SMED30004599

Overview
NameSMED30004599
Smed IDSMED30004599
Length (bp)3055
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30004599 (SMED30004599) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30004599 (SMED30004599) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30004599 (SMED30004599) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30004599 (SMED30004599) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004599

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30004599SMESG000053708.1 SMESG000053698.1 SmedASXL_018401SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30004599SMESG000053708.1 SMESG000053698.1 SmedASXL_018400SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30004599SMESG000053708.1 SMESG000053698.1 Contig18437uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004599SMESG000053708.1 SMESG000053698.1 Contig18437newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004599SMESG000053708.1 SMESG000053698.1 Contig29257uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004599SMESG000053708.1 SMESG000053698.1 Contig29257newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004599SMESG000066407.1 SMESG000053709.1 SMESG000053708.1 SMESG000046471.1 SMESG000044282.1 Contig18438uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004599SMESG000066407.1 SMESG000053709.1 SMESG000053708.1 SMESG000046471.1 SMESG000044282.1 Contig18438newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30004599SMESG000053708.1 SMESG000053698.1 dd_Smed_v4_652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004599SMESG000053708.1 SMESG000053698.1 dd_Smed_v4_652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004599SMESG000053708.1 SMESG000053698.1 dd_Smed_v4_652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004599SMESG000053708.1 SMESG000053698.1 dd_Smed_v4_652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004599SMESG000053708.1 SMESG000053698.1 dd_Smed_v4_652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004599SMESG000053708.1 SMESG000053698.1 dd_Smed_v4_652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004599SMESG000053708.1 SMESG000053698.1 Contig33231uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004599SMESG000053708.1 SMESG000053698.1 Contig33231newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004599SMESG000053708.1 SMESG000053698.1 Contig42751uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004599SMESG000053708.1 SMESG000053698.1 Contig42751newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004599SMESG000053708.1 SMESG000053698.1 Contig45946uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004599SMESG000053708.1 SMESG000053698.1 Contig45946newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymal cellSMED30004599SMESG000053709.1 SMESG000053708.1 SMESG000053703.1 SMESG000053698.1 dd_Smed_v6_652_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30004599SMESG000053709.1 SMESG000053708.1 SMESG000053703.1 SMESG000053698.1 dd_Smed_v6_652_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30004599SMESG000053709.1 SMESG000053708.1 SMESG000053703.1 SMESG000053698.1 dd_Smed_v6_652_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30004599 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000042:133179..150511 -14692
v31.000042:190241..209061 -13483
Homology
BLAST of SMED30004599 vs. Ensembl Human
Match: MRC1 (mannose receptor C-type 1 [Source:HGNC Symbol;Acc:HGNC:7228])

HSP 1 Score: 103.219 bits (256), Expect = 2.588e-27
Identity = 146/648 (22.53%), Postives = 247/648 (38.12%), Query Frame = -3
Query:  876 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYS--KEGSWVDSRNVSLQFKKWYQGEPN-GGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYAD--------------GFWNDVECDQPNSVICEP------------------MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVIC---------QPIQNKKR----------PSSNSLFYSSTEKMNNLAAREF-CANRNMRIVKIDNASKNDLAMTYAIKS--NLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE--PINDTKNGFHITSVK 2642
            + +Y Y  ++E  T D A  FC      L++I++E   K ++      +  + +  G   S  K+ +W+D   V   +  W  GEPN     ENC+  +  ++ FWND+NC + N               IC+      +NS I               T  +P   S          FY   C          KI G+ME+E                        +  ++ A K C+    NLV+I NE     +    ++ +    W   ND+  E  ++ ++   + YTNW    P GG+R     SL Y D              G W D  CD     IC+                   +++  + Y + + +  +++A  YCK  N ++ +I +  SN      ++ S +   W+  N N  +  +  TD   + Y NW   EP+   K  C+  L ++G W    C+     +C         +P Q   R          P     +Y  +    N       C      +V I++A+++   ++Y ++   + + FWI G     EG W+   +  +S+ NW + +P G +  N  V+L  ++G W + HC S    IC+   I D K    + + K
Sbjct:  807 YKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKV--DYVSWATGEPNFANEDENCVT-MYSNSGFWNDINCGYPNAF-------------ICQR-----HNSSI-------------NATTVMPTMPSVPSGCKEGWNFYSNKCF---------KIFGFMEEE------------------------RKNWQEARKACIGFGGNLVSIQNEKEQAFL-TYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYP-GGRR----SSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAWLQMETSNE-RVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPK--LKSACVY-LDLDGYWKTAHCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQASLECLRMGSSLVSIESAAESSF-LSYRVEPLKSKTNFWI-GLFRNVEGTWLWINNSPVSFVNWNTGDPSGER--NDCVALHASSGFWSNIHCSSYKGYICKRPKIIDAKPTHELLTTK 1373          

HSP 2 Score: 40.817 bits (94), Expect = 2.588e-27
Identity = 34/116 (29.31%), Postives = 55/116 (47.41%), Query Frame = -2
Query: 2656 QKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGY---YWIDGN-DNGMEGY-WVDSKSNPMQYQNWKSGEPNGKRQ-ENCVHGLYYPAGLWNDISCNTPNSVICQKKK 2985
            +K  +  +  FC+    +L +I N    + ++ + I     Y   +W+     +  EG+ W D   +P+ Y+NW  GEPN  +  E C      P   WNDI+C   N+ ICQ +K
Sbjct:  669 EKKTWFESRDFCRALGGDLASINNKEEQQTIWRL-ITASGSYHKLFWLGLTYGSPSEGFTWSDG--SPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQK 781          

HSP 3 Score: 119.013 bits (297), Expect = 2.132e-26
Identity = 163/724 (22.51%), Postives = 273/724 (37.71%), Query Frame = -3
Query:  195 EKMTYKSAVKYCLAQSMNLVTIDN-EATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEP--DGGKRENCIQSLVYADGFWNDVECDQPNSVICEPM--------------------RHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRIN---GLWNDVTCDSLGEVICQP-------------------IQNKKRPSSNSLFY-----SSTEKMNNLAAREFCANRNMRIVKIDNASKNDLA--MTYAIKSNLSYFWIDGT-DSANEG-NWVDYQDQKLSYKNWYSTEPDGGK-TENCAVSLTDANGLWDDAHCQSMNSVIC----------EPIND-------TKNG--------FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNR------------KEGQWEDSKQNLLSFKKWHKSEPK-GGRNENCITGNNYQDALWNDEKCGSLNSVICQ--------------------PIKYGPSKY---------HISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKE------NC---IQGLYFSDGTWNDVKCDMKNKVICELK 1973
            EK   + A+  C  +  +L +I   E  + ++  L  + N D  WI  ND+  +  +  S+   +++T W   EP  +  ++E+C+  +   DG+W D  C+ P   IC+                      +H    Y IG    TF +A   C   N  L  IE+      +   V    +  +W   +D   +G +  T  EE+ + +W+   P   RK  C+  +R     GLW+ + CD   + +C+                     ++    S  SL +        EK     +R+FC      +  I+N  +      +  A  S    FW+  T  S +EG  W D     +SY+NW   EP+  +  E C     D    W+D +C+ +N+ IC          EP          T++G        ++ +  K   D A  +C+    +LV I  +     ++           ++N ND +            K+  W D  +  + +  W   EP     +ENC+T  +     WND  CG  N+ ICQ                      K G + Y          + + ++N+++  K C     +LV I ++K+  F+    +K    + W   NDV +E  ++ TD   + Y NW    P G +        +C   I G     G W D  CD K   IC+ +
Sbjct:  380 EKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPN-DELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCV-VMKGKDGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPG--RKPGCV-AMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSD--GSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWK----------YVNRNDAQSAYFIGLLISLDKKFAWMDGSK--VDYVSWATGEPNFANEDENCVTMYS-NSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFL-TYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTR 1082          

HSP 4 Score: 112.849 bits (281), Expect = 1.576e-24
Identity = 161/700 (23.00%), Postives = 271/700 (38.71%), Query Frame = -3
Query:  201 REKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDL---SLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKR-ENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNK-------------------------YHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQ-GYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNK-----KRPSSNSL---------FYS----------STEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTE------NCAVSLTDAN---GLWDDAHCQSMNSVICEPINDT------------------KNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ-----PIKYGPSK-------------------YHISKS-KRNYKDGVKYCKSKKMSLVKITDDKDNKFV-YDL-ALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 1976
             EK T+  +  +C A   +L +I+N+   + +  L   S  Y+   +W+          +  S+ + +SY NW Y EP+  +  E C +        WND+ C+  N+ IC+  +  T K                         Y+  K++ T ++A  +CK+    L++I++ES  K + K V ++     +  G   S +  +   D  ++ Y +W   EP      ENC+     +G WND+ C      ICQ   +        P+  S+         FYS            E+ N   AR+ C      +V I N  K    +TY +K +    W    D  +E  ++    + + Y NW    P G ++       +C V +  A+   G W D  C S    IC+  +D                   K+ + +   K ++  A  YC+     +  I  D  +N    L +  +  R WI  N N  + Q+  + +  + +  W   EPK      C+  +   D  W    C      +C+     P    P                     Y+I  S  RN+      C     SLV I    ++ F+ Y +  LKSK   FWI G     EG W+  +N  ++++NWN   P+ G++ +C+  L+ S G W+++ C      IC+
Sbjct:  668 HEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYH-KLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVTMYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQN-EKEQAFLTYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASIL-DPYSNAFAWLQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPK--LKSACVYLD--LDGYWKTAHCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQASLECLRMGSSLVSIESAAESSFLSYRVEPLKSKT-NFWI-GLFRNVEGTWLWINNSPVSFVNWNTGDPS-GERNDCV-ALHASSGFWSNIHCSSYKGYICK 1356          

HSP 5 Score: 106.301 bits (264), Expect = 1.630e-22
Identity = 136/694 (19.60%), Postives = 242/694 (34.87%), Query Frame = -3
Query:  201 TREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNK------------------------YHIGKDRMTFN-DAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEP--QGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPS--------------SNSLFYSSTEKMNNLA-AREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTD-ANGLWDDAHCQSMNSVICE------------------PINDTKNGFHITSVKMKFDTAVK-----------YCRNKKMELVKIDGDQMNNQVYNLSVTFNLGR--YWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNYQDALWNDEKCGSLNSVICQ-------------------PIK------YGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPN-GGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 1979
            ++  +T+  A K C  Q+  L++I        +  L+        WI  N L     W  S+ +   Y NW    P     ++C+      +  W ++EC Q    IC+    T N                         Y I +D      DA+  C+K    L +I        +   +      + W+  ND   +  +  +D   +++  W   EP  +  R+E+C+     +G W D  C+     IC+     + P                +   Y     ++  A A + C N N  +  I++  +     ++       YFW   +D   +G +    ++++ + +W S  P  G+   C    T  A GLWD   C      +C+                     +       TS+  K     K           +CR    +L  I+  +    ++ L          +W+          +  S  + +S++ W   EP   +N E C          WND  C  LN+ ICQ                   P+       Y   +Y+ SK K    +   +CK     LV I  + + KF++    ++   + +  G  ++ +  +   D   + Y++W   +PN   + ENC+  +Y + G WND+ C   N  IC+
Sbjct:  234 SKSALTWHQARKSCQQQNAELLSITEIHEQTