%), Postives = 154/277 (55.60%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY--NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            YWI D      + + +++  E+ R      GA S+V  C  + T+K +A+ V+KK V       +IG+ L+L+  N++++ E+FET T I+++ E +TG +LF+   + G Y+E       KQIL  + YLHE  I+H ++K ENL+       +  LKI D   S I+ + +   ++   P  C PE+L        +DMW++G+  +ILLCG+EPFY E+  + ++R ++  +Y +   +  E + NA KD +  L+  DPK R+    AL+HPW
Sbjct:   28 YWI-DGSNRDPLGDFFEVESELGR------GATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDARDAVKQILEAVAYLHENGIVHRDLKPENLLYATPAP-DAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNA-KDLVKKLIVLDPKKRLTTFQALQHPW 295          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P25323|MYLKA_DICDI (Myosin light chain kinase A OS=Dictyostelium discoideum OX=44689 GN=mlkA PE=1 SV=2)

HSP 1 Score: 158.303 bits (399), Expect = 1.688e-44
Identity = 91/268 (33.96%), Postives = 149/268 (55.60%), Query Frame = 2
Query:  101 VEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVI-KKKVGYCPDNN---DIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            VE+IY+   E+ R      GA S+V    N+ T++ +A+ VI K ++G   + N   ++ I  K+N  N++ + E+F+T   + ++ E +TG +LF+   + G Y+E+    + K+I+S + YLH  NI+H ++K ENL++  S E +L + I D   S I+   +   +    PS   PEVL +      +DMW+IGV  +ILLCG+ PFY + + E++  ++ A+Y +        S   KDF+  LL  D   R+N  NAL HPW
Sbjct:    4 VEKIYEFKEELGR------GAFSIVYLGENKQTKQRYAIKVINKSELGKDYEKNLKMEVDILKKVNHPNIIALKELFDTPEKLYLVMELVTGGELFDKIVEKGSYSEADAANLVKKIVSAVGYLHGLNIVHRDLKPENLLL-KSKENHLEVAIADFGLSKIIGQTLVMQTACGTPSYVAPEVLNATGYDKEVDMWSIGVITYILLCGFPPFYGDTVPEIFEQIMEANYEFPEEYWGGISKEAKDFIGKLLVVDVSKRLNATNALNHPW 264          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0V7M1|KPSH1_BOVIN (Serine/threonine-protein kinase H1 OS=Bos taurus OX=9913 GN=PSKH1 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 3.751e-41
Identity = 94/286 (32.87%), Postives = 148/286 (51.75%), Query Frame = 2
Query:   47 RRKKMDCYWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKV--GYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHY--DIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFNC-ESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            RR ++  Y  K    +  V   YDI   I R      G+ S V    +R TR+ +A+ +I+ K   G     +++ +  ++   N+++++EVFET   + ++ E  TG +LF+     G +TE    R+ + +L G+RYLH   I H ++K ENL+    G  + I+ I D   ++      D    +    P    PEVL+ +  T ++DMWA+GV  +ILL G  PF  +  T LYR ++   YSY+     S SN  KDF++ LL  DP +RM  + AL+HPW
Sbjct:   79 RRARVAKYRAK---FDPRVTAKYDIKALIGR------GSFSRVVRVEHRATRQPYAIKMIETKYREGREVCESELRVLRRVRHANIIQLVEVFETQERVYMVMELATGGELFDRIIAKGSFTERDATRVLQMVLDGVRYLHALGITHRDLKPENLLYYHPGTDSKII-ITDFGLASARKKGDDCLMKTTCGTPEYIAPEVLVRKPYTNSVDMWALGVIAYILLSGTMPFEDDNRTRLYRQILRGKYSYSGEPWPSVSNLAKDFIDRLLTVDPGARMTALQALRHPW 354          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A267GGV5 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011758g1 PE=3 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 4.128e-59
Identity = 102/275 (37.09%), Postives = 164/275 (59.64%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            YW+K+SIK+   E +Y++G E+ R      GA S+V  C    + + +AV +I+KKV     + +IG+ L ++  N++R+ E+FET +HI ++ EH+TG +LF+     G Y+E       +Q+L  ++YLHE +IIH ++K ENL + +S   +  LK+ D   S I+  D+  L++   P  C PEVLLS+     +DMW++GV  +ILLCGYEPFY E  +++YR ++   Y ++    +  S   KD ++ L+  DP  R+    AL+HPW
Sbjct:    5 YWVKESIKDTPFESVYELGSELGR------GATSIVYECRLIGSNQKWAVKIIQKKVDKKIVSTEIGVLLSVSHPNIIRLKELFETASHIYMVLEHVTGGELFDRIVSRGSYSEKDAAICVQQLLQALKYLHEKDIIHRDLKPENL-LYESESDDACLKVADFGLSKIVSDDVQTLTVCGTPGYCAPEVLLSRDYGTPVDMWSVGVITYILLCGYEPFYAENESDMYRRILRGQYEFDSPWWDEISRNAKDLVSRLMLLDPAKRLTASQALRHPW 272          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1S3I026 (calcium/calmodulin-dependent protein kinase type IV OS=Lingula unguis OX=7574 GN=LOC106159758 PE=3 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 3.042e-56
Identity = 103/280 (36.79%), Postives = 160/280 (57.14%), Query Frame = 2
Query:   53 KKMDCYWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            +KM  YWI+DSIK++  E+ Y+I  E+ +      GA SVV  C  +   + +AV ++ KKV       + G+ LKL   N++R+ E++ET T I ++ E +TG +LF+     G Y+E       KQ+L  +++LH+ ++ H ++K ENL+  DS + +L LK+ D   S I   +I   ++   P  C PEVL     + A+DMW++GV  +ILLCGYEPFY +   E+Y+ +I  DY ++    +  S   KD +  LLK DP  R+    AL+HPW
Sbjct:    4 EKMQDYWIEDSIKDKKFEDYYNIVKELGK------GATSVVYRCEQKGLAQPWAVKILTKKVDKKIVRTECGVLLKLKHSNVIRLKEIYETPTQIYLVLELVTGGELFDRIVTRGCYSEKDAANCVKQMLDAVKFLHQNDVAHRDLKPENLLYQDSSDESL-LKVADFGLSKICESNIQMSTVCGTPGYCAPEVLQGNPYSTAVDMWSVGVITYILLCGYEPFYCDNEKEMYKKIIKGDYMFDAPWWDDVSENAKDLVRQLLKVDPAERLTSSQALEHPW 276          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A267GU18 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020174g1 PE=3 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 1.762e-55
Identity = 105/275 (38.18%), Postives = 156/275 (56.73%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFNCEST-SNALKDFLNHLLKADPKSRMNIINALKHPW 889
            YW+ +SIK+   E++YD+G E+ +      G  SVV  C    + + +A  VI+KKV       +IGI L ++  N++R+ EVFET  H  ++ E +TG +LF+     G Y E    +  +Q+L G+RYLHE  IIH ++K ENL+  D  E    LKI D   S I   D++  S+   P  C PEVLL +    A+DMW++GV  FILL GYEPFY +  +++YR ++ A Y+++    S  S   +D +  LL  D  +R+    AL+HPW
Sbjct:    5 YWLYESIKDIRFEDVYDLGKELGK------GGTSVVHECNRIGSSEKWAAKVIQKKVDKRIVTAEIGILLSVSHENIIRLKEVFETPNHFFMVLELVTGGELFDRIVSRGSYNEKDASQCIRQLLDGLRYLHERGIIHRDLKPENLLYEDERE-EAKLKIADFGLSKIADSDVHTRSVCGTPGYCAPEVLLRRGCGTAMDMWSVGVIAFILLGGYEPFYADNDSDMYRRILRAQYTFDQRWWSGISKNARDLIERLLVLDADARLTAGQALRHPW 272          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A4D6Q5Z3 (Calcium/calmodulin-dependent protein kinase type IV-like OS=Onchidium struma nom. nud. OX=643549 GN=MKIV PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.413e-54
Identity = 103/278 (37.05%), Postives = 158/278 (56.83%), Query Frame = 2
Query:   59 MDCYWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            M  YWI +SIK+   E++YD+G E+ R      GA SVV  C  + T +++AV ++ K+V       +IGI LKLN  N++R+ EVFET  H  ++ E +TG +LF        Y+E +     + I++G+ YLH ++++H ++K EN I+ +S   N  LKI D   STI+   +   ++   P  C PEVL  +    + DMW++GV  +ILLCGYEPFY E    +++ ++  DY ++    +  S+  KD +  LL  DPK R+    ALKH W
Sbjct:    5 MQEYWIAESIKDTKFEDVYDLGKELGR------GATSVVHKCCVKGTDQAWAVKIMDKRVELKTIVTEIGILLKLNHPNIVRMKEVFETLDHDYIVLELVTGSELFERIITQEYYSEEQAATAIRDIITGVEYLHNHDVVHRDLKPEN-ILYESLSLNSKLKIADFGLSTIVSGKVALTTVCGTPGYCAPEVLKGEKYFKSCDMWSVGVIAYILLCGYEPFYAENEATMFKKILKGDYKFDSPWWDDVSDNAKDLVRKLLVVDPKKRLTPAAALKHVW 275          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1I8GVX7 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 2.076e-53
Identity = 102/289 (35.29%), Postives = 162/289 (56.06%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPWNEICIMKNQPLESI 931
            +W+K+SIK+   + +YD+  E+ R      GA SVV AC  R T + +AV VI+KKV       +IGI L ++  N++R+ E+FET THI+ + E++TG +LF+     G Y+E    +  +Q+L  ++YLHE +IIH ++K ENL + ++   +  LKI D   S I+  D+   ++   P  C PEVLL +     L            LCGYEPFY E  +E+YR ++ A Y ++    +  S   +D ++ L++ DP  R+    AL+HPW      K +PL+++
Sbjct:    5 FWLKESIKDVPFDSVYDLCSELGR------GATSVVFACQKRGTNEKWAVKVIQKKVDKKIVATEIGILLTISHPNIIRLKELFETSTHIHTVLEYVTGGELFDRIVSRGNYSEQDAAQCVRQLLEALKYLHEKDIIHRDLKPENL-LYENERDDACLKIADFGLSKIISQDVQTATVCGTPGYCAPEVLLGKGYGTPL----FSPTASPRLCGYEPFYAENDSEMYRKILRAQYEFDSPWWDGISRNARDLVSGLMQLDPAKRLTAAQALQHPWVSGQAAKTEPLQAV 282          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: si:ch73-60h1.1 (calcium/calmodulin-dependent protein kinase type IV-like [Source:NCBI gene;Acc:103036728])

HSP 1 Score: 179.874 bits (455), Expect = 5.966e-52
Identity = 97/277 (35.02%), Postives = 159/277 (57.40%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY--NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            YW++ S ++ ++EE Y +G E+ R      GA SVV  C  + T K +A  V+KK +       +IG+ L+L+  N++R+ E+FET T I++I E +TG +LF+   + G Y+E     + KQIL  + YLHE  ++H ++K ENL+  D    +  LKI D   S I+   +   ++   P  C PE+L        +DMW++GV ++ILLCG+EPF+  +  + +Y  ++  DY +   +  E + NA KD ++ L+  DP  R+++  AL+HPW
Sbjct:   13 YWVEGSRRDASMEEFYTMGPELGR------GATSVVFRCEEKQTEKPYAAKVLKKTIDKKIVRTEIGVLLRLSHPNIIRLKEIFETETEISLILELVTGGELFDRIVERGYYSERDAAHVIKQILEAVAYLHENGVVHRDLKPENLLYADLSI-DAPLKIADFGLSKIIDEQVTMKTVCGTPGYCAPEILRGNAYGPEVDMWSVGVILYILLCGFEPFFDPRGDQYMYSRILNCDYEFVSPWWDEVSLNA-KDLVSKLIVLDPHKRLSVQQALEHPW 281          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: camk4 (calcium/calmodulin dependent protein kinase IV [Source:NCBI gene;Acc:103044753])

HSP 1 Score: 171.014 bits (432), Expect = 1.756e-49
Identity = 93/284 (32.75%), Postives = 159/284 (55.99%), Query Frame = 2
Query:   44 SRRKKMDCYWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            SR      YWI DS K + + + Y++  E+ R      GA SVV  C  + T+K +AV ++KK V       +IG+ L+L+  N++++ E+FET   I+++ E +TG +LF+   + G Y+E       KQ+L  + YLHE+ ++H ++K ENL+   S   +  LKI D   S I+   +   ++   P  C PE+L        +DMW++GV  +ILLCG+EPF+ ++  + +++ ++  +Y + +   ++ S   KD +  L+  DPK R+  + AL+HPW
Sbjct:    9 SRPGAAPEYWIDDS-KRETLADFYELECELGR------GATSVVFRCRQKGTQKPYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPLEISLVLELVTGGELFDRVVEKGYYSERDAADAIKQVLEAVAYLHEHGVVHRDLKPENLLYATSAP-DAPLKIADFGLSKIIDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGVITYILLCGFEPFFDDRGDQYMFKRILNCEYEFVSPWWDNVSLNAKDLVKKLIVQDPKKRLTTLQALQHPW 284          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: si:ch73-60h1.1 (calcium/calmodulin-dependent protein kinase type IV-like [Source:NCBI gene;Acc:103036728])

HSP 1 Score: 163.696 bits (413), Expect = 9.673e-46
Identity = 89/251 (35.46%), Postives = 143/251 (56.97%), Query Frame = 2
Query:  146 FQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY--NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            F   GA SVV  C  + T K +A  V+KK +       +IG+ L+L+  N++R+ E+FET T I++I E +TG +LF+   + G Y+E     + KQIL  + YLHE  ++H ++K ENL+  D    +  LKI D   S I+   +   ++   P  C PE+L        +DMW++GV ++ILLCG+EPF+  +  + +Y  ++  DY +   +  E + NA KD ++ L+  DP  R+++  AL+HPW
Sbjct:   37 FFSRGATSVVFRCEEKQTEKPYAAKVLKKTIDKKIVRTEIGVLLRLSHPNIIRLKEIFETETEISLILELVTGGELFDRIVERGYYSERDAAHVIKQILEAVAYLHENGVVHRDLKPENLLYADLSI-DAPLKIADFGLSKIIDEQVTMKTVCGTPGYCAPEILRGNAYGPEVDMWSVGVILYILLCGFEPFFDPRGDQYMYSRILNCDYEFVSPWWDEVSLNA-KDLVSKLIVLDPHKRLSVQQALEHPW 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: pnck (calcium/calmodulin-dependent protein kinase type 1B-like [Source:NCBI gene;Acc:103046554])

HSP 1 Score: 154.066 bits (388), Expect = 2.014e-43
Identity = 84/249 (33.73%), Postives = 137/249 (55.02%), Query Frame = 2
Query:  155 EGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDN---NDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            EG+ S V    +R T K  AV  I+K+     ++   N+I +  ++   N++ + E FET T + ++   +TG +L +   + G YTE    R+  Q+L  ++YLH+  I+H ++K ENL+     E + I+ I D   S +        +    P+   PE+L  +     +D+WA+GV  FILLCGY PFY E  T+LY+ +I A++ ++    +  S++ KDF+ HLL+ DP+ R N   AL+HPW
Sbjct:   26 EGSFSEVRVAQHRKTHKLVAVKCIRKRALKGKESMLENEIAVLRRIKHENIISLEETFETPTKLYLVMTLVTGGELLDRILERGSYTEKDASRVILQVLEAVKYLHQLGIVHRDLKPENLLYETPLEDSKIV-ISDFGLSKMEEQGALS-TACGTPAYVAPELLQQKTYGKGVDLWALGVISFILLCGYPPFYDENDTQLYKQIIKAEFEFDSPYWDDISDSAKDFIVHLLQKDPERRFNCEQALQHPW 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: pnck (calcium/calmodulin-dependent protein kinase type 1B-like [Source:NCBI gene;Acc:103046554])

HSP 1 Score: 154.066 bits (388), Expect = 2.014e-43
Identity = 84/249 (33.73%), Postives = 137/249 (55.02%), Query Frame = 2
Query:  155 EGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDN---NDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            EG+ S V    +R T K  AV  I+K+     ++   N+I +  ++   N++ + E FET T + ++   +TG +L +   + G YTE    R+  Q+L  ++YLH+  I+H ++K ENL+     E + I+ I D   S +        +    P+   PE+L  +     +D+WA+GV  FILLCGY PFY E  T+LY+ +I A++ ++    +  S++ KDF+ HLL+ DP+ R N   AL+HPW
Sbjct:   26 EGSFSEVRVAQHRKTHKLVAVKCIRKRALKGKESMLENEIAVLRRIKHENIISLEETFETPTKLYLVMTLVTGGELLDRILERGSYTEKDASRVILQVLEAVKYLHQLGIVHRDLKPENLLYETPLEDSKIV-ISDFGLSKMEEQGALS-TACGTPAYVAPELLQQKTYGKGVDLWALGVISFILLCGYPPFYDENDTQLYKQIIKAEFEFDSPYWDDISDSAKDFIVHLLQKDPERRFNCEQALQHPW 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003135.1 (pep scaffold:Pmarinus_7.0:GL491838:799:5626:1 gene:ENSPMAG00000002863.1 transcript:ENSPMAT00000003135.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.946 bits (315), Expect = 3.008e-34
Identity = 76/255 (29.80%), Postives = 130/255 (50.98%), Query Frame = 2
Query:  158 GALSVVSACYNRTTRKSFAVNVIKKKVGYCPDN---NDIGIFLKLNDVNLMRVIEVFETWTHINVIREH----LTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCP---PEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            GA S V     R+T +  A+  I K      DN   N++ +  ++   N++ + +++ET +H+ +I +     + G +LF+   + G YTE     + +Q+L  + +LH   ++H ++K ENL+   S E +  + I D   S +        +    P       PEVL  +  T A+D W+IGV  +ILLCGY PFY E  + L+  ++ A+Y ++    +  S++ KDF+ HL++ D   R     AL+HPW
Sbjct:    2 GAFSEVVLAEERSTGRHVAIKCIAKTALRGKDNTVENEVCVLSRIKHENIIALEDIYETDSHLYLIMQLVLLLIRGGELFDRIVERGFYTERDASALIRQVLRAVSHLHGQGVVHRDLKPENLLYY-SAEDDSKIMISDFGLSKVEAPGSVMSTACGTPGYVACEAPEVLAQKPYTRAVDCWSIGVISYILLCGYPPFYDEVDSRLFDQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDVAERFTCEQALQHPW 255          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001278.1 (pep scaffold:Pmarinus_7.0:GL476529:253165:339525:-1 gene:ENSPMAG00000001147.1 transcript:ENSPMAT00000001278.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.005 bits (284), Expect = 1.478e-29
Identity = 74/255 (29.02%), Postives = 126/255 (49.41%), Query Frame = 2
Query:  158 GALSVVSACYNRTTRKSFAVNVIKKKV------GYCPDN--NDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDH-IQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFNCESTSNAL-KDFLNHLLKADP-KSRMNIINALKHPW 889
            G  +VV  C  + +   FA   IKK+       G  P++   ++ I  +L   N++ + EV+E  T + +I E ++G +LF+        +E +     KQIL G+ YLH   I H ++K EN++++++      +KI D  +  +I+    +R  I   P    PE++  +      DMW+IGV  +ILL G  PF  +   E    +   +Y ++      ++AL K+F+  LL   P + RMN+  A+ HPW
Sbjct:    4 GQFAVVKKCCEKKSGLEFAAKFIKKRRSRSSRRGVVPEDIKREVSILRELRHPNIISLHEVYENDTDVTLILELVSGGELFDFLAHKESLSEDEATEFLKQILDGVSYLHCRRIAHFDLKPENIMLLENRAPKAHVKIIDFGLAQSIVDGVEFR-HIFGTPEFVVPEIVNYEPLGVQADMWSIGVMTYILLSGASPFLGDTKEETLSNISAVEYKFDEEYFKQTSALAKNFIQRLLLKSPNRERMNVEEAIHHPW 257          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: dapk1 (death-associated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060526-177])

HSP 1 Score: 116.316 bits (290), Expect = 1.255e-28
Identity = 72/254 (28.35%), Postives = 122/254 (48.03%), Query Frame = 2
Query:  158 GALSVVSACYNRTTRKSFAVNVIKKKV-------GYCPDN--NDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            G  +VV  C  +T+ + FA  +I+K         G   ++   ++ +   L   N++ + +VFE+   + +I E ++G +LF+   K    +E +     KQIL G+ YLH  +I H ++K    ++++  + N  +K+ D   + I+   I   +I   P    PEV+  +      DMW+IGV  +ILL G  PF  +   E    +    Y ++    + TS    DF+  LL  DPK RM + + L HPW
Sbjct:    2 GHFAVVKRCREKTSGEEFAAKLIRKSRSARSSRRGVVREDIEREVNVLRGLRHPNVIALHDVFESKADVILILELVSGGELFDFLAKKDALSEEEATEFIKQILDGVHYLHSKHIAHFDLKKPFFMLLECNQPNPRIKLIDFGLAHIIEEGIEFRNIFGTPEFVAPEVVNYEPLGLEADMWSIGVITYILLSGASPFLGDSKQETLTNITGVKYEFDEEYFDQTSQLAMDFIRRLLVKDPKKRMTVKDCLSHPW 255          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008748.1 (pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 gene:ENSPMAG00000007907.1 transcript:ENSPMAT00000008748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 1.324e-27
Identity = 76/279 (27.24%), Postives = 127/279 (45.52%), Query Frame = 2
Query:  155 EGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIG----IFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYR-LSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPWNEICIMKNQPLESIYQQYVKCVGSIEDR 973
            +GA SVV  C   +T + FA  +I  K     D+  +     I   L   N++R+ E         ++ + +TG +LF        Y+E+      +QIL  + + H++ I+H ++K ENL++    +G  + K+ D   +  +  D          P    PEVL        +DMWA GV ++ILL GY PF+ E   +LY+ +    Y + +   ++ +   K+ +N +L  +P  R+    ALKHPW  IC           Q+ V+C+     R
Sbjct:   22 KGAFSVVRRCVKVSTGQEFAAKIINTKKLSARDHQKLEREARICRLLKHSNIVRLHESIAEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHHCHQHGIVHRDLKPENLLLASKMKGAAV-KLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTAEAKNLINQMLTINPAKRITAAEALKHPW--ICQRSTVASCMHRQETVECLRKFNAR 297          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010548.1 (pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-1 gene:ENSPMAG00000009555.1 transcript:ENSPMAT00000010548.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.686 bits (265), Expect = 1.356e-25
Identity = 73/277 (26.35%), Postives = 125/277 (45.13%), Query Frame = 2
Query:   95 QNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSF--AVNVIKKKVGYCPDN---NDIGIFLKLND-VNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPF--YREKITELYRAVITADYS----YNFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            Q++E  Y+IG  I    F        VS+         +  A+ +I K      +    +++ +  +L    N++R++E  E+ +   ++ E + G  LF+   +S  +TE     +   +   ++YLH  NI+H ++K ENL++  + +G   LK+ D   +  +   IY  ++   P+   PE+L        +DMWA GV  +ILLCG+ PF        EL+  +   +Y     Y  +      A KD ++ LL  D   R     AL HPW
Sbjct:  357 QDIESRYEIGRTIGDGNFATVKECRRVSSGDGSAGEAEWDLAMKIIDKAKLVGREEMLRSEVALTTRLGQHPNVVRLVEAMESPSDAYLVLERVRGGDLFDAITESVRFTERHAAAMVADLCRALQYLHANNIVHRDVKPENLLVQRNADGGTTLKLADLGLAMEVTGPIY--TVCGTPTYVAPEILAETGYGLEVDMWAAGVITYILLCGFPPFRSLERDQEELFEIIQLGEYEFLSPYWDHISDGHEAAKDLVSRLLVVDTARRYTARQALHHPW 631          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CMK1 (Calmodulin-dependent protein kinase; may play a role in stress response, many Ca++/calmodulin dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK1 has a paralog, CMK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001910])

HSP 1 Score: 111.309 bits (277), Expect = 1.015e-27
Identity = 78/259 (30.12%), Postives = 122/259 (47.10%), Query Frame = 2
Query:  158 GALSVVSACYNRTTRKSFAVNV-IKK-----KVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVD-SGEGNLILK---ICDHIQS--TIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN---CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            G   VV    N  T +  AV + IKK     KV      +++ I  +L+  N++   + FE+     +I +   G +LF+   K G +TE    RI  +ILS ++Y+H  NI+H ++K ENL+ +D S E  L++    I   ++S   +++     L  +A      PEVL         D+W+IGV  + LLCGY  F  E++ +      T +Y   F+    +S SN  K F+   L  DP  R      L+ PW
Sbjct:   46 GTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVA------PEVLTQDGHGKPCDIWSIGVITYTLLCGYSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPW 298          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 105.531 bits (262), Expect = 2.961e-25
Identity = 67/271 (24.72%), Postives = 127/271 (46.86%), Query Frame = 2
Query:  155 EGALSVVSACYNRTTRKSFAVNVIKKK--VGYCPD-NNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFA-------------LDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYN-FNCESTSNALKDFLNHLLKADPKSRMNIINALKHPWNEICIMKNQ 916
            +GA + V     RTT K+FAV +I K+  +G       ++ +  KLN   ++R+   +E      ++ E ++G  L +     G   E     I++QIL+ I+Y+H   I H ++K +N++I    +  +++KI D   + +     +  +     +   PEV+  +  + +             +DMW++G  V+++L G+ PF      +LY+ +    Y          S   +DF++ LL+ DP +R     AL HPW ++  + +Q
Sbjct:  206 QGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDGVTRELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILI--EQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWIKMSPLGSQ 474          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CMK2 (Calmodulin-dependent protein kinase; may play a role in stress response, many CA++/calmodulan dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK2 has a paralog, CMK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005376])

HSP 1 Score: 98.5969 bits (244), Expect = 2.731e-23
Identity = 73/260 (28.08%), Postives = 116/260 (44.62%), Query Frame = 2
Query:  158 GALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNN--------DIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYD---IYRLSIIALPSL--CPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFNC---ESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            G+  VV      +T +  A+ ++ KK      NN        ++ I  KL+  N++   + FE+     ++ +  TG +LF+     G +TE     I  QIL  + Y+H  N++H ++K EN++ VD  E N  L I D   +  +  +   IY+    A  SL    PEVL         D+W+IGV  + LLCGY PF  E +         + Y   F+    ++ S  +K F+   L+ +P  R      L  PW
Sbjct:   56 GSFGVVRQARKLSTNEDVAIKILLKKA--LQGNNVQLQMLYEELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQILGAVEYMHSKNVVHRDLKPENVLYVDKSE-NSPLVIADFGIAKQLKGEEDLIYK----AAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYWDNISIDVKRFILKALRLNPADRPTATELLDDPW 308          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: IPL1 (Aurora kinase of chromosomal passenger complex; mediates release of mono-oriented kinetochores from microtubules in meiosis I, and kinetochore release from SPB clusters at meiotic exit; helps maintain condensed chromosomes during anaphase; required for SPB cohesion and prevention of multipolar spindle formation; promotes telomerase release at G2/M; Iocalizes to nuclear foci that diffuse upon DNA replication stress; required for inhibition of karyopherin Pse1p upon SAC arrest [Source:SGD;Acc:S000006130])

HSP 1 Score: 94.7449 bits (234), Expect = 2.495e-22
Identity = 65/221 (29.41%), Postives = 104/221 (47.06%), Query Frame = 2
Query:  260 DIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPWNEICIMKNQPL 922
            ++ I   LN  NL +    F     + ++ E+L   +++   +  GP+ +        QI + + Y+H+ NIIH +IK EN++I   G  N+I K+ D   S I   +  R ++        PE++ S+     +D WA+GV  F LL G  PF  E     Y+ +   D     N    S   +D +  LLK DPK RM + +   HPW    I++N+P 
Sbjct:  152 EVEIQTSLNHPNLTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRLHGPFNDILASDYIYQIANALDYMHKKNIIHRDIKPENILI---GFNNVI-KLTDFGWSIINPPENRRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTGAPPFEEEMKDTTYKRIAALDIKMPSNI---SQDAQDLILKLLKYDPKDRMRLGDVKMHPW----ILRNKPF 361          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: DUN1 (Cell-cycle checkpoint S/T protein kinase; required for transient G2/M arrest after DNA damage, damage-induced transcription, and nuclear-to-cytoplasmic redistribution of Rnr2p-Rnr4p after genotoxic stress and iron deprivation; phosphorylates repair protein Rad55p, transcriptional repressor Sml1p, superoxide dismutase, and ribonucleotide reductase inhibitors Crt1p and Dif1p; functions in the Mec1p pathway to regulate dNTP pools and telomere length; postreplicative repair role [Source:SGD;Acc:S000002259])

HSP 1 Score: 92.8189 bits (229), Expect = 3.553e-21
Identity = 65/271 (23.99%), Postives = 126/271 (46.49%), Query Frame = 2
Query:  158 GALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNN-----DIGIFLKLNDVNLMRVIEVF-----ETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIV---------------DSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYRE-KITELYRAVITADYS-YNFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            G  ++V    N+ T +  AV +   +       N     +  I +++   N++ +++ F     ++     ++ E +   +LF    +     + +   + KQ+L+G++YLHE NIIH +IK EN+++                D  E ++ +KI D   +       +  ++   PS   PEVL  +  T  +D+W+ GV +++ LCG+ PF  +     L   ++ A Y+ Y+   +   +++   +++LL  +P  R NI  AL HPW
Sbjct:  209 GHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGPPSLKEQILQAKYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHPW 479          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO42276 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1X1])

HSP 1 Score: 179.874 bits (455), Expect = 6.570e-54
Identity = 95/275 (34.55%), Postives = 151/275 (54.91%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            Y+ +D  + + +E+ YDIG E+ R      GA SVV  C  + T K FAV ++KK V       + GI  ++N  N++ + E+FET TH+ ++ E +TG +LF+   + G Y E       K IL  + +LH+ +I+H ++K ENL+  +  E +  LKI D   S I+  ++   ++   P  C PEVL  +     +DMWAIGV  +ILLCG+EPFY E   ++++ ++  DY + +   +  S+  KD +  L+  D   R+    AL HPW
Sbjct:    3 YFFEDLSRKEPIEDFYDIGKELGR------GASSVVKLCRQKGTNKEFAVKIMKKTVDKKIIQTETGILFRINHPNIIHMKELFETHTHLFMVLELVTGGELFDRVVEKGYYCEKDAADAIKMILEAVGHLHKNDIVHRDLKPENLLYANERE-DSPLKIADFGLSKILPQEVMTSTVCGTPGYCAPEVLKGESYDTGVDMWAIGVIAYILLCGFEPFYDETDQQMFQRILKCDYDFVSPWWDDVSSGAKDLVKRLITGDKNKRLTAKQALDHPW 270          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO36253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ85])

HSP 1 Score: 142.895 bits (359), Expect = 7.295e-40
Identity = 82/248 (33.06%), Postives = 126/248 (50.81%), Query Frame = 2
Query:  158 GALSVVSACYNRTTRKSFAVNVIKKKVGYCPDN---NDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            GA S V     + T   FAV  I KK     +    N+I I  K+   N++ + ++F+  +H+ ++ + + G +LF+   + G YTE     + +QIL    YLH   I+H ++K ENL+     E + I+ I D   S I     +  +    P    PEVL  Q    A+D W+IGV  +ILLCGY PFY +    L+  ++ A+Y ++    +  S + KDF+ HL++ DPK R     AL HPW
Sbjct:   26 GAFSEVVLAEEKATGSLFAVKCISKKELKGKEESVENEIAILKKVRHKNIIGLKDIFDNKSHLYLVMDLVQGGELFDRIVEKGNYTEQDASALVQQILEAADYLHSLGIVHRDLKPENLLYYSPDEDSKIM-ISDFGLSKIEAQGSFMDTACGTPGYVAPEVLKQQPYGKAVDCWSIGVITYILLCGYPPFYDDSDANLFAQIMRAEYEFDSPYWDEISESAKDFIRHLMELDPKLRYTCRQALSHPW 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO44488 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVP7])

HSP 1 Score: 121.324 bits (303), Expect = 2.737e-32
Identity = 71/249 (28.51%), Postives = 123/249 (49.40%), Query Frame = 2
Query:  155 EGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDN---NDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            +G  +VV  C +R T K +A+ +I K      ++   N+I I  ++   +++ +IE +ET   I ++ E + G  LF    ++  YTE     + + + S + YLH  +I+H +IK ENL++++   G   LK+ D      M        +   P+   PE+L        +D+WA GV  +ILLCG+ PF      EL+  ++  ++ Y +      S++ KD ++H+L  D   R +    L HPW
Sbjct:    9 DGNFAVVRECKHRKTNKEYALKIINKAKVKGKEHMIENEISILRRVKHNHIVELIEEYETPREIFLVMELVKGGDLFEAIVEATKYTEVHASHMVRDLASALDYLHCNSIVHRDIKPENLLVLNLPNGRKSLKLADF--GLAMEVKSPMFLVCGTPTYVAPEILDESGYGLKVDIWAAGVISYILLCGFPPFRSPDQDELFDLILAGEFEYLSPFWNDISSSAKDLIDHMLVVDANQRYSAKQVLAHPW 255          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO35611 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL08])

HSP 1 Score: 120.553 bits (301), Expect = 5.814e-31
Identity = 82/293 (27.99%), Postives = 145/293 (49.49%), Query Frame = 2
Query:  158 GALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHY--DIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFNC-ESTSNALKDFLNHLLKADPKSRMNIINALKHPW----NEICIMKNQPLESIYQQYVKCVG-SIEDRMHEKVMDDIRRAN 1012
            G+ S V    +  T++ +A+ +++ + G     +++ +  ++    ++R+ EVFE    + ++ E  TG  L +     G +TE    R+   +L G+RYLH   I H ++K ENL+    G  + I+ I D   S +  +  D    +    P    PEVLLS+  T ++D+W+IGV  F +L G  PF  +  + LY+ ++   +S++    +  ++  KDF+N L+  +P+ R+     +KHPW         +KN   +SI Q  +K  G S +    +K    IR AN
Sbjct:   79 GSFSRVVRVEHYQTKQPYAIKMMEIEQGKDEFQSELAVLRRVKHEFVVRLYEVFECRNRVYLVMELATGGVLLDRILSKGFFTERDATRVIYMVLEGVRYLHSLGITHRDLKPENLLYYHPGNDSKIM-ITDFGLSNLRKHPDDRTMETTCGTPGYMAPEVLLSKPYTNSVDIWSIGVITFNVLSGQMPFADDHRSRLYKKILRGKFSFSGEPWDDVTDMAKDFINKLIVYEPEMRLTAEQGIKHPWIASSAATSSLKNLH-KSISQNLLKSRGNSAKSNRSQKSNRSIRIAN 369          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO33022 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STC5])

HSP 1 Score: 116.316 bits (290), Expect = 5.000e-30
Identity = 80/274 (29.20%), Postives = 134/274 (48.91%), Query Frame = 2
Query:  104 EEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVI--------KKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDI---YRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSY-NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            E++Y+I        F  +GA   VS C N  TR+ FAV  I        KKK       N+  I   L+  +++ + +VF T   + ++ E+L G  LF+       ++E       +Q+L  +RYL    IIH ++K ENL++ +        +  DH    I   D     +L     P    PE +L +  T+A+D+WA GV +++LL GY PF+ E+   L  +++ ++Y++ +   ++ S   KD +  +L  DP+ R+  + ALKH W
Sbjct:    4 EDVYEITD------FIGKGAFGQVSKCVNLQTREVFAVKEIDFSGSEEDKKKA-----QNEAKICGLLDHPSIVHLEDVFFTPRRMLLVLEYLPGGDLFDGVVTRTQFSEKDACACVRQVLKALRYLTRKGIIHRDLKPENLLLSE--------RPSDHRPPIIKLTDFGIAKQLKGNGSPLYLAPETILEEGLTYAVDIWACGVILYLLLVGYPPFWNEQTEFLLLSILQSNYTFPSPYWDTVSEPAKDLIRKMLVVDPRDRITAVEALKHEW 258          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: si:ch73-60h1.1 (calcium/calmodulin-dependent protein kinase type IV [Source:NCBI gene;Acc:101155594])

HSP 1 Score: 175.252 bits (443), Expect = 7.340e-50
Identity = 94/277 (33.94%), Postives = 157/277 (56.68%), Query Frame = 2
Query:   68 YWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITE-LYRAVITADYSY--NFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            +W+  S ++  VE+ Y +G E+ R      GA S+V  C  + T+K +AV V+KK +       +IG+ L+L+  N++++ E+FET T I ++ E +TG +LF+   + G Y+E     + KQIL  + YLHE  ++H ++K ENL+  D    +  LKI D   S I+   +   ++   P  C PE+L        +DMW++GV ++ILLCG+EPF+  +  + +Y  ++  DY +   +  E + NA KD +  L+  DP  R+++  AL+HPW
Sbjct:   13 FWVDGSRRDGTVEDFYTLGSELGR------GATSIVYRCEEKQTQKPYAVKVLKKTIDKKIVRTEIGVLLRLSHPNIIQLKEIFETDTDIALVLELVTGGELFDRIVERGYYSERDAAHVIKQILEAVAYLHENGVVHRDLKPENLLYADLSL-DASLKIADFGLSKIIDDQVTMKTVCGTPGYCAPEILRGNAYGPEVDMWSVGVILYILLCGFEPFFDPRGDQYMYSRILNCDYEFVSPWWDEVSLNA-KDLVGKLIVLDPHKRLSVREALQHPW 281          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000012877.2 (calcium/calmodulin-dependent protein kinase type 1D [Source:NCBI gene;Acc:101157124])

HSP 1 Score: 147.902 bits (372), Expect = 1.869e-40
Identity = 81/282 (28.72%), Postives = 153/282 (54.26%), Query Frame = 2
Query:   50 RKKMDCYWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKK-VGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            RK++ C W K +    N+++++D   ++        G+ S V     + T + +A+  +KKK + +    N+I I  ++   N++ + + +E+ TH  ++ + ++G +LF+     G YTE    R+ KQ+L  + YLH+ +I+H ++K ENL+  ++ E   I+ + D   S    + +   +    P    PEVL  +  + A+D W+IGV  +ILLCGY PF+ E  T L+  ++ A+Y+++    +  S + KDF+ ++++ +P  R     AL+HPW
Sbjct:    3 RKEITCSWKKST---SNIKDVFDFEGKMG------SGSFSEVFMVREKKTGRLYALKCLKKKHLAHSNLENEINILRRIKHENVVGLEDFYESRTHYYLVMQLVSGGELFDRILDKGVYTEKDASRVIKQVLQAVSYLHQNSIVHRDLKPENLLFFNTDENAKIM-VSDFGLSKTPEHGVMS-TACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFFEENETRLFSKIMRAEYAFHSPFWDDISESAKDFVRNMMEKNPLKRFTTEQALRHPW 273          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: camk1gb (calcium/calmodulin-dependent protein kinase type 1D [Source:NCBI gene;Acc:101164726])

HSP 1 Score: 146.747 bits (369), Expect = 7.618e-40
Identity = 88/282 (31.21%), Postives = 151/282 (53.55%), Query Frame = 2
Query:   50 RKKMDCYWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPD-NNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            R++ D  W K +   +N++EI+D+  E+        GA S V     R T K FA+  IKKK     +  N++ +  ++   N++ + +++E+ TH  +I + ++G +LF+     G YTE    R+ +Q+L  + YLH+  I+H ++K EN++     E + I+ I D   S +    I   +    P    PEVL  +  + A+D W+IGV  +ILLCGY PFY E  T+L+  ++ A Y ++    +  S + KDF+ ++++  P  R +   AL+HPW
Sbjct:    3 RQESDHMWKKST---ENIQEIFDLMEELG------SGAFSEVFMVRERKTGKKFAMKCIKKKKKRDINLENEMAVLRRIKHENVVGLEDIYESRTHYYLIMQLVSGGELFDRILDRGMYTEKDASRVIQQVLQAVSYLHQNGIVHRDLKPENILYYSQDEDSKIM-ISDFGLSKMTDTGIMS-TACGTPGYVAPEVLAQKPYSKAVDCWSIGVITYILLCGYPPFYEESETKLFSKIMKAQYEFDSPFWDDISESAKDFIRNMMQKTPSMRYSTEQALRHPW 273          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: camk1db (calcium/calmodulin-dependent protein kinase type 1D [Source:NCBI gene;Acc:101175563])

HSP 1 Score: 145.976 bits (367), Expect = 9.546e-40
Identity = 86/284 (30.28%), Postives = 145/284 (51.06%), Query Frame = 2
Query:   50 RKKMDCYWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDN---NDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            R +  C   K ++    V E        F  P +V GA S V     + T K  A+  I KK     +    N+I +  K+   N++ + +++E+  H+ +I + ++G +LF+   + G YTE    R+ +Q+L  + YLH   I+H ++K ENL+     + + I+ I D   S +        +    P    PEVL  +  + A+D W+IGV  +ILLCGY PFY E  ++L+  ++ ADY ++    +  S++ KDF++ L++ DP+ R     AL+HPW
Sbjct:    2 RSRQRCKSSKLNVAPHGVSE--------FTSP-EVSGAFSEVVMAREKATGKMVAIKCIPKKALKGKETSIENEIAVLRKIKHENIVALEDIYESSNHLYLIMQLVSGGELFDRIVEKGFYTEMDASRLIRQVLDAVNYLHSMGIVHRDLKPENLLYFSPHDDSKIM-ISDFGLSKMEGTGGVMATACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKADYEFDAPYWDDISDSAKDFISCLMEKDPEKRFTCDQALEHPW 275          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: camk1b (calcium/calmodulin-dependent protein kinase type 1 [Source:NCBI gene;Acc:101170017])

HSP 1 Score: 145.206 bits (365), Expect = 1.226e-39
Identity = 87/271 (32.10%), Postives = 143/271 (52.77%), Query Frame = 2
Query:   89 KNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDN---NDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            +  +V+E YD   EI        GA S V     + T K  A+  I KK     +N   N+I +  K+   N++ + ++FE+ +H+ +I + ++G +LF+   + G YTE    ++ +QIL  ++YLH+  I+H ++K ENL+     E + I+ I D   S I        +    P    PEVL  +  + A+D W+IGV  +ILLCGY PFY E   +L+  ++ A+Y ++    +  S++ KDF+ HL++ D  +R     AL HPW
Sbjct:   13 RTTDVKEQYDF-KEILGT-----GAFSEVVLAEEKRTHKLVAIKCIPKKALEGKENSIENEIAVLHKIKHPNIVSLEDIFESKSHLYLIMQLVSGGELFDRIIEKGFYTEKDASKLIQQILDAVKYLHDMGIVHRDLKPENLLYYSMDEDSKIM-ISDFGLSKIEGSGSVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVISYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIVHLMEKDSNTRYTCDQALLHPW 276          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000030766.1 (SMESG000030766.1)

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 292/333 (87.69%), Postives = 295/333 (88.59%), Query Frame = 2
Query:   59 MDCYWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFNCESTSNALKDFLNHLLKADPKSRMNIINALKHPWNEICIMKNQPLESIYQQYVKCVGSIEDRMHEKVMDDIRRANDIFDKLILRNPYRTY 1057
            MDCYWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLND+NLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTE+   R                                   NLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFNCESTSNALKDFLNHLLKA+PKSRMNIINALKHPWNEICIMKNQPLESIYQQYVKCVGSIEDRMHEKVMDDIRRANDIFDKLILRNPYRTY
Sbjct:    1 MDCYWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDINLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTENIFTR-----------------------------------NLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFNCESTSNALKDFLNHLLKANPKSRMNIINALKHPWNEICIMKNQPLESIYQQYVKCVGSIEDRMHEKVMDDIRRANDIFDKLILRNPYRTY 298          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000042100.1 (SMESG000042100.1)

