Abhydrolase domain-containing protein 13

Overview
NameAbhydrolase domain-containing protein 13
Smed IDSMED30004603
Length (bp)1307
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Abhydrolase domain-containing protein 13 (SMED30004603) t-SNE clustered cells

Violin plots show distribution of expression levels for Abhydrolase domain-containing protein 13 (SMED30004603) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Abhydrolase domain-containing protein 13 (SMED30004603) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Abhydrolase domain-containing protein 13 (SMED30004603) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004603

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30004603h1SMcG0019313 dd_Smed_v4_6717_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Human
Match: ABHD13 (abhydrolase domain containing 13 [Source:HGNC Symbol;Acc:HGNC:20293])

HSP 1 Score: 200.675 bits (509), Expect = 4.162e-60
Identity = 120/292 (41.10%), Postives = 168/292 (57.53%), Query Frame = 3
Query:  285 SGIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAG-LKPRAEEIFVKT 1157
            +GI+Y F        VL Y  EQ       P  +R+ V +P    +P+E + I T+DG  L+  LI    +     PT+I+ HGNAGN+G RL N   +    +VN+L+ DYRGYG+S G+ SE GLY+D++ +++Y+  R D+D   I +FGRSLGGAVAI +A  N+  ISAI+VENTF SIP  A  LF    +  +P +  +N+F S  K+ + ++P LFISG  D  IPP MM  L+   PS  K L     G HN+TW   GYF ++  F+   +K  + E   KT
Sbjct:   54 AGILYKFQD------VLLYFPEQ-------PSSSRLYVPMPT--GIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGNAGNIGHRLPNALLMLVNLKVNLLLVDYRGYGKSEGEASEEGLYLDSEAVLDYVMTRPDLDKTKIFLFGRSLGGAVAIHLASENSHRISAIMVENTFLSIPHMASTLFSFFPMRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVVKSHSPEEMAKT 330          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Human
Match: ABHD17A (abhydrolase domain containing 17A [Source:HGNC Symbol;Acc:HGNC:28756])

HSP 1 Score: 90.5077 bits (223), Expect = 1.407e-19
Identity = 62/205 (30.24%), Postives = 96/205 (46.83%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAGLKP 1130
            T++F HGNA ++G        L      N+  +DY GYG S+G+PSE  LY D       L  R  I   SI+++G+S+G    +++A R     +A+++ +  TS    A      P   K   F   + F +I KV ++  PVL I G +D  I  +  L L+ +CP   + L  V    HN+      Y E +  F++   P
Sbjct:  113 TVLFSHGNAVDLGQMSSFYIGLGSRLHCNIFSYDYSGYGASSGRPSERNLYADIDAAWQALRTRYGISPDSIILYGQSIGTVPTVDLASRYE--CAAVVLHSPLTSGMRVA-----FPDTKKTYCF---DAFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPL-WVEGAGHNDIELYSQYLERLRRFISQELP 306          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Human
Match: ABHD17C (abhydrolase domain containing 17C [Source:HGNC Symbol;Acc:HGNC:26925])

HSP 1 Score: 88.9669 bits (219), Expect = 5.114e-19
Identity = 59/201 (29.35%), Postives = 95/201 (47.26%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLA 1118
            TL+F HGNA ++G        L      N+  +DY GYG S+GKPSE  LY D       L  R  +   +I+++G+S+G    +++A R     +A+I+ +     P  +      P   K   F   + F SI+K+ ++  PVL I G +D  I  +  L ++ +CP   + L  V    HN+      Y E +  F++
Sbjct:  134 TLLFSHGNAVDLGQMCSFYIGLGSRINCNIFSYDYSGYGVSSGKPSEKNLYADIDAAWQALRTRYGVSPENIILYGQSIGTVPTVDLASRYE--CAAVILHS-----PLMSGLRVAFPDTRKTYCF---DAFPSIDKISKVTSPVLVIHGTEDEVIDFSHGLAMYERCPRAVEPL-WVEGAGHNDIELYAQYLERLKQFIS 323          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Human
Match: ABHD17A (abhydrolase domain containing 17A [Source:HGNC Symbol;Acc:HGNC:28756])

HSP 1 Score: 89.3521 bits (220), Expect = 6.242e-19
Identity = 61/201 (30.35%), Postives = 95/201 (47.26%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLA 1118
            T++F HGNA ++G        L      N+  +DY GYG S+G+PSE  LY D       L  R  I   SI+++G+S+G    +++A R     +A+++ +  TS    A      P   K   F   + F +I KV ++  PVL I G +D  I  +  L L+ +CP   + L  V    HN+      Y E +  F++
Sbjct:  164 TVLFSHGNAVDLGQMSSFYIGLGSRLHCNIFSYDYSGYGASSGRPSERNLYADIDAAWQALRTRYGISPDSIILYGQSIGTVPTVDLASRYE--CAAVVLHSPLTSGMRVA-----FPDTKKTYCF---DAFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPL-WVEGAGHNDIELYSQYLERLRRFIS 353          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Human
Match: ABHD17B (abhydrolase domain containing 17B [Source:HGNC Symbol;Acc:HGNC:24278])

HSP 1 Score: 87.0409 bits (214), Expect = 1.452e-18
Identity = 61/201 (30.35%), Postives = 97/201 (48.26%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLA 1118
            TL+F HGNA ++G        L      N+  +DY GYG S+GKP+E  LY D +     L  R  I   +++I+G+S+G   ++++A R     +A+I+ +  TS    A      P   K   F   + F +I+K+ ++  PVL I G +D  I  +  L LF +C    + L  V    HN+      Y E +  F++
Sbjct:   93 TLLFSHGNAVDLGQMSSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADIEAAWLALRTRYGIRPENVIIYGQSIGTVPSVDLAARYES--AAVILHSPLTSGMRVA-----FPDTKKTYCF---DAFPNIDKISKITSPVLIIHGTEDEVIDFSHGLALFERCQRPVEPL-WVEGAGHNDVELYGQYLERLKQFVS 282          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Celegans
Match: aho-3 (Alpha/beta hydrolase domain-containing protein aho-3 [Source:UniProtKB/Swiss-Prot;Acc:Q21221])

HSP 1 Score: 90.8929 bits (224), Expect = 5.603e-20
Identity = 58/200 (29.00%), Postives = 95/200 (47.50%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFL 1115
            TL+F HGNA ++G     +  L      NV  +DY GYG STGKPSE  LY D       L     +    I+++G+S+G   ++++A R    ++A+++ +   S         ++ +      +   + F SI KV R+K P L I G  D  I  +  + ++ +CP+  + L  V    HN+      Y E + SF+
Sbjct:  114 TLLFSHGNAVDLGQMTSFLYGLGFHLNCNVFSYDYSGYGCSTGKPSEKNLYADITAAFELLKSEFGVPKEKIILYGQSIGTVPSVDLASRED--LAALVLHSPLMS-------GMRVAFPGTTTTWCC-DAFPSIEKVPRVKCPTLVIHGTDDEVIDFSHGVSIYERCPTSVEPL-WVPGAGHNDVELHAAYLERLRSFI 302          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Celegans
Match: Y41E3.18 (pep chromosome:WBcel235:IV:15061929:15065748:-1 gene:WBGene00044003.1 transcript:Y41E3.18.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y41E3.18)

HSP 1 Score: 77.0258 bits (188), Expect = 4.922e-15
Identity = 52/168 (30.95%), Postives = 82/168 (48.81%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQL---YKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISA-IIVENTFTSI-------PAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIP 986
            TL++ H N  ++   LI I  L    +F +  V  +DY GYG S G  SES LY D Q +  +++L + +D   IV+ G S+G A  IE+         A +I++   TSI           KHL K             ++F +I+K+  +++P+L I G+ D  +P
Sbjct:  273 TLLYSHPNGSDLSDHLIGIPSLIDIARFYRCEVYSYDYTGYGISGGIASESNLYSDIQAIYEHITLEKRVDPKKIVLLGYSIGSAATIELLRHEQDQKPAGVILQAPPTSILRVIGGMMGRTKHLEK--------KTCCIDRFVTIDKIHEIQIPILVIHGKADKTVP 432          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Celegans
Match: abhd-12 (ABHydrolase Domain containing homolog [Source:UniProtKB/TrEMBL;Acc:Q965S2])

HSP 1 Score: 67.0106 bits (162), Expect = 5.719e-12
Identity = 49/224 (21.88%), Postives = 98/224 (43.75%), Query Frame = 3
Query:  519 LIFCHGNAGNMG-SRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVAL---RNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRN-----------QFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLN-RVSSGD----HNNTWTRPGYFESINSFLAGLKP 1130
            + + HGN+ +      + +  L   C  +V+ FDYRGYG S G P+E G+  D +T+  Y  L+++     ++++G S+G  V+ ++     R   P   +I+E+ F ++  A  +       + + DF++ +             +S  ++  +  P++ +  E D  +P  +   L+      ++ +  R  S D    H      P   E I  F+  + P
Sbjct:  116 IFYAHGNSFDRTFYHRVEMYNLLSDCNYHVVCFDYRGYGDSEGTPTEKGIVEDTKTV--YEWLKENCGKTPVIVWGHSMGTGVSCKLVQDLSREQQPPCGLILESPFNNLKDAVTNHPIFTVFSWMNDFMVDHIIIRPLNSVGLTMRSDKRIRLVSCPIIILHAEDDKILPVKLGRALYEAAKDAERDIKIREFSSDYGLGHKFICRYPELPEIIEEFVGSVTP 337          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Celegans
Match: abhd-12 (ABHydrolase Domain containing homolog [Source:UniProtKB/TrEMBL;Acc:Q965S2])

HSP 1 Score: 67.0106 bits (162), Expect = 5.719e-12
Identity = 49/224 (21.88%), Postives = 98/224 (43.75%), Query Frame = 3
Query:  519 LIFCHGNAGNMG-SRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVAL---RNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRN-----------QFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLN-RVSSGD----HNNTWTRPGYFESINSFLAGLKP 1130
            + + HGN+ +      + +  L   C  +V+ FDYRGYG S G P+E G+  D +T+  Y  L+++     ++++G S+G  V+ ++     R   P   +I+E+ F ++  A  +       + + DF++ +             +S  ++  +  P++ +  E D  +P  +   L+      ++ +  R  S D    H      P   E I  F+  + P
Sbjct:  116 IFYAHGNSFDRTFYHRVEMYNLLSDCNYHVVCFDYRGYGDSEGTPTEKGIVEDTKTV--YEWLKENCGKTPVIVWGHSMGTGVSCKLVQDLSREQQPPCGLILESPFNNLKDAVTNHPIFTVFSWMNDFMVDHIIIRPLNSVGLTMRSDKRIRLVSCPIIILHAEDDKILPVKLGRALYEAAKDAERDIKIREFSSDYGLGHKFICRYPELPEIIEEFVGSVTP 337          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Celegans
Match: F01D5.8 (pep chromosome:WBcel235:II:14010775:14013802:1 gene:WBGene00008498.1 transcript:F01D5.8a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F01D5.8)

HSP 1 Score: 67.0106 bits (162), Expect = 5.757e-12
Identity = 47/171 (27.49%), Postives = 80/171 (46.78%), Query Frame = 3
Query:  519 LIFCHGNAGNMGSRL----INIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINY-LSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSK 1016
            ++FC  N+ ++G  L    +N        + ++  FDY GYG S+G   E  +Y D + +    L +R D     IV+ G S+G   A+++A  N   ++ +++   FTS       LF        PD    + F+S +K++ +   VL   G+ D  IP +  L L+ K
Sbjct:  137 VLFCQPNSSDLGGFLQPNSMNFVTYANVFETDLYAFDYSGYGFSSGTQGEKNVYADVRAVYEKILEMRPD---KKIVVMGYSIGTTAAVDLAATNPDRLAGVVLIAPFTS----GLRLFS--SKPDKPDTCWADSFKSFDKINNIDTRVLICHGDVDEVIPLSHGLALYEK 298          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Fly
Match: Bem46 (gene:FBgn0025109 transcript:FBtr0077643)

HSP 1 Score: 223.402 bits (568), Expect = 3.178e-69
Identity = 115/284 (40.49%), Postives = 170/284 (59.86%), Query Frame = 3
Query:  282 FSGIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNT--GPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAGLK 1127
            + G +   LF  ++  +  Y ++ +++  D+P  +R+ + +P  +NLP+  +SI+T D   L A+ + Q        PTL++ HGNAGNMG R+ N+  +Y     NVL+ +YRGYG STG P+E GL  DA+  I+YL  R D+D   +++FGRSLGGAV ++VA        +   IVENTF+SIP  A  L   P V  IP+ L +N++ S++K+ +  VP LFISG  D  +PP MM  L++KC S  K L     G HN+TW   GY+++I  FLA L+
Sbjct:   32 YGGYMTLALFAGIILLIFYYAQDLLLYHPDLPANSRIYIPIPTMHNLPHITVSIKTPDDVTLHAFWVTQPEERSKSSPTLLYFHGNAGNMGHRMQNVWGIYHHLHCNVLMVEYRGYGLSTGVPTERGLVTDARAAIDYLHTRHDLDHSQLILFGRSLGGAVVVDVAADTVYGQKLMCAIVENTFSSIPEMAVELVH-PAVKYIPNLLFKNKYHSMSKIGKCSVPFLFISGLADNLVPPRMMRALYTKCGSEIKRLLEFPGGSHNDTWIVDGYYQAIGGFLAELQ 314          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Fly
Match: CG33096 (gene:FBgn0053096 transcript:FBtr0301976)

HSP 1 Score: 97.4413 bits (241), Expect = 1.466e-22
Identity = 60/207 (28.99%), Postives = 102/207 (49.28%), Query Frame = 3
Query:  498 TRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLA 1118
            ++N   TL+F HGNA ++G        L      N+  +DY GYG S GKPSE  LY D +     +  R +I   +I+++G+S+G    +++A R+   + A+I+ +   S         ++ + N    +   + F SI+KV ++K PVL I G  D  I  +  + ++ +CP   +    V    HN+    P Y+E +  FL+
Sbjct:   86 SKNAKYTLLFSHGNAVDLGQMSSFYLTLGSQINCNIFGYDYSGYGMSGGKPSEKNLYADIEAAWQAMRTRFNISPETIILYGQSIGTVPTVDLASRHE--VGAVILHSPLMS-------GLRVVFRNTKRTWFF-DAFPSIDKVAKVKAPVLVIHGTDDEVIDFSHGIGIYERCPKTVEPF-WVEGAGHNDVELHPHYYERLRKFLS 281          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Fly
Match: CG33096 (gene:FBgn0053096 transcript:FBtr0301975)

HSP 1 Score: 97.4413 bits (241), Expect = 1.466e-22
Identity = 60/207 (28.99%), Postives = 102/207 (49.28%), Query Frame = 3
Query:  498 TRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLA 1118
            ++N   TL+F HGNA ++G        L      N+  +DY GYG S GKPSE  LY D +     +  R +I   +I+++G+S+G    +++A R+   + A+I+ +   S         ++ + N    +   + F SI+KV ++K PVL I G  D  I  +  + ++ +CP   +    V    HN+    P Y+E +  FL+
Sbjct:   86 SKNAKYTLLFSHGNAVDLGQMSSFYLTLGSQINCNIFGYDYSGYGMSGGKPSEKNLYADIEAAWQAMRTRFNISPETIILYGQSIGTVPTVDLASRHE--VGAVILHSPLMS-------GLRVVFRNTKRTWFF-DAFPSIDKVAKVKAPVLVIHGTDDEVIDFSHGIGIYERCPKTVEPF-WVEGAGHNDVELHPHYYERLRKFLS 281          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Fly
Match: CG33096 (gene:FBgn0053096 transcript:FBtr0344622)

HSP 1 Score: 97.4413 bits (241), Expect = 1.466e-22
Identity = 60/207 (28.99%), Postives = 102/207 (49.28%), Query Frame = 3
Query:  498 TRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLA 1118
            ++N   TL+F HGNA ++G        L      N+  +DY GYG S GKPSE  LY D +     +  R +I   +I+++G+S+G    +++A R+   + A+I+ +   S         ++ + N    +   + F SI+KV ++K PVL I G  D  I  +  + ++ +CP   +    V    HN+    P Y+E +  FL+
Sbjct:   86 SKNAKYTLLFSHGNAVDLGQMSSFYLTLGSQINCNIFGYDYSGYGMSGGKPSEKNLYADIEAAWQAMRTRFNISPETIILYGQSIGTVPTVDLASRHE--VGAVILHSPLMS-------GLRVVFRNTKRTWFF-DAFPSIDKVAKVKAPVLVIHGTDDEVIDFSHGIGIYERCPKTVEPF-WVEGAGHNDVELHPHYYERLRKFLS 281          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Fly
Match: CG33096 (gene:FBgn0053096 transcript:FBtr0114464)

HSP 1 Score: 97.4413 bits (241), Expect = 1.466e-22
Identity = 60/207 (28.99%), Postives = 102/207 (49.28%), Query Frame = 3
Query:  498 TRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLA 1118
            ++N   TL+F HGNA ++G        L      N+  +DY GYG S GKPSE  LY D +     +  R +I   +I+++G+S+G    +++A R+   + A+I+ +   S         ++ + N    +   + F SI+KV ++K PVL I G  D  I  +  + ++ +CP   +    V    HN+    P Y+E +  FL+
Sbjct:   86 SKNAKYTLLFSHGNAVDLGQMSSFYLTLGSQINCNIFGYDYSGYGMSGGKPSEKNLYADIEAAWQAMRTRFNISPETIILYGQSIGTVPTVDLASRHE--VGAVILHSPLMS-------GLRVVFRNTKRTWFF-DAFPSIDKVAKVKAPVLVIHGTDDEVIDFSHGIGIYERCPKTVEPF-WVEGAGHNDVELHPHYYERLRKFLS 281          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Zebrafish
Match: abhd13 (abhydrolase domain containing 13 [Source:NCBI gene;Acc:561333])

HSP 1 Score: 204.912 bits (520), Expect = 6.594e-62
Identity = 114/288 (39.58%), Postives = 164/288 (56.94%), Query Frame = 3
Query:  282 FSGIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAG-LKPRAEE 1142
            + G +   L +A L  +L   ++ +++  D P  +R+ V +P    +P+E + I T+DG  L+  L+          PT+++ HGNAGN+G R+ N   +    + NV++ DYRGYG+S G PSE GLY DA+  ++Y+  R DID   +V+FGRSLGGAVAI +A  N   ++AI+VENTF SIP  A  LF    +  +P +  +N+F S   V   ++P LFISG  D  IPP MM  L+   PS  K L     G HN+TW   GYF ++  F+   LK  A E
Sbjct:   40 YGGFVLLGLILASLAGILYKFQDVLLYFPDQPSSSRLYVPMPT--GIPHENVYIRTKDGIRLNLILLRYTGENPAGAPTILYFHGNAGNIGHRVPNALLMLVNLKANVVLVDYRGYGKSEGDPSEDGLYQDAEATLDYVMTRPDIDKTKVVLFGRSLGGAVAIRLASCNPHRVAAIMVENTFLSIPHMAATLFSFFPMRYLPLWCYKNKFLSYRHVVPCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPEGTHNDTWQCQGYFSALEQFMKELLKSHARE 325          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Zebrafish
Match: abhd17ab (abhydrolase domain containing 17Ab [Source:ZFIN;Acc:ZDB-GENE-081105-136])

HSP 1 Score: 90.5077 bits (223), Expect = 8.040e-20
Identity = 63/201 (31.34%), Postives = 94/201 (46.77%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLA 1118
            T++F HGNA ++G        L      N+  +DY GYG STGKPSE  LY D       L  R  I   +I+++G+S+G    +++A R     +A+I+ +  TS    A      P   K   F   + F +I KV ++  PVL I G +D  I  +  L L+ +CP   + L  V    HN+      Y E +  F+ 
Sbjct:  101 TVLFSHGNAVDLGQMSSFYIGLGTRINCNIFSYDYSGYGVSTGKPSEKNLYADIDAAWQALRSRYGISPENIILYGQSIGTVPTVDLASRYE--CAAVILHSPLTSGMRVA-----FPDTKKTYCF---DAFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPL-WVEGAGHNDIELYTQYLERLRRFIG 290          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Zebrafish
Match: abhd17c (abhydrolase domain containing 17C [Source:NCBI gene;Acc:393126])

HSP 1 Score: 89.7373 bits (221), Expect = 1.248e-19
Identity = 61/200 (30.50%), Postives = 95/200 (47.50%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFL 1115
            TL+F HGNA ++G        L      NV  +DY GYG STGKPSE  LY D +     L  +  +   +I+++G+S+G    +++A R     +A+I+ +     P  +      P   K   F   + F SI+KV ++  PVL I G +D  I  +  L ++ +CP   + L  V    HN+      Y E +  F+
Sbjct:   99 TLLFSHGNAVDLGQMCSFYIGLGSRINCNVFSYDYSGYGVSTGKPSEKNLYADIEAAWQVLRNKYGVTPENIILYGQSIGTVPTVDLASRYE--CAAVILHS-----PLMSGLRVAFPDTRKTYCF---DAFPSIDKVSKVASPVLVIHGTEDEVIDFSHGLAIYERCPRAVEPL-WVEGAGHNDIELYAQYLERLKQFI 287          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Zebrafish
Match: abhd17c (abhydrolase domain containing 17C [Source:NCBI gene;Acc:393126])

HSP 1 Score: 89.7373 bits (221), Expect = 1.248e-19
Identity = 61/200 (30.50%), Postives = 95/200 (47.50%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFL 1115
            TL+F HGNA ++G        L      NV  +DY GYG STGKPSE  LY D +     L  +  +   +I+++G+S+G    +++A R     +A+I+ +     P  +      P   K   F   + F SI+KV ++  PVL I G +D  I  +  L ++ +CP   + L  V    HN+      Y E +  F+
Sbjct:   99 TLLFSHGNAVDLGQMCSFYIGLGSRINCNVFSYDYSGYGVSTGKPSEKNLYADIEAAWQVLRNKYGVTPENIILYGQSIGTVPTVDLASRYE--CAAVILHS-----PLMSGLRVAFPDTRKTYCF---DAFPSIDKVSKVASPVLVIHGTEDEVIDFSHGLAIYERCPRAVEPL-WVEGAGHNDIELYAQYLERLKQFI 287          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Zebrafish
Match: abhd17b (abhydrolase domain containing 17B [Source:ZFIN;Acc:ZDB-GENE-040718-244])

HSP 1 Score: 88.9669 bits (219), Expect = 1.914e-19
Identity = 62/201 (30.85%), Postives = 97/201 (48.26%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLA 1118
            TL+F HGNA ++G        L      NV  +DY GYG S+GKPSE  LY D     + L  R  I   +++I+G+S+G   ++++A R     +A+++ +  TS    A      P   K   F   + F +I+K+ ++  PVL I G +D  I  +  L L+ +C    + L  V    HN+      Y E +  F+A
Sbjct:   93 TLLFSHGNAVDLGQMSSFYIGLGSRINCNVFSYDYSGYGASSGKPSEKNLYADVDAAWHALRTRYGIRPENVIIYGQSIGTVPSVDLASRYES--AAVVLHSPLTSGMRVA-----FPDTKKTYCF---DAFPNIDKISKVTSPVLVIHGTEDEVIDFSHGLALYERCQRPVEPL-WVEGAGHNDVELYGQYLERLKQFVA 282          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Xenopus
Match: abhd13 (abhydrolase domain containing 13 [Source:NCBI gene;Acc:100127876])

HSP 1 Score: 202.986 bits (515), Expect = 5.182e-61
Identity = 112/282 (39.72%), Postives = 171/282 (60.64%), Query Frame = 3
Query:  282 FSGIIYSFL-FIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAGL 1124
            + G+I   L F+++   + ++ +  + FP D P  +R+ + +P    +P+E + I+T+D   L+  L+    +  N  PT+I+ HGNAGN+G RL N   +    +VN+L+ DYRGYG+S G+PSE GLY+D++ +++Y+  R DID   I++FGRSLGGAVAI +A  N   I A+++ENTF SIP  A  LF +  +  +P +  +N+F S  K+ + ++P LFISG  D  IPP MM  L+   PS  K L     G HN+TW   GYF ++  F+  L
Sbjct:   40 YGGVILLLLIFVSIAGILFKFQDVLLYFP-DQPSSSRLYIPMPT--GIPHENIFIKTKDNVRLNLILLRYTGDNSNFSPTIIYFHGNAGNIGHRLPNALLMLVNLKVNLLLVDYRGYGKSDGEPSEEGLYLDSEAVLDYVMTRPDIDKTKIILFGRSLGGAVAIHLASENAHRICALMLENTFLSIPHMASTLFSVLPMRYLPLWCYKNKFLSYRKILQCRMPSLFISGLSDQLIPPFMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEL 318          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Xenopus
Match: abhd17c (abhydrolase domain containing 17C [Source:NCBI gene;Acc:448170])

HSP 1 Score: 91.6633 bits (226), Expect = 3.450e-20
Identity = 65/236 (27.54%), Postives = 107/236 (45.34%), Query Frame = 3
Query:  429 EELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAGLKPRA 1136
            E     TE G  L    +     +R    T++F HGNA ++G        L      N+  +DY GYG S+GKPSE  LY D +   + L  R  +   +I+++G+S+G    +++A R     +A+I+ +     P  +      P   K   F   + F SI+K+ ++  PVL I G +D  I  +  L ++ +CP   + L  V    HN+      Y E +  F++   P +
Sbjct:   71 EVFRWRTERGSCLGCMFVRCSPGSRY---TVLFSHGNAVDLGQMCSFYIGLGTRINCNIFSYDYSGYGVSSGKPSEKNLYADIEAAWHALRTRYGVTPENIILYGQSIGTVPTVDLASRYE--CAAVILHS-----PLMSGLRVAFPDTRKTYCF---DAFPSIDKISKVTSPVLIIHGTEDEVIDFSHGLAMYERCPRAVEPL-WVEGAGHNDIELYAQYLERLKQFISHELPNS 292          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Xenopus
Match: abhd17c (abhydrolase domain containing 17C [Source:NCBI gene;Acc:448170])

HSP 1 Score: 91.2781 bits (225), Expect = 7.242e-20
Identity = 64/230 (27.83%), Postives = 105/230 (45.65%), Query Frame = 3
Query:  429 EELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLA 1118
            E     TE G  L    +     +R    T++F HGNA ++G        L      N+  +DY GYG S+GKPSE  LY D +   + L  R  +   +I+++G+S+G    +++A R     +A+I+ +     P  +      P   K   F   + F SI+K+ ++  PVL I G +D  I  +  L ++ +CP   + L  V    HN+      Y E +  F++
Sbjct:   89 EVFRWRTERGSCLGCMFVRCSPGSRY---TVLFSHGNAVDLGQMCSFYIGLGTRINCNIFSYDYSGYGVSSGKPSEKNLYADIEAAWHALRTRYGVTPENIILYGQSIGTVPTVDLASRYE--CAAVILHS-----PLMSGLRVAFPDTRKTYCF---DAFPSIDKISKVTSPVLIIHGTEDEVIDFSHGLAMYERCPRAVEPL-WVEGAGHNDIELYAQYLERLKQFIS 304          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Xenopus
Match: abhd17a (abhydrolase domain containing 17A [Source:NCBI gene;Acc:496639])

HSP 1 Score: 90.1225 bits (222), Expect = 1.332e-19
Identity = 61/200 (30.50%), Postives = 97/200 (48.50%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFL 1115
            TL+F HGNA ++G        L      N+  +DY GYG S+G+PSE  LY D     + L  R  I   +I+++G+S+G   A+++A R     +A+I+ +  TS          +P   K   F   + F +I+KV ++  PVL + G +D  I  +  L L+ +CP   + L  V    HN+      Y E +  F+
Sbjct:  107 TLLFSHGNAVDLGQMTSFYLDLGTRINCNIFSYDYSGYGCSSGRPSEKNLYADIDAAWHALRTRYGISPENILLYGQSIGTVPAVDLASRYE--CAAVILHSALTS-----GMRVVLPDTKKTYCF---DAFPNIDKVSKITSPVLIMHGTEDEVIDFSHGLALYERCPKTVEPL-WVEGAGHNDIEQYSQYLERLKRFI 295          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Xenopus
Match: abhd17b (abhydrolase domain containing 17B [Source:NCBI gene;Acc:448619])

HSP 1 Score: 86.6557 bits (213), Expect = 1.931e-18
Identity = 62/201 (30.85%), Postives = 94/201 (46.77%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLA 1118
            TL+F HGNA ++G        L      N+  +DY GYG S+GKPSE  LY D       L  R  I    ++I+G+S+G   ++++A R     +A+I+ +  TS    A      P   K   F   + F +I+K+ ++  PVL I G +D  I  +  L LF +C    + L  V    HN+      Y E +  F+ 
Sbjct:   93 TLLFSHGNAVDLGQMSSFYIGLGSRINCNIFSYDYSGYGSSSGKPSEKNLYADIDAAWIALRTRYGIRPEHVIIYGQSIGTVPSVDLAARYES--AAVILHSPLTSGMRVA-----FPDTKKTYCF---DAFPNIDKISKITSPVLIIHGTEDEVIDFSHGLALFERCQRPVEPL-WVEGAGHNDVELYGQYLERLKQFVT 282          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Mouse
Match: Abhd13 (abhydrolase domain containing 13 [Source:MGI Symbol;Acc:MGI:1916154])

HSP 1 Score: 208.764 bits (530), Expect = 1.860e-63
Identity = 118/295 (40.00%), Postives = 170/295 (57.63%), Query Frame = 3
Query:  276 VNFSGIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAG-LKPRAEEIFVKT 1157
            V+ +GI+Y F        VL Y  EQ       P  +R+ V +P    +P+E + I T+DG  L+  L+    +     PT+I+ HGNAGN+G RL N   +    +VN+++ DYRGYG+S G+ SE GLY+D++ +++Y+  R D+D   + +FGRSLGGAVAI +A  N+  ISAI+VENTF SIP  A  LF    +  +P +  +N+F S  K+ + ++P LFISG  D  IPP MM  L+   PS  K L     G HN+TW   GYF ++  F+   +K  + E   KT
Sbjct:   51 VSIAGILYKFQD------VLLYFPEQ-------PSSSRLYVPMPT--GIPHENIFIRTKDGVRLNLILVRYTGDNSPYCPTIIYFHGNAGNIGHRLPNALLMLVNLRVNLVLVDYRGYGKSEGEASEEGLYLDSEAVLDYVMTRPDLDKTKVFLFGRSLGGAVAIHLASENSHRISAIMVENTFLSIPHMASTLFSFFPMRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVIKSHSPEDMTKT 330          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Mouse
Match: Abhd13 (abhydrolase domain containing 13 [Source:MGI Symbol;Acc:MGI:1916154])

HSP 1 Score: 208.764 bits (530), Expect = 1.860e-63
Identity = 118/295 (40.00%), Postives = 170/295 (57.63%), Query Frame = 3
Query:  276 VNFSGIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAG-LKPRAEEIFVKT 1157
            V+ +GI+Y F        VL Y  EQ       P  +R+ V +P    +P+E + I T+DG  L+  L+    +     PT+I+ HGNAGN+G RL N   +    +VN+++ DYRGYG+S G+ SE GLY+D++ +++Y+  R D+D   + +FGRSLGGAVAI +A  N+  ISAI+VENTF SIP  A  LF    +  +P +  +N+F S  K+ + ++P LFISG  D  IPP MM  L+   PS  K L     G HN+TW   GYF ++  F+   +K  + E   KT
Sbjct:   51 VSIAGILYKFQD------VLLYFPEQ-------PSSSRLYVPMPT--GIPHENIFIRTKDGVRLNLILVRYTGDNSPYCPTIIYFHGNAGNIGHRLPNALLMLVNLRVNLVLVDYRGYGKSEGEASEEGLYLDSEAVLDYVMTRPDLDKTKVFLFGRSLGGAVAIHLASENSHRISAIMVENTFLSIPHMASTLFSFFPMRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVIKSHSPEDMTKT 330          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Mouse
Match: Abhd17a (abhydrolase domain containing 17A [Source:MGI Symbol;Acc:MGI:106388])

HSP 1 Score: 90.1225 bits (222), Expect = 1.299e-19
Identity = 62/205 (30.24%), Postives = 96/205 (46.83%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAGLKP 1130
            T++F HGNA ++G        L      N+  +DY GYG S+G+PSE  LY D       L  R  I   SI+++G+S+G    +++A R     +A+++ +  TS    A      P   K   F   + F +I KV ++  PVL I G +D  I  +  L L+ +CP   + L  V    HN+      Y E +  F++   P
Sbjct:  113 TVLFSHGNAVDLGQMCSFYVGLGTRIGCNIFSYDYSGYGISSGRPSEKNLYADIDAAWQALRTRYGISPDSIILYGQSIGTVPTVDLASRYE--CAAVVLHSPLTSGMRVA-----FPDTKKTYCF---DAFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPL-WVEGAGHNDIELYSQYLERLRRFISQELP 306          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Mouse
Match: Abhd17c (abhydrolase domain containing 17C [Source:MGI Symbol;Acc:MGI:1917428])

HSP 1 Score: 89.3521 bits (220), Expect = 2.422e-19
Identity = 60/207 (28.99%), Postives = 97/207 (46.86%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAGLKPRA 1136
            TL+F HGNA ++G        L      N+  +DY GYG S+GKPSE  LY D       L  R  +   +I+++G+S+G    +++A R     +A+I+ +     P  +      P   K   F   + F SI+K+ ++  PVL I G +D  I  +  L ++ +CP   + L  V    HN+      Y E +  F++   P +
Sbjct:  125 TLLFSHGNAVDLGQMCSFYIGLGSRINCNIFSYDYSGYGVSSGKPSEKNLYADIDAAWQALRTRYGVSPENIILYGQSIGTVPTVDLASRYE--CAAVILHS-----PLMSGLRVAFPDTRKTYCF---DAFPSIDKISKVTSPVLVIHGTEDEVIDFSHGLAMYERCPRAVEPL-WVEGAGHNDIELYAQYLERLKQFISHELPNS 320          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Mouse
Match: Abhd17b (abhydrolase domain containing 17B [Source:MGI Symbol;Acc:MGI:1917816])

HSP 1 Score: 87.4261 bits (215), Expect = 6.795e-19
Identity = 61/201 (30.35%), Postives = 97/201 (48.26%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLA 1118
            TL+F HGNA ++G        L      N+  +DY GYG S+GKP+E  LY D +     L  R  I   +++I+G+S+G   ++++A R     +A+I+ +  TS    A      P   K   F   + F +I+K+ ++  PVL I G +D  I  +  L LF +C    + L  V    HN+      Y E +  F++
Sbjct:   93 TLLFSHGNAVDLGQMSSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADVEAAWLALRTRYGIRPENVIIYGQSIGTVPSVDLAARYES--AAVILHSPLTSGMRVA-----FPDTKKTYCF---DAFPNIDKISKITSPVLIIHGTEDEVIDFSHGLALFERCQRPVEPL-WVEGAGHNDVELYGQYLERLKQFVS 282          
BLAST of Abhydrolase domain-containing protein 13 vs. UniProt/SwissProt
Match: sp|Q5ZJL8|ABHDD_CHICK (Protein ABHD13 OS=Gallus gallus OX=9031 GN=ABHD13 PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 1.168e-63
Identity = 113/295 (38.31%), Postives = 173/295 (58.64%), Query Frame = 3
Query:  276 VNFSGIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAG-LKPRAEEIFVKT 1157
            V+ +GI+Y F             ++ +++  + P  +R+ V +P    +P+E + I+T+DG +L+  L+    +     PT+I+ HGNAGN+G RL N   +    +VN+++ DYRGYG+S G+ SE GLY+D++ +++Y+  R D+D   I +FGRSLGGAVAI +A  N+  ISAI+VENTF SIP  A  LF    +  +P +  +N+F S  K+ + ++P LFISG  D  IPP MM  L+   P+  K L     G HN+TW   GYF ++  F+   +K  + E   KT
Sbjct:   51 VSIAGILYKF-------------QDMLLYFPEQPSSSRLYVPMPT--GIPHENIFIKTKDGVLLNLILLRYTGDNAAYSPTIIYFHGNAGNIGHRLPNALLMLVNLKVNLILVDYRGYGKSEGEASEEGLYIDSEAVLDYVMTRSDLDKTKIFLFGRSLGGAVAIHLASENSHRISAIMVENTFLSIPHMASTLFSFFPMRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPARTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVIKSHSSEEMAKT 330          
BLAST of Abhydrolase domain-containing protein 13 vs. UniProt/SwissProt
Match: sp|Q80UX8|ABHDD_MOUSE (Protein ABHD13 OS=Mus musculus OX=10090 GN=Abhd13 PE=2 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 1.301e-62
Identity = 118/295 (40.00%), Postives = 170/295 (57.63%), Query Frame = 3
Query:  276 VNFSGIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAG-LKPRAEEIFVKT 1157
            V+ +GI+Y F        VL Y  EQ       P  +R+ V +P    +P+E + I T+DG  L+  L+    +     PT+I+ HGNAGN+G RL N   +    +VN+++ DYRGYG+S G+ SE GLY+D++ +++Y+  R D+D   + +FGRSLGGAVAI +A  N+  ISAI+VENTF SIP  A  LF    +  +P +  +N+F S  K+ + ++P LFISG  D  IPP MM  L+   PS  K L     G HN+TW   GYF ++  F+   +K  + E   KT
Sbjct:   51 VSIAGILYKFQD------VLLYFPEQ-------PSSSRLYVPMPT--GIPHENIFIRTKDGVRLNLILVRYTGDNSPYCPTIIYFHGNAGNIGHRLPNALLMLVNLRVNLVLVDYRGYGKSEGEASEEGLYLDSEAVLDYVMTRPDLDKTKVFLFGRSLGGAVAIHLASENSHRISAIMVENTFLSIPHMASTLFSFFPMRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVIKSHSPEDMTKT 330          
BLAST of Abhydrolase domain-containing protein 13 vs. UniProt/SwissProt
Match: sp|Q6IRP4|ABHDD_XENLA (Protein ABHD13 OS=Xenopus laevis OX=8355 GN=abhd13 PE=2 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 2.875e-62
Identity = 110/282 (39.01%), Postives = 171/282 (60.64%), Query Frame = 3
Query:  282 FSGIIYSFL-FIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAGL 1124
            + G+I   L F+++   + ++ +  + FP D P  +R+ + +P    +P+E + I+T+D   L+  L+    +  +  PT+I+ HGNAGN+G RL N   +    +VN+++ DYRGYG+S G+PSE GLY+D++ +++Y+  R DID   I++FGRSLGGAVAI +A  N   I A+++ENTF SIP  A  LF +  +  +P +  +N+F S  K+ + ++P LFISG  D  IPP MM  L+   PS  K L     G HN+TW   GYF ++  F+  L
Sbjct:   40 YGGVILLLLIFVSIAGILFKFQDVLLYFP-DQPSSSRLYIPMPT--GIPHENIFIKTKDNIRLNLILLRYTGDNSSFSPTIIYFHGNAGNIGHRLPNALLMLVNLKVNLILVDYRGYGKSDGEPSEEGLYMDSEAVLDYVMTRPDIDKTKIILFGRSLGGAVAIHLASENAHRICALVLENTFLSIPHMASTLFSVLPMRYLPLWCYKNKFLSYRKIVQCRMPSLFISGLSDQLIPPFMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEL 318          
BLAST of Abhydrolase domain-containing protein 13 vs. UniProt/SwissProt
Match: sp|Q32LS6|ABHDD_DANRE (Protein ABHD13 OS=Danio rerio OX=7955 GN=abhd13 PE=2 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 4.978e-61
Identity = 114/288 (39.58%), Postives = 164/288 (56.94%), Query Frame = 3
Query:  282 FSGIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAG-LKPRAEE 1142
            + G +   L +A L  +L   ++ +++  D P  +R+ V +P    +P+E + I T+DG  L+  L+          PT+++ HGNAGN+G R+ N   +    + NV++ DYRGYG+S G PSE GLY DA+  ++Y+  R DID   +V+FGRSLGGAVAI +A  N   ++AI+VENTF SIP  A  LF    +  +P +  +N+F S   V   ++P LFISG  D  IPP MM  L+   PS  K L     G HN+TW   GYF ++  F+   LK  A E
Sbjct:   40 YGGFVLLGLILASLAGILYKFQDVLLYFPDQPSSSRLYVPMPT--GIPHENVYIRTKDGIRLNLILLRYTGENPAGAPTILYFHGNAGNIGHRVPNALLMLVNLKANVVLVDYRGYGKSEGDPSEDGLYQDAEATLDYVMTRPDIDKTKVVLFGRSLGGAVAIRLASCNPHRVAAIMVENTFLSIPHMAATLFSFFPMRYLPLWCYKNKFLSYRHVVPCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPEGTHNDTWQCQGYFSALEQFMKELLKSHARE 325          
BLAST of Abhydrolase domain-containing protein 13 vs. UniProt/SwissProt
Match: sp|Q7L211|ABHDD_HUMAN (Protein ABHD13 OS=Homo sapiens OX=9606 GN=ABHD13 PE=2 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 1.999e-59
Identity = 120/292 (41.10%), Postives = 168/292 (57.53%), Query Frame = 3
Query:  285 SGIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAG-LKPRAEEIFVKT 1157
            +GI+Y F        VL Y  EQ       P  +R+ V +P    +P+E + I T+DG  L+  LI    +     PT+I+ HGNAGN+G RL N   +    +VN+L+ DYRGYG+S G+ SE GLY+D++ +++Y+  R D+D   I +FGRSLGGAVAI +A  N+  ISAI+VENTF SIP  A  LF    +  +P +  +N+F S  K+ + ++P LFISG  D  IPP MM  L+   PS  K L     G HN+TW   GYF ++  F+   +K  + E   KT
Sbjct:   54 AGILYKFQD------VLLYFPEQ-------PSSSRLYVPMPT--GIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGNAGNIGHRLPNALLMLVNLKVNLLLVDYRGYGKSEGEASEEGLYLDSEAVLDYVMTRPDLDKTKIFLFGRSLGGAVAIHLASENSHRISAIMVENTFLSIPHMASTLFSFFPMRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVVKSHSPEEMAKT 330          
BLAST of Abhydrolase domain-containing protein 13 vs. TrEMBL
Match: E2C147 (Abhydrolase domain-containing protein 13 OS=Harpegnathos saltator OX=610380 GN=EAI_07557 PE=4 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 7.124e-80
Identity = 129/284 (45.42%), Postives = 184/284 (64.79%), Query Frame = 3
Query:  282 FSGIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALR--NTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAGLK 1127
            + G++  FL       +L + E+Q+++  ++P  +R+ V  P+ ++LPY+ +  ++ DG +L  + I Q  N    VPT++F HGNAGNMG RL NI  LY   Q N+L+ +YRGYG S G PSE GLY+DAQ  INYLS R DI++  I++FGRSLGGAVAI++A++  N+  I  +I+ENTFTSIP  A    K  ++  +P F+ +N++ SI KV  + VP LFISG  D  +PP MM DL+  C SG K L  V+ G HN TW +PGY++ I +FL  L+
Sbjct:   41 YGGVLAFFLLCFATTGILYHREDQLLYHPEMPAHSRVYVPAPSIFSLPYQSIYTKSGDGTMLHMFFISQPENRMKNVPTILFFHGNAGNMGHRLQNILGLYYNVQCNILMLEYRGYGLSQGSPSEEGLYMDAQAGINYLSTRTDINTNEIIVFGRSLGGAVAIDLAMKEENSRRIWCLILENTFTSIPDMAALFLKSKFLQHLPLFVYKNKYLSILKVRSIIVPTLFISGLADTLVPPRMMQDLYKTCRSGHKRLLPVAGGTHNETWCQPGYYQHICAFLTELR 324          
BLAST of Abhydrolase domain-containing protein 13 vs. TrEMBL
Match: A0A154NZ25 (Abhydrolase domain-containing protein 13 OS=Dufourea novaeangliae OX=178035 GN=WN55_09640 PE=4 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 6.242e-77
Identity = 126/284 (44.37%), Postives = 180/284 (63.38%), Query Frame = 3
Query:  282 FSGIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVAL--RNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAGLK 1127
            + G+   FL       +L + E+Q+++  + P  +R+ V  P+ ++LPY+ +   + DG  L  + I Q  +   +VPTL+F HGNAGN+G RL N  +LY   Q NVL+ +YRGYG S G PSE GLY+DA+  I YLS R DI++  I++FGRSLGGAVAI +A    N+  I  +I+ENTFTSIP  A  LF + ++  +P FL +N++ SI KV  + VP LFISG  D  +PP MM DL+  C S  K +  V+ G HN TW +PGY+++I +FL+ L+
Sbjct:   41 YGGLSAFFLLCFATTGILYHREDQLVYRPEWPANSRVYVPAPSVFSLPYQNIYTRSGDGTTLHMFFIAQPKDKAKQVPTLLFLHGNAGNIGHRLQNAVELYHAVQCNVLMLEYRGYGLSQGSPSEEGLYMDARAGIEYLSSRTDINTNEIIVFGRSLGGAVAINLATIPENSQKIWCLILENTFTSIPDMAALLFGLKFLQYLPLFLYKNKYLSILKVRSVTVPTLFISGLADTLVPPRMMQDLYKNCRSSYKKILPVTGGTHNETWCQPGYYQNICTFLSALR 324          
BLAST of Abhydrolase domain-containing protein 13 vs. TrEMBL
Match: T1G0W9 (Hydrolase_4 domain-containing protein OS=Helobdella robusta OX=6412 GN=20214717 PE=4 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 1.137e-75
Identity = 130/284 (45.77%), Postives = 180/284 (63.38%), Query Frame = 3
Query:  291 IIY-SFLFIALLFF----VLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPI----SAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFL 1115
            IIY SF+FI L+F      L +I++ +++  +VP E+R+ V  P+++ LPYE + + T DG  L AYLI Q     +   T++F HGNAGN+G RL NI  +Y +C VNVL+ +YRGYG S G PSESGLY+DAQT ++Y+  R D++   I+IFGRSLGGAVAI  A   +  +    +++IVENTFT+I    K L  +  ++  P FL++N F S+  +  +KVP LFI G KD  +PP MM  LF K  S  K +  V +G HN  W  PGY++ INSF 
Sbjct:   38 IIYGSFVFIVLIFCSALGFLYHIQDSLLYQPNVPTESRLFVDNPSRFGLPYENIHLHTADGLELHAYLIKQPAPQSHNAYTVVFLHGNAGNIGHRLYNIHHMYLYCGVNVLMPEYRGYGLSQGTPSESGLYIDAQTAVDYILTRSDLNHSKIIIFGRSLGGAVAINAAASTSLHLGVQPASLIVENTFTNIRDMGKVLTGLSIIDHCPTFLIKNNFPSVEAIQHVKVPTLFICGLKDELVPPDMMRQLFEKSGSLLKRMFLVPNGTHNECWRFPGYYDQINSFF 321          
BLAST of Abhydrolase domain-containing protein 13 vs. TrEMBL
Match: A0A423SWU8 (Abhydrolase domain-containing protein 13 OS=Penaeus vannamei OX=6689 GN=C7M84_013200 PE=4 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 3.983e-75
Identity = 123/292 (42.12%), Postives = 180/292 (61.64%), Query Frame = 3
Query:  276 VNFSGIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRN--TGPISAIIVENTFTSIPAAAKHLFK-IPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAGLKPRAEE 1142
            + FSGI+Y              I +Q+++  + PP++R+ V  P+   LP E L +   DG  L A  + Q        PT I+ HGNAGN+G RL N+ ++Y++  VN+L+ +YRGYG S G PSE GLY+DAQ  INYL  R DID   I+IFGRSLGGAVA++   R+  +  ++A+I+ENTFTSIP  AK LF  + ++ K+P++  +N++ S  K+ R+ VP LF+SG+ D+ +PP MM++L+  C S  K L + + G HN TW  PGY++ +  FL  L  R  +
Sbjct:   55 IAFSGIVYQ-------------ISDQLVYWPNFPPDSRVLVQPPSSMGLPAENLYLYARDGTKLHAVFVKQASGAVKSAPTFIYFHGNAGNLGHRLSNVYEMYRWLHVNLLLLEYRGYGLSEGSPSEEGLYLDAQAAINYLKTRSDIDQNKIIIFGRSLGGAVAVDCVSRSEISSRVAAVILENTFTSIPDMAKVLFSNVKFLAKLPEWCHKNKYLSKYKMCRVVVPTLFLSGQADSLVPPRMMMELYHCCASPAKRLMQFTQGSHNETWKCPGYYQVLLHFLDELFQRTTQ 333          
BLAST of Abhydrolase domain-containing protein 13 vs. TrEMBL
Match: A0A067RJM1 (Abhydrolase domain-containing protein 13 OS=Zootermopsis nevadensis OX=136037 GN=L798_04870 PE=4 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 5.546e-75
Identity = 119/286 (41.61%), Postives = 180/286 (62.94%), Query Frame = 3
Query:  282 FSGIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALR--NTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAGLKPR 1133
            + GI+   L       +L + E+ +++  ++P  +R+ V +P+ + LPYE + + + DG +L  + I Q  +   + PT+++ HGNAGNMG RL N+   Y++ Q N+L+ +YRGYG S G PSE GLY+DA+T +++LSLR D++   I++FGRSLGGAVAI+VA R      I  +I+ENTFTSIP  AK L     +  +P    +N+F S+ K+  L VP +F+SG  D  +PP MM++L  +C S  K L +  SG HN TWT PGY++S+ +FL   + R
Sbjct:   66 YGGILAFLLLCFATTGILYHTEDNLLYHPEMPAHSRVFVPVPSLFGLPYENVFVRSADGTLLHLFFIRQPGDQAAEAPTILYLHGNAGNMGHRLQNVLGFYQYLQCNILMLEYRGYGLSQGSPSEEGLYMDARTALDFLSLRHDVNHKEIIVFGRSLGGAVAIDVAARPEYASRIWCLILENTFTSIPDMAKVLIGWRVLQYLPLCFYKNKFLSVWKMAHLAVPTVFVSGLADTLVPPRMMVELHQRCGSHHKQLVQFDSGTHNETWTNPGYYQSLATFLQDARIR 351          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Cavefish
Match: abhd13 (abhydrolase domain containing 13 [Source:NCBI gene;Acc:103037823])

HSP 1 Score: 201.445 bits (511), Expect = 9.086e-61
Identity = 108/272 (39.71%), Postives = 159/272 (58.46%), Query Frame = 3
Query:  330 VLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAG-LKPRAEE 1142
            +L   ++ +++  D P  +R+ V +P    +P+E + + T+DG  L+  L+          PT+++ HGNAGN+G R+ N   +    + NV++ DYRGYG+S G+PSE GLY DA+  ++Y+  R DID   +V+FGRSLGGAVAI +A  N   ++AI+VENTF SIP  A  LF    +  +P +  +N+F S   V   ++P LFISG  D  IPP MM  L+   P+  K L     G HN+TW   GYF ++  F+   LK  A+E
Sbjct:   56 ILYKFQDVLLYFPDQPSSSRLYVPMPT--GIPHENVYVRTKDGVRLNLILLRYTGENPASAPTILYFHGNAGNIGHRVPNALLMLVNLKANVVLVDYRGYGKSDGEPSEEGLYQDAEATLDYIMSRPDIDKTKMVLFGRSLGGAVAIRLASVNPHRVAAIMVENTFLSIPHMAATLFSFFPMRYLPLWCYKNKFLSYRHVALCRMPSLFISGLSDQLIPPVMMKQLYELSPARTKRLAIFPEGTHNDTWQCQGYFAALEQFMKELLKSHAQE 325          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Cavefish
Match: abhd17aa (protein ABHD17A-like [Source:NCBI gene;Acc:103045831])

HSP 1 Score: 92.0485 bits (227), Expect = 2.692e-20
Identity = 63/201 (31.34%), Postives = 96/201 (47.76%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLA 1118
            T++F HGNA ++G        L      N+  +DY GYG STGKPSE  LY D     + L  R  I   +I+++G+S+G    +++A R     +A+++ +  TS    A      P   K   F   + F +I KV ++  PVL I G +D  I  +  L LF +CP   + L  V    HN+      Y E +  F++
Sbjct:  124 TVLFSHGNAVDLGQMSSFYIGLGTRINCNIFSYDYSGYGASTGKPSEKNLYADIDAAWHALRTRYGISPENIILYGQSIGTVPTVDLASRYE--CAAVVLHSPLTSGMRVA-----FPDTKKTYFF---DAFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALFERCPKAVEPL-WVEGAGHNDIELYSQYLERLRRFIS 313          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Cavefish
Match: ENSAMXT00000041259.1 (protein ABHD17A-like [Source:NCBI gene;Acc:103041214])

HSP 1 Score: 90.8929 bits (224), Expect = 4.221e-20
Identity = 63/201 (31.34%), Postives = 94/201 (46.77%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLA 1118
            T++F HGNA ++G        L      N+  +DY GYG STGKPSE  LY D       L  R  I   +I+++G+S+G    +++A R     +A+I+ +  TS    A      P   K   F   + F +I KV ++  PVL I G +D  I  +  L L+ +CP   + L  V    HN+      Y E +  F+ 
Sbjct:   93 TVLFSHGNAVDLGQMSSFYIGLGTRINCNIFSYDYSGYGVSTGKPSEKNLYADIDAAWQALRTRYGISPENIILYGQSIGTVPTVDLASRYE--CAAVILHSPLTSGMRVA-----FPDTKKTYCF---DAFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPL-WVEGAGHNDIELYSQYLERLRRFIG 282          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Cavefish
Match: abhd17b (abhydrolase domain containing 17B [Source:NCBI gene;Acc:103022021])

HSP 1 Score: 89.7373 bits (221), Expect = 1.083e-19
Identity = 62/201 (30.85%), Postives = 97/201 (48.26%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLA 1118
            TL+F HGNA ++G        L      NV  +DY GYG S+GKPSE  LY D     + L  R  I   +++++G+S+G   ++++A R     +A+I+ +  TS    A      P   K   F   + F +I+K+ ++  PVL I G +D  I  +  L L+ +C    + L  V    HN+      Y E +  F+A
Sbjct:   93 TLLFSHGNAVDLGQMSSFYIGLGSRINCNVFSYDYSGYGASSGKPSEKNLYADVDAAWHALRTRYGIRPENVIVYGQSIGTVPSVDLAARYES--AAVILHSPLTSGMRVA-----FPDTKKTYCF---DAFPNIDKISKVTSPVLVIHGTEDEVIDFSHGLALYERCQRPVEPL-WVEGAGHNDVELYGQYLERLKQFVA 282          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Cavefish
Match: ENSAMXT00000053344.1 (protein ABHD17A-like [Source:NCBI gene;Acc:103041214])

HSP 1 Score: 89.7373 bits (221), Expect = 1.569e-19
Identity = 63/201 (31.34%), Postives = 94/201 (46.77%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLA 1118
            T++F HGNA ++G        L      N+  +DY GYG STGKPSE  LY D       L  R  I   +I+++G+S+G    +++A R     +A+I+ +  TS    A      P   K   F   + F +I KV ++  PVL I G +D  I  +  L L+ +CP   + L  V    HN+      Y E +  F+ 
Sbjct:  131 TVLFSHGNAVDLGQMSSFYIGLGTRINCNIFSYDYSGYGVSTGKPSEKNLYADIDAAWQALRTRYGISPENIILYGQSIGTVPTVDLASRYE--CAAVILHSPLTSGMRVA-----FPDTKKTYCF---DAFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPL-WVEGAGHNDIELYSQYLERLRRFIG 320          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Sea Lamprey
Match: abhd13 (abhydrolase domain containing 13 [Source:NCBI gene;Acc:561333])

HSP 1 Score: 187.963 bits (476), Expect = 1.486e-56
Identity = 110/279 (39.43%), Postives = 153/279 (54.84%), Query Frame = 3
Query:  345 EEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSA-YLILQDI----NTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKI-----------------PYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFL 1115
            ++Q++F  + P  +R+ V LP    +P E + +   DG  LSA +L   DI         VPT I+ HGNAGN+G R+ N   +    +VNVL+ DYRGYG S G+PSE GLY+DAQ  + +   R D+D   +V+FGRSLGGAVAI++A R      A+IVENTF SIP  A+ LF +                 P+   +P +  R++F S   +   +VP LFISG  D+ +PP MM  L    P+  K +     G HN+TW   GY  ++  FL
Sbjct:   17 QDQLLFFPEQPASSRVFVPLP--LGVPRESVRVRARDGVALSAVFLRACDIVGGPAAPAGVPTFIYFHGNAGNLGHRMPNALMMVAHLRVNVLLLDYRGYGHSDGEPSEHGLYLDAQAALAHAMARPDVDPSCVVLFGRSLGGAVAIDLAARQQHGALALIVENTFLSIPHMAQALFPVFSRGGGGGGGSSSSSCRPF--PLPSWCFRSRFPSHENIASCRVPTLFISGLADSLVPPVMMSRLHDLSPAPLKRMATFREGTHNDTWQCRGYISALQHFL 291          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Sea Lamprey
Match: abhd17b (abhydrolase domain containing 17B [Source:ZFIN;Acc:ZDB-GENE-040718-244])

HSP 1 Score: 86.2705 bits (212), Expect = 2.935e-19
Identity = 58/200 (29.00%), Postives = 93/200 (46.50%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFL 1115
            TL+F HGNA ++G      A L      NV  +DY GYG S+GKPSE  LY D       L  R  +    +V++G+S+G    +++A R     + +++ +     P A+      P + +   F   + F SI K+ ++  PVL I G +D  +  +  L + ++C    + L  V    HN+      Y E +  FL
Sbjct:   99 TLLFSHGNAVDLGQMCGFYADLAAKLNCNVFSYDYSGYGASSGKPSERNLYADIDAAFQALRTRYGLTPDKVVLYGQSIGTVPTVDLASRYE--CAGVVLHS-----PLASGLRVLFPGIARTYCF---DPFPSIEKISKVSSPVLVIHGTEDEVVDLSHGLAIHARCRRPAEPL-WVEGAGHNDVVLHAQYMERLQRFL 287          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005892.1 (pep scaffold:Pmarinus_7.0:GL476342:292888:300705:-1 gene:ENSPMAG00000005303.1 transcript:ENSPMAT00000005892.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.8777 bits (198), Expect = 2.738e-17
Identity = 62/204 (30.39%), Postives = 93/204 (45.59%), Query Frame = 3
Query:  489 DINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQV---NVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALR---NTGPISAIIVENTFTSIPAAAK-----HLFKI-P-----YVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRV 1049
            D    N  P  ++ HGNAG  G    +  +LYK       +V+  DYRG+G STG P+E G+  DA  +  +   R    +G + I+G SLG  VA  V  +      P  A+I+E  FT+I   A       ++KI P     +++ I D  +R  F S      L  P+L +  E D  +P  +   L+    S K ++  V
Sbjct:   93 DAALGNGAPVFVYFHGNAGTRGGH--HRVELYKVLSASGFHVVTLDYRGWGDSTGTPTEEGITADAIFVYKWAQQRA---AGPVYIWGHSLGTGVATNVGRKLCEQGAPPGAVILEAPFTNIREEADSHPLAQIYKIFPAFDWFFLDSITDSGVR--FASDENASELNCPLLILHAEDDHIVPFHLGKKLYDIAASAKVNVEFV 289          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Yeast
Match: YNL320W_mRNA (Putative protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies [Source:SGD;Acc:S000005264])

HSP 1 Score: 141.354 bits (355), Expect = 2.009e-39
Identity = 89/264 (33.71%), Postives = 138/264 (52.27%), Query Frame = 3
Query:  330 VLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRL--KVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFL 1115
             L + + ++++P      AR  V  P+   +PYE+L++ T+D   L A+    DI   N   T++    NAGN+G  ++ I   Y+   ++V I+ YRGYG S G PSE GL +DA  +I++LS         +V++GRSLGGA A+ +A +       +I+ENTF SI     ++F  P + +    L    + S   +     + P LF+SG KD  +PP  M  L+  CPS  K +     G HN+T  + GY++ I  FL
Sbjct:   23 TLYHYQNRLVYP-SWAQGARNHVDTPDSRGIPYEKLTLITQDHIKLEAW----DIKNENSTSTVLILCPNAGNIGYFILIIDIFYRQFGMSVFIYSYRGYGNSEGSPSEKGLKLDADCVISHLSTDSFHSKRKLVLYGRSLGGANALYIASKFRDLCDGVILENTFLSIRKVIPYIF--PLLKRFT-LLCHEIWNSEGLMGSCSSETPFLFLSGLKDEIVPPFHMRKLYETCPSSNKKIFEFPLGSHNDTIIQDGYWDIIRDFL 278          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Nematostella
Match: EDO36646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI15])

HSP 1 Score: 209.92 bits (533), Expect = 1.862e-64
Identity = 111/278 (39.93%), Postives = 164/278 (58.99%), Query Frame = 3
Query:  288 GIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNT--GPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFL 1115
            G++   L  A +   L + ++ +++  + P  +R+ V  P    LP E L ++T+DG  ++   I Q    +   PT++F HGNAGN+G RL+N   L+  C  NVL+ +YRGYG+S G PSE G  +DAQ  +++L  R DID   I++FGRSLGGAVAI++           A++VENTF SIPA A  L  I  ++++P F  RN+F S++K+   +VP LF+SG  D  IPP MM  L+    S  K L +   G HN+TW   GY ++I+ F+
Sbjct:   13 GVVIFLLLTAAVLGALYHYQDSLLYFPEQPLSSRLFVQNPRVLGLPCENLYLKTQDGVRINVVFIKQVPPLQATAPTVLFFHGNAGNVGHRLMNAKALHSQCGCNVLLVEYRGYGKSEGSPSEHGFQLDAQASMDHLLSRTDIDPTQIIVFGRSLGGAVAIDLVSHPAYVQRAFALVVENTFVSIPAMANTL--IAGLHRLPYFCFRNKFNSLSKIPNARVPTLFLSGMADQLIPPKMMKMLYQSSGSSLKKLEQFEGGSHNDTWQCFGYLDAISRFI 288          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Nematostella
Match: EDO45743 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS48])

HSP 1 Score: 90.8929 bits (224), Expect = 1.309e-20
Identity = 70/229 (30.57%), Postives = 101/229 (44.10%), Query Frame = 3
Query:  429 EELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFL 1115
            E  + +T  G  +    I    N R    TL+F HGNA ++G        L      N+  +DY GYG STGKPSE  LY D     N L  R  I   +IV++G+S+G    I++A R       +I+ +  TS    A      P   +   F   + F SI KV ++  PVL + G +D  I  +  L ++ +CP     L  V    HN+      Y E +  F+
Sbjct:   66 EAFTTKTNRGNHIGCMFIRCSPNARF---TLLFSHGNAVDLGQMSSFYVGLGTRINCNIFSYDYSGYGVSTGKPSEKNLYSDIDAAWNALRTRYGISPENIVLYGQSIGTVPTIDLASRFE--CGGVILHSPLTSGMRVA-----FPETKRTWCF---DAFPSIEKVSKIVSPVLVVHGTEDEVIDFSHGLAIYERCPRAVDPL-WVEGAGHNDVELYGQYLERLKQFI 280          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Nematostella
Match: EDO48697 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIF7])

HSP 1 Score: 76.2554 bits (186), Expect = 2.076e-16
Identity = 51/168 (30.36%), Postives = 78/168 (46.43%), Query Frame = 3
Query:  513 PTLIFCHGNAGNMGS-RLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNT---GPISAIIVENTFTSIPAA------AKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIP 986
            P  ++ HGNA N      + + Q+      +V+ FDYRG+  S G PSE GL  D  T+  ++  R       + I+G SLG  VA  VA R T    P   +I+E  F S+  A      AK    +PY +++     +  F++  ++  +  PVL +    D  IP
Sbjct:    6 PIFLYLHGNAFNRAEPHRVALYQVLSKLSFHVVTFDYRGFADSEGHPSEEGLIEDGLTVWKWIKRRS--KKAPVYIWGHSLGSGVATGVAERLTQMRAPPKGLILEAAFNSVYDAGLDHSLAKPFKFLPYFHEVVMESFKGVFETDKRLGNVNCPVLMLHDHDDDIIP 171          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Nematostella
Match: EDO44623 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVD5])

HSP 1 Score: 48.1358 bits (113), Expect = 2.772e-6
Identity = 53/211 (25.12%), Postives = 90/211 (42.65%), Query Frame = 3
Query:  498 TRNKVPTLIFCHGNAGNM-GSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGS-IVIFGRSLGGAVAIEVALRNTGPISAII--------VENTFTSIPAAAKH------LFKIP-YVNKIPDFLLRNQFQSINK---VDRLKV--PVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDH 1064
            ++  +P +IF  G   +M G++ + + +           FD+RG G S+GKP +  +    +   + L L ++I   S  V+ G SLGG + + VA+     I  +I        V   F ++P   K        + IP   ++ P  L  +  Q   K     R+ +  PV  I G KD  +P  + LD+  +  S    L  + +G H
Sbjct:   18 SQGSLPGVIFLPGLMSSMNGTKALALEEFCVKTGRAYTRFDHRGLGESSGKPVDCTVSSRKE---DVLRLMEEIKGTSPQVLIGSSLGGWIMLHVAMEMPERIQGLIGIATAADFVSRRFDNLPLETKTEIQNIGYWTIPSQFSQKPYILTWDMIQDARKHVLQGRIPISCPVRLIHGMKDQEVPYKVSLDVSDRLLSNNVQLTLLKNGGH 225          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Medaka
Match: abhd13 (abhydrolase domain containing 13 [Source:NCBI gene;Acc:561333])

HSP 1 Score: 203.371 bits (516), Expect = 2.672e-61
Identity = 111/291 (38.14%), Postives = 167/291 (57.39%), Query Frame = 3
Query:  282 FSGIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQ---DINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAG-LKPRAEE 1142
            + G     L +A +  +L   ++ +++  D P  +R+ V +P    +P+E + I T+DG  L+  L+     D       PT+++ HGNAGN+G R+ N   +    + N+++ DYRGYG+S G+PSE GLY+DA+  ++Y+  R D+D   +V+FGRSLGGAVA+ +A  N   +SA+IVENTF SIP  A  LF    +  +P +  RNQF +  +V   ++P LF+SG  D  IPP MM  L+   P+  K L     G HN+TW   GYF ++  F+   LK  A E
Sbjct:   40 YGGFFLLALILASVAGILYKFQDVLLYFPDQPSSSRLYVPMPT--GIPHENVYIRTKDGVKLNLILLRYTGGDTLPGVAPPTILYFHGNAGNIGHRVPNALLMLVNLKANIVLVDYRGYGKSEGEPSEDGLYLDAEATLDYIMTRPDVDKTKVVLFGRSLGGAVAVRLASVNPHRVSAVIVENTFLSIPHMAATLFSFLPIRLLPLWCYRNQFLTYRQVVLCRMPSLFVSGLSDQLIPPVMMKQLYELSPARTKRLAIFPEGTHNDTWQCQGYFAALEQFIKDLLKSHAHE 328          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Medaka
Match: abhd17b (abhydrolase domain containing 17B [Source:NCBI gene;Acc:101166966])

HSP 1 Score: 88.1965 bits (217), Expect = 2.788e-19
Identity = 60/201 (29.85%), Postives = 98/201 (48.76%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLA 1118
            TL+F HGNA ++G        L      N+  +DY GYG S+GKPSE  LY D +   + L  R  I   +++++G+S+G   ++++A R     +A+++ +  TS    A      P   K   F   + F +I+K+ ++  PVL I G +D  I  +  L L+ +C    + L  V    HN+      Y E +  F+A
Sbjct:   93 TLLFSHGNAVDLGQMSSFYIGLGSRINCNIFSYDYSGYGASSGKPSEKNLYADVEAAWHALRSRYGIRPENVIVYGQSIGTVPSVDLASRYES--AAVVLHSPLTSGMRVA-----FPDTKKTYCF---DAFPNIDKISKVTSPVLVIHGTEDEVIDFSHGLALYERCQRPVEPL-WVEGAGHNDVELYGQYLERLKQFVA 282          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Medaka
Match: ENSORLT00000018598.3 (protein ABHD17A [Source:NCBI gene;Acc:101161510])

HSP 1 Score: 88.9669 bits (219), Expect = 3.790e-19
Identity = 63/200 (31.50%), Postives = 95/200 (47.50%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFL 1115
            T++F HGNA ++G        L      N+  +DY GYG STGKPSE  LY D     + L  R  I   +I+++G+S+G    +++A R     +A+++ +  TS    A      P   K   F   + F +I KV ++  PVL I G +D  I  +  L LF +CP   + L  V    HN+      Y E +  F+
Sbjct:  157 TVLFSHGNAVDLGQMSSFYIGLGTRINCNIFSYDYSGYGVSTGKPSEKNLYADIDAAWHALRSRYGISPENIILYGQSIGTVPTVDLASRFE--CAAVVLHSPLTSGMRVA-----FPDTKKTYCF---DAFPNIEKVSKIPSPVLIIHGTEDEVIDFSHGLALFERCPKAVEPL-WVEGAGHNDIELYSQYLERLRRFI 345          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Medaka
Match: ENSORLT00000026893.1 (protein ABHD17A [Source:NCBI gene;Acc:101161510])

HSP 1 Score: 88.9669 bits (219), Expect = 3.790e-19
Identity = 63/200 (31.50%), Postives = 95/200 (47.50%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFL 1115
            T++F HGNA ++G        L      N+  +DY GYG STGKPSE  LY D     + L  R  I   +I+++G+S+G    +++A R     +A+++ +  TS    A      P   K   F   + F +I KV ++  PVL I G +D  I  +  L LF +CP   + L  V    HN+      Y E +  F+
Sbjct:  157 TVLFSHGNAVDLGQMSSFYIGLGTRINCNIFSYDYSGYGVSTGKPSEKNLYADIDAAWHALRSRYGISPENIILYGQSIGTVPTVDLASRFE--CAAVVLHSPLTSGMRVA-----FPDTKKTYCF---DAFPNIEKVSKIPSPVLIIHGTEDEVIDFSHGLALFERCPKAVEPL-WVEGAGHNDIELYSQYLERLRRFI 345          
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Medaka
Match: abhd17ab (protein ABHD17A [Source:NCBI gene;Acc:101173294])

HSP 1 Score: 87.4261 bits (215), Expect = 9.607e-19
Identity = 62/200 (31.00%), Postives = 95/200 (47.50%), Query Frame = 3
Query:  516 TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFL 1115
            T++F HGNA ++G        L      N+  +DY GYG S+GKPSE  LY D     + L  R  I   +I+++G+S+G    +++A R     +A+I+ +  TS    A      P   +   F   + F +I KV ++  PVL I G +D  I  +  L LF +CP   + L  V    HN+      Y E +  F+
Sbjct:  133 TVLFSHGNAVDLGQMSSFYIGLGTRINCNIFSYDYSGYGVSSGKPSEKDLYADVDAAWHALRTRFCISPENIILYGQSIGTVPTVDLASRYE--CAAVILHSPLTSGMRVA-----FPETKETYCF---DAFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALFERCPKAVEPL-WVEGAGHNDIELYSQYLERLRRFI 321          
BLAST of Abhydrolase domain-containing protein 13 vs. Planmine SMEST
Match: SMESG000067332.1 (SMESG000067332.1)

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 319/319 (100.00%), Postives = 319/319 (100.00%), Query Frame = 3
Query:  204 MYCSVYYSLQKXXXXXXXXXXXXQVNFSGIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAGLKPRAEEIFVKTV 1160
            MYCSVYYSLQKLFLFAAFIITLFQVNFSGIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAGLKPRAEEIFVKTV
Sbjct:    1 MYCSVYYSLQKLFLFAAFIITLFQVNFSGIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAGLKPRAEEIFVKTV 319          
BLAST of Abhydrolase domain-containing protein 13 vs. Planmine SMEST
Match: SMESG000000881.1 (SMESG000000881.1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.336e-15
Identity = 53/181 (29.28%), Postives = 90/181 (49.72%), Query Frame = 3
Query:  441 IETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFI 983
            + T+   I   Y+ +++ N      +++F HGNA ++G     +  L     VN+  +DY GYG STG P E  +Y DA+     L+ R  I    IV++G+S+G A  + +A ++   ++ +I+ +     P  +      P  N+   F   + F +I+KV R+K P L I G +D  I
Sbjct:   71 VTTKRSRIACYYIPVENKNAY----SVLFSHGNAVDLGLMAGFLQALSIRFDVNIFCYDYSGYGVSTGDPLECNIYADAEAAFEELTERYKIPLSRIVLYGQSIGTAPTVHLATKHK--VAGVILHS-----PLMSGLRVVCPGTNRSFCF---DPFTNIDKVARIKSPTLIIHGTEDEII 237          
BLAST of Abhydrolase domain-containing protein 13 vs. Planmine SMEST
Match: SMESG000072914.1 (SMESG000072914.1)

HSP 1 Score: 67.781 bits (164), Expect = 2.376e-12
Identity = 71/289 (24.57%), Postives = 121/289 (41.87%), Query Frame = 3
Query:  288 GIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQYNLP----YEELSIETEDGEILSAYLILQDINTRNKVP------------TLIFCHGNAGNMGSRLINIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFKIPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFSKCPSGKKSLNRVSSG-DHNNTWTRPGYFESI 1103
            GI+ S LF   LF    Y+   +      PP     +   +QY       Y +  I  +    L+ Y+I      RN +             T+++ HGNA ++G     + +L    +VN+L +DY GYG S+G PSE  LY +  +++ ++    DI   +I+++G+S+G    I +A +       +I+ +   S     K L    ++       + +  Q+I  V   +  VL I G  D   P     +L  + P  +     +  G  HNN    PGY + +
Sbjct:    2 GIVCSKLFC--LFCCPPYLPSIVSKAAFSPPPCTYSIIHDSQYRFKFLVNYNDFDISRDHENFLNYYII--RTKRRNNLSCIYLKTAPWTKNTILYSHGNAVDLGLIANKLIELGLKLKVNILAYDYSGYGTSSGSPSERNLYSNIVSVLEFMHQNFDIPHKNIILYGQSIGSVPTIFLASKFR--FGVVILHSPLAS---GFKFLNCCCFMKLCSCCDVLDNLQNIKYV---RSRVLVIHGLDDEVTPVEHSYELLKRIPPERLLDPLIIDGAGHNNIELFPGYLQRL 278          
BLAST of Abhydrolase domain-containing protein 13 vs. Planmine SMEST
Match: SMESG000015331.1 (SMESG000015331.1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.258e-10
Identity = 55/196 (28.06%), Postives = 91/196 (46.43%), Query Frame = 3
Query:  504 NKVPTLIFCHGNAGNMGS--RLINIAQLYKFCQVNVLIFDYRGYGRSTGK-PSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEV-----ALRNTGPISAIIVENTFTSIPAAAKHLFK------IPYVNKIPDFLLRNQFQSINKVDRLKVP---VLFISGEKDAFIPPAMMLDLFSKCPSGKKSL 1040
            N  P +++ HGN+ + GS  RL+ +  + +    ++L  DYRG+  S+G   +E     DA    NYL L     + SI ++G SLG  ++  +      +     IS +I+E+ FTSI     H+        +PY ++I    L NQ  + N ++ LK     +L +  E D  +   M   L+S   S  K +
Sbjct:   32 NGNPIILYLHGNSMHRGSNHRLL-LYHVLRESGFHILTIDYRGFADSSGSIHNEDEALEDAFVAYNYLKLTA--PNSSIFLWGHSLGTGISSLLLQKLSKMNECSAISGVILESPFTSILETMDHIGLTWPWRFMPYFDRIFKKALLNQKLAFNSIENLKETNNIILILHAEDDKVLSFKMGKKLYSTLLSAGKDV 224          
BLAST of Abhydrolase domain-containing protein 13 vs. Planmine SMEST
Match: SMESG000015331.1 (SMESG000015331.1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.552e-10
Identity = 55/196 (28.06%), Postives = 91/196 (46.43%), Query Frame = 3
Query:  504 NKVPTLIFCHGNAGNMGS--RLINIAQLYKFCQVNVLIFDYRGYGRSTGK-PSESGLYVDAQTMINYLSLRQDIDSGSIVIFGRSLGGAVAIEV-----ALRNTGPISAIIVENTFTSIPAAAKHLFK------IPYVNKIPDFLLRNQFQSINKVDRLKVP---VLFISGEKDAFIPPAMMLDLFSKCPSGKKSL 1040
            N  P +++ HGN+ + GS  RL+ +  + +    ++L  DYRG+  S+G   +E     DA    NYL L     + SI ++G SLG  ++  +      +     IS +I+E+ FTSI     H+        +PY ++I    L NQ  + N ++ LK     +L +  E D  +   M   L+S   S  K +
Sbjct:   64 NGNPIILYLHGNSMHRGSNHRLL-LYHVLRESGFHILTIDYRGFADSSGSIHNEDEALEDAFVAYNYLKLTA--PNSSIFLWGHSLGTGISSLLLQKLSKMNECSAISGVILESPFTSILETMDHIGLTWPWRFMPYFDRIFKKALLNQKLAFNSIENLKETNNIILILHAEDDKVLSFKMGKKLYSTLLSAGKDV 256          
The following BLAST results are available for this feature:
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABHD134.162e-6041.10abhydrolase domain containing 13 [Source:HGNC Symb... [more]
ABHD17A1.407e-1930.24abhydrolase domain containing 17A [Source:HGNC Sym... [more]
ABHD17C5.114e-1929.35abhydrolase domain containing 17C [Source:HGNC Sym... [more]
ABHD17A6.242e-1930.35abhydrolase domain containing 17A [Source:HGNC Sym... [more]
ABHD17B1.452e-1830.35abhydrolase domain containing 17B [Source:HGNC Sym... [more]
back to top
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aho-35.603e-2029.00Alpha/beta hydrolase domain-containing protein aho... [more]
Y41E3.184.922e-1530.95pep chromosome:WBcel235:IV:15061929:15065748:-1 ge... [more]
abhd-125.719e-1221.88ABHydrolase Domain containing homolog [Source:Uni... [more]
abhd-125.719e-1221.88ABHydrolase Domain containing homolog [Source:Uni... [more]
F01D5.85.757e-1227.49pep chromosome:WBcel235:II:14010775:14013802:1 gen... [more]
back to top
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Bem463.178e-6940.49gene:FBgn0025109 transcript:FBtr0077643[more]
CG330961.466e-2228.99gene:FBgn0053096 transcript:FBtr0301976[more]
CG330961.466e-2228.99gene:FBgn0053096 transcript:FBtr0301975[more]
CG330961.466e-2228.99gene:FBgn0053096 transcript:FBtr0344622[more]
CG330961.466e-2228.99gene:FBgn0053096 transcript:FBtr0114464[more]
back to top
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abhd136.594e-6239.58abhydrolase domain containing 13 [Source:NCBI gene... [more]
abhd17ab8.040e-2031.34abhydrolase domain containing 17Ab [Source:ZFIN;Ac... [more]
abhd17c1.248e-1930.50abhydrolase domain containing 17C [Source:NCBI gen... [more]
abhd17c1.248e-1930.50abhydrolase domain containing 17C [Source:NCBI gen... [more]
abhd17b1.914e-1930.85abhydrolase domain containing 17B [Source:ZFIN;Acc... [more]
back to top
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abhd135.182e-6139.72abhydrolase domain containing 13 [Source:NCBI gene... [more]
abhd17c3.450e-2027.54abhydrolase domain containing 17C [Source:NCBI gen... [more]
abhd17c7.242e-2027.83abhydrolase domain containing 17C [Source:NCBI gen... [more]
abhd17a1.332e-1930.50abhydrolase domain containing 17A [Source:NCBI gen... [more]
abhd17b1.931e-1830.85abhydrolase domain containing 17B [Source:NCBI gen... [more]
back to top
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abhd131.860e-6340.00abhydrolase domain containing 13 [Source:MGI Symbo... [more]
Abhd131.860e-6340.00abhydrolase domain containing 13 [Source:MGI Symbo... [more]
Abhd17a1.299e-1930.24abhydrolase domain containing 17A [Source:MGI Symb... [more]
Abhd17c2.422e-1928.99abhydrolase domain containing 17C [Source:MGI Symb... [more]
Abhd17b6.795e-1930.35abhydrolase domain containing 17B [Source:MGI Symb... [more]
back to top
BLAST of Abhydrolase domain-containing protein 13 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZJL8|ABHDD_CHICK1.168e-6338.31Protein ABHD13 OS=Gallus gallus OX=9031 GN=ABHD13 ... [more]
sp|Q80UX8|ABHDD_MOUSE1.301e-6240.00Protein ABHD13 OS=Mus musculus OX=10090 GN=Abhd13 ... [more]
sp|Q6IRP4|ABHDD_XENLA2.875e-6239.01Protein ABHD13 OS=Xenopus laevis OX=8355 GN=abhd13... [more]
sp|Q32LS6|ABHDD_DANRE4.978e-6139.58Protein ABHD13 OS=Danio rerio OX=7955 GN=abhd13 PE... [more]
sp|Q7L211|ABHDD_HUMAN1.999e-5941.10Protein ABHD13 OS=Homo sapiens OX=9606 GN=ABHD13 P... [more]
back to top
BLAST of Abhydrolase domain-containing protein 13 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E2C1477.124e-8045.42Abhydrolase domain-containing protein 13 OS=Harpeg... [more]
A0A154NZ256.242e-7744.37Abhydrolase domain-containing protein 13 OS=Dufour... [more]
T1G0W91.137e-7545.77Hydrolase_4 domain-containing protein OS=Helobdell... [more]
A0A423SWU83.983e-7542.12Abhydrolase domain-containing protein 13 OS=Penaeu... [more]
A0A067RJM15.546e-7541.61Abhydrolase domain-containing protein 13 OS=Zooter... [more]
back to top
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abhd139.086e-6139.71abhydrolase domain containing 13 [Source:NCBI gene... [more]
abhd17aa2.692e-2031.34protein ABHD17A-like [Source:NCBI gene;Acc:1030458... [more]
ENSAMXT00000041259.14.221e-2031.34protein ABHD17A-like [Source:NCBI gene;Acc:1030412... [more]
abhd17b1.083e-1930.85abhydrolase domain containing 17B [Source:NCBI gen... [more]
ENSAMXT00000053344.11.569e-1931.34protein ABHD17A-like [Source:NCBI gene;Acc:1030412... [more]
back to top
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
abhd131.486e-5639.43abhydrolase domain containing 13 [Source:NCBI gene... [more]
abhd17b2.935e-1929.00abhydrolase domain containing 17B [Source:ZFIN;Acc... [more]
ENSPMAT00000005892.12.738e-1730.39pep scaffold:Pmarinus_7.0:GL476342:292888:300705:-... [more]
back to top
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YNL320W_mRNA2.009e-3933.71Putative protein of unknown function; the authenti... [more]
back to top
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO366461.862e-6439.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457431.309e-2030.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486972.076e-1630.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446232.772e-625.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Abhydrolase domain-containing protein 13 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abhd132.672e-6138.14abhydrolase domain containing 13 [Source:NCBI gene... [more]
abhd17b2.788e-1929.85abhydrolase domain containing 17B [Source:NCBI gen... [more]
ENSORLT00000018598.33.790e-1931.50protein ABHD17A [Source:NCBI gene;Acc:101161510][more]
ENSORLT00000026893.13.790e-1931.50protein ABHD17A [Source:NCBI gene;Acc:101161510][more]
abhd17ab9.607e-1931.00protein ABHD17A [Source:NCBI gene;Acc:101173294][more]
back to top
BLAST of Abhydrolase domain-containing protein 13 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067332.10.000e+0100.00SMESG000067332.1[more]
SMESG000000881.12.336e-1529.28SMESG000000881.1[more]
SMESG000072914.12.376e-1224.57SMESG000072914.1[more]
SMESG000015331.11.258e-1028.06SMESG000015331.1[more]
SMESG000015331.11.552e-1028.06SMESG000015331.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004603 ID=SMED30004603|Name=Abhydrolase domain-containing protein 13|organism=Schmidtea mediterranea sexual|type=transcript|length=1307bp
TTAGTGATCAAATATTTTCTTCAAATATTCATAGTTTTATTTATCAAATT
ATTTCTATAATTTTAAATTTTGGATTTTAAATATCCTAGATGATCAGAAT
CTGATTTTGCTACATGAATGTTCCCATAAGATTATTGAAAAAAAAATTAT
TTATGTTTATTAAAAAGTTGTTTTGTTTGAAAAATTCTCGGTGTTTTCAC
CATATGTATTGTTCTGTGTATTATAGCTTGCAGAAATTGTTTTTGTTTGC
AGCTTTTATCATTACATTGTTTCAAGTCAATTTCAGTGGAATTATTTATA
GTTTTTTATTTATAGCTTTGTTATTTTTTGTTTTACGATATATTGAAGAG
CAAATAATATTTCCAGTTGATGTTCCTCCTGAAGCACGAATGTGCGTTGC
ACTTCCAAATCAATATAACCTTCCATATGAAGAATTATCTATTGAAACTG
AAGACGGCGAAATATTATCTGCATATCTAATTCTTCAAGATATAAACACT
CGTAATAAAGTTCCAACGTTAATTTTTTGTCATGGAAATGCTGGAAATAT
GGGCTCGAGGTTGATTAATATTGCTCAATTATATAAATTTTGTCAAGTCA
ATGTATTAATATTTGACTATCGTGGCTACGGAAGAAGTACAGGAAAGCCT
TCTGAAAGTGGTTTATACGTTGATGCACAAACCATGATAAATTATTTGTC
TCTGCGACAAGATATTGATAGTGGAAGCATAGTAATATTTGGCAGATCTC
TTGGTGGTGCTGTTGCGATAGAAGTTGCTTTGAGAAATACTGGGCCAATT
TCAGCAATTATTGTTGAAAATACTTTTACGTCCATTCCAGCAGCCGCTAA
ACACTTATTCAAAATTCCTTATGTTAATAAAATTCCAGATTTTCTTTTAA
GAAATCAATTTCAATCTATAAACAAGGTCGATCGATTGAAAGTTCCTGTT
TTATTTATAAGTGGAGAAAAAGATGCATTTATTCCACCTGCGATGATGTT
GGATTTGTTCTCAAAATGTCCTTCGGGTAAAAAGTCTTTAAATAGGGTTT
CAAGTGGAGATCACAATAATACTTGGACTCGGCCAGGATATTTTGAATCG
ATTAATTCTTTTCTCGCGGGTTTAAAACCTCGAGCTGAAGAAATCTTTGT
GAAAACAGTTTAATGAAAATAAACTGATTTTTTTTTAAGTAGGCATTTAT
CTGATAGTGAGAAATGAATGGAATTATTGACACTTATTTGTGATAGAATT
ATACCGGCTGTTACCATGTTTCATAATTAAATGTCTCCTTAATATTTCCC
CAAAACT
back to top

protein sequence of SMED30004603-orf-1

>SMED30004603-orf-1 ID=SMED30004603-orf-1|Name=SMED30004603-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=350bp
MNVPIRLLKKKLFMFIKKLFCLKNSRCFHHMYCSVYYSLQKLFLFAAFII
TLFQVNFSGIIYSFLFIALLFFVLRYIEEQIIFPVDVPPEARMCVALPNQ
YNLPYEELSIETEDGEILSAYLILQDINTRNKVPTLIFCHGNAGNMGSRL
INIAQLYKFCQVNVLIFDYRGYGRSTGKPSESGLYVDAQTMINYLSLRQD
IDSGSIVIFGRSLGGAVAIEVALRNTGPISAIIVENTFTSIPAAAKHLFK
IPYVNKIPDFLLRNQFQSINKVDRLKVPVLFISGEKDAFIPPAMMLDLFS
KCPSGKKSLNRVSSGDHNNTWTRPGYFESINSFLAGLKPRAEEIFVKTV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
Vocabulary: INTERPRO
TermDefinition
IPR029058AB_hydrolase
IPR022742Hydrolase_4
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022742Serine aminopeptidase, S33PFAMPF12146Hydrolase_4coord: 134..246
e-value: 1.3E-11
score: 44.3
IPR029058Alpha/Beta hydrolase foldGENE3DG3DSA:3.40.50.1820coord: 80..328
e-value: 1.2E-38
score: 134.8
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 96..335
NoneNo IPR availablePANTHERPTHR12277UNCHARACTERIZEDcoord: 53..343
NoneNo IPR availablePANTHERPTHR12277:SF81PROTEIN ABHD13coord: 53..343
NoneNo IPR availableTMHMMTMhelixcoord: 42..73