HSP 1 Score: 186.808 bits (473), Expect = 6.930e-56
Identity = 103/290 (35.52%), Postives = 164/290 (56.55%), Query Frame = 2
Query:   59 MDCYWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPWNEICIMKNQPLE 925
            M+ YWIKDSIKN+  E+ Y+I ++I        G+   V  C  + T   FA  VI KKV      +++G+ LKL   N++R+ EV+E+ T ++++ E+++G +LF+     G Y+E    R  +++L  + YLHE +IIH ++K ENL+     E N  LK+ D   + I+  D++ +++   P  C PE+LL       +D+W+IGV  +ILLCGYEPFY EK  ++++ +I   YS++    ++ S   KD ++ LL  DP  R+    AL H W +    K   LE
Sbjct:    1 MEEYWIKDSIKNEPFEKYYEILNKIGN------GSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEESN--LKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLE 282          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000078937.1 (SMESG000078937.1)

HSP 1 Score: 137.117 bits (344), Expect = 4.444e-37
Identity = 81/265 (30.57%), Postives = 131/265 (49.43%), Query Frame = 2
Query:  158 GALSVVSACYNRTTRKSFAVNVIKKKVGYCPD-----------------NNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVL-LSQIRTFA--LDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFN-CESTSNALKDFLNHLLKADPKSRMNIINALKHPW 889
            GA S V    +   R   AV  IKKK                        N+I +  KL   N++++++V E+     ++ E +TG +LF+   + G YTE     + +Q+L    Y+HE  ++H ++K ENL+     + + I+ I D   S +   D    +    P    PEVL ++  R++   +D WA+GV  +ILLCGY PFY E   EL+R +  A Y ++    +  S++ KDF+ HL++ +PK R +   +L HPW
Sbjct:   19 GAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLRKLKHENIVQLLDVLESDDTYYLVMELVTGGELFDRIVEKGSYTEKDASNLIRQVLEATDYMHEQGVVHRDLKPENLLYYSPDDDSKIM-ISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPW 282          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000011366.1 (SMESG000011366.1)

HSP 1 Score: 114.005 bits (284), Expect = 1.629e-28
Identity = 79/269 (29.37%), Postives = 129/269 (47.96%), Query Frame = 2
Query:  104 EEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKK------VGYCPDN--NDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYN-FNCESTSNALKDFLNHLLKADPKSRMNIINALKH 883
            E+ Y +G  I +      G  + V  C N  T   +A   IKKK      +G   D+   +  I  KL+  N++++ E F+      +I E +TG +LF +       +E +  +  +QIL G+ ++H  NI+H ++K EN+++ D       +KI D   S  ++ D   L +   P    PEV+     TFA DMW+IG+  +I+L G  PFY E  +E++  +       N   C   S+  K FL+ L+   P  R++  + LKH
Sbjct:    9 EQKYILGQHIGK------GHYATVKMCTNIETNIDYAAKFIKKKRIAMSRIGTKTDDIVREARILSKLSHPNIIQIYEAFDRKDMSVLILELVTGGELFEYISNKVTLSEEEASKFMRQILLGVHHMHSKNILHLDLKPENILVEDPDTQK--IKIIDFGFSKEIN-DAPILELQGTPEFVAPEVINYDPLTFATDMWSIGIIAYIMLTGNSPFYHETQSEVFNRITRCQLDLNDSTCSMMSDLAKSFLSSLIVKTPSKRLSCEDCLKH 268          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000011366.1 (SMESG000011366.1)

HSP 1 Score: 113.62 bits (283), Expect = 2.445e-28
Identity = 79/269 (29.37%), Postives = 129/269 (47.96%), Query Frame = 2
Query:  104 EEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKSFAVNVIKKK------VGYCPDN--NDIGIFLKLNDVNLMRVIEVFETWTHINVIREHLTGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLIIVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTFALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYN-FNCESTSNALKDFLNHLLKADPKSRMNIINALKH 883
            E+ Y +G  I +      G  + V  C N  T   +A   IKKK      +G   D+   +  I  KL+  N++++ E F+      +I E +TG +LF +       +E +  +  +QIL G+ ++H  NI+H ++K EN+++ D       +KI D   S  ++ D   L +   P    PEV+     TFA DMW+IG+  +I+L G  PFY E  +E++  +       N   C   S+  K FL+ L+   P  R++  + LKH
Sbjct:    9 EQKYILGQHIGK------GHYATVKMCTNIETNIDYAAKFIKKKRIAMSRIGTKTDDIVREARILSKLSHPNIIQIYEAFDRKDMSVLILELVTGGELFEYISNKVTLSEEEASKFMRQILLGVHHMHSKNILHLDLKPENILVEDPDTQK--IKIIDFGFSKEIN-DAPILELQGTPEFVAPEVINYDPLTFATDMWSIGIIAYIMLTGNSPFYHETQSEVFNRITRCQLDLNDSTCSMMSDLAKSFLSSLIVKTPSKRLSCEDCLKH 268          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAMK43.378e-4833.57calcium/calmodulin dependent protein kinase IV [So... [more]
CAMK43.378e-4833.57calcium/calmodulin dependent protein kinase IV [So... [more]
PSKH18.663e-4232.87protein serine kinase H1 [Source:HGNC Symbol;Acc:H... [more]
CAMK11.441e-3930.63calcium/calmodulin dependent protein kinase I [Sou... [more]
CAMK1G2.492e-3833.60calcium/calmodulin dependent protein kinase IG [So... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmk-14.438e-3529.72Calcium/calmodulin-dependent protein kinase type 1... [more]
R06A10.42.954e-3129.41pep chromosome:WBcel235:I:1089666:1095796:-1 gene:... [more]
unc-433.546e-2927.76Calcium/calmodulin-dependent protein kinase type I... [more]
unc-433.546e-2927.76Calcium/calmodulin-dependent protein kinase type I... [more]
unc-433.546e-2927.76Calcium/calmodulin-dependent protein kinase type I... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CaMKI2.074e-3128.52gene:FBgn0016126 transcript:FBtr0333670[more]
CaMKII8.249e-2826.62gene:FBgn0264607 transcript:FBtr0333675[more]
CaMKII8.254e-2826.62gene:FBgn0264607 transcript:FBtr0300377[more]
CaMKII8.254e-2826.62gene:FBgn0264607 transcript:FBtr0089217[more]
CaMKII8.254e-2826.62gene:FBgn0264607 transcript:FBtr0089218[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-60h1.14.312e-5335.74si:ch73-60h1.1 [Source:ZFIN;Acc:ZDB-GENE-140106-15... [more]
camk41.739e-4832.61calcium/calmodulin-dependent protein kinase IV [So... [more]
camk41.739e-4832.61calcium/calmodulin-dependent protein kinase IV [So... [more]
pnck7.892e-4532.25pregnancy up-regulated nonubiquitous CaM kinase [S... [more]
camk1b6.537e-4432.84calcium/calmodulin-dependent protein kinase Ib [So... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxf29.715e-4933.70forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646... [more]
foxf24.897e-4833.70forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646... [more]
foxf25.008e-4833.70forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646... [more]
foxf21.016e-4733.70forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646... [more]
foxf21.016e-4733.70forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Camk42.540e-4833.57calcium/calmodulin-dependent protein kinase IV [So... [more]
Camk42.540e-4833.57calcium/calmodulin-dependent protein kinase IV [So... [more]
Camk42.540e-4833.57calcium/calmodulin-dependent protein kinase IV [So... [more]
Pskh11.434e-4132.87protein serine kinase H1 [Source:MGI Symbol;Acc:MG... [more]
Camk12.899e-4031.00calcium/calmodulin-dependent protein kinase I [Sou... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P13234|KCC4_RAT2.701e-4833.94Calcium/calmodulin-dependent protein kinase type I... [more]
sp|Q16566|KCC4_HUMAN1.622e-4733.57Calcium/calmodulin-dependent protein kinase type I... [more]
sp|P08414|KCC4_MOUSE4.875e-4733.57Calcium/calmodulin-dependent protein kinase type I... [more]
sp|P25323|MYLKA_DICDI1.688e-4433.96Myosin light chain kinase A OS=Dictyostelium disco... [more]
sp|Q0V7M1|KPSH1_BOVIN3.751e-4132.87Serine/threonine-protein kinase H1 OS=Bos taurus O... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GGV54.128e-5937.09Protein kinase domain-containing protein OS=Macros... [more]
A0A1S3I0263.042e-5636.79calcium/calmodulin-dependent protein kinase type I... [more]
A0A267GU181.762e-5538.18Protein kinase domain-containing protein OS=Macros... [more]
A0A4D6Q5Z31.413e-5437.05Calcium/calmodulin-dependent protein kinase type I... [more]
A0A1I8GVX72.076e-5335.29Protein kinase domain-containing protein OS=Macros... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-60h1.15.966e-5235.02calcium/calmodulin-dependent protein kinase type I... [more]
camk41.756e-4932.75calcium/calmodulin dependent protein kinase IV [So... [more]
si:ch73-60h1.19.673e-4635.46calcium/calmodulin-dependent protein kinase type I... [more]
pnck2.014e-4333.73calcium/calmodulin-dependent protein kinase type 1... [more]
pnck2.014e-4333.73calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003135.13.008e-3429.80pep scaffold:Pmarinus_7.0:GL491838:799:5626:1 gene... [more]
ENSPMAT00000001278.11.478e-2929.02pep scaffold:Pmarinus_7.0:GL476529:253165:339525:-... [more]
dapk11.255e-2828.35death-associated protein kinase 1 [Source:ZFIN;Acc... [more]
ENSPMAT00000008748.11.324e-2727.24pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 ge... [more]
ENSPMAT00000010548.11.356e-2526.35pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CMK11.015e-2730.12Calmodulin-dependent protein kinase; may play a ro... [more]
RAD532.961e-2524.72DNA damage response protein kinase; required for c... [more]
CMK22.731e-2328.08Calmodulin-dependent protein kinase; may play a ro... [more]
IPL12.495e-2229.41Aurora kinase of chromosomal passenger complex; me... [more]
DUN13.553e-2123.99Cell-cycle checkpoint S/T protein kinase; required... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO422766.570e-5434.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362537.295e-4033.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444882.737e-3228.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356115.814e-3127.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330225.000e-3029.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-60h1.17.340e-5033.94calcium/calmodulin-dependent protein kinase type I... [more]
ENSORLT00000012877.21.869e-4028.72calcium/calmodulin-dependent protein kinase type 1... [more]
camk1gb7.618e-4031.21calcium/calmodulin-dependent protein kinase type 1... [more]
camk1db9.546e-4030.28calcium/calmodulin-dependent protein kinase type 1... [more]
camk1b1.226e-3932.10calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030766.10.000e+087.69SMESG000030766.1[more]
SMESG000042100.16.930e-5635.52SMESG000042100.1[more]
SMESG000078937.14.444e-3730.57SMESG000078937.1[more]
SMESG000011366.11.629e-2829.37SMESG000011366.1[more]
SMESG000011366.12.445e-2829.37SMESG000011366.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004608 ID=SMED30004608|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1094bp
CTAGAATAAGATAATTTGTTTATGTGAATCATTAATTAAAATTTCAAGGC
GAAAAAAAATGGATTGCTATTGGATTAAGGACAGTATCAAAAATCAAAAC
GTTGAAGAAATTTATGATATTGGACATGAAATTTTCAGATGCCCATTTCA
AGTTGAAGGAGCATTGTCCGTAGTATCAGCCTGCTATAACAGAACAACTC
GAAAATCTTTTGCCGTAAATGTAATAAAGAAAAAGGTTGGATATTGCCCT
GACAATAATGATATTGGTATTTTTTTGAAATTGAATGACGTAAACCTGAT
GCGAGTTATAGAAGTGTTTGAGACATGGACACATATCAATGTAATACGTG
AGCATTTAACGGGTGATCAACTATTTAATCATTTCAAAAAAAGCGGCCCT
TATACAGAAAGTAAAGTAGGTCGAATAACTAAACAGATTTTATCCGGCAT
TAGATATCTTCACGAGTACAATATTATTCATGGAAACATAAAGTCAGAGA
ATCTAATTATCGTTGATTCGGGAGAAGGGAATCTCATTTTAAAAATATGC
GACCATATTCAATCCACAATTATGCATTACGATATTTACAGACTGTCAAT
AATCGCGCTACCTTCGCTCTGTCCACCAGAGGTGCTTCTATCCCAAATTC
GAACATTCGCACTCGATATGTGGGCCATTGGTGTTTGCGTTTTCATTTTG
CTTTGCGGATATGAGCCTTTTTATCGAGAGAAAATTACAGAACTTTACCG
CGCAGTAATCACTGCCGACTACTCTTACAATTTCAATTGCGAATCTACCA
GCAATGCGTTAAAGGATTTTTTAAACCACCTTTTGAAAGCAGATCCTAAA
TCCCGAATGAATATAATCAATGCCTTAAAGCATCCATGGAATGAGATATG
TATAATGAAAAATCAACCATTGGAATCAATCTATCAACAATATGTTAAAT
GTGTTGGAAGTATTGAAGACCGGATGCATGAAAAAGTTATGGATGACATT
CGTAGAGCCAATGATATATTTGATAAACTCATTTTAAGAAATCCTTATAG
AACCTATAAAAATAAATAAATTACCGTAATAAAAATAATTTAAG
back to top

protein sequence of SMED30004608-orf-1

>SMED30004608-orf-1 ID=SMED30004608-orf-1|Name=SMED30004608-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=337bp
MDCYWIKDSIKNQNVEEIYDIGHEIFRCPFQVEGALSVVSACYNRTTRKS
FAVNVIKKKVGYCPDNNDIGIFLKLNDVNLMRVIEVFETWTHINVIREHL
TGDQLFNHFKKSGPYTESKVGRITKQILSGIRYLHEYNIIHGNIKSENLI
IVDSGEGNLILKICDHIQSTIMHYDIYRLSIIALPSLCPPEVLLSQIRTF
ALDMWAIGVCVFILLCGYEPFYREKITELYRAVITADYSYNFNCESTSNA
LKDFLNHLLKADPKSRMNIINALKHPWNEICIMKNQPLESIYQQYVKCVG
SIEDRMHEKVMDDIRRANDIFDKLILRNPYRTYKNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
IPR011528NERD
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 30..278
e-value: 5.5E-32
score: 122.3
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 33..277
e-value: 6.2E-42
score: 143.8
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 25..278
score: 27.51
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 103..284
e-value: 4.5E-53
score: 182.7
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 33..102
e-value: 4.5E-53
score: 182.7
NoneNo IPR availablePANTHERPTHR24347SERINE/THREONINE-PROTEIN KINASEcoord: 11..294
NoneNo IPR availableTMHMMTMhelixcoord: 200..222
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 33..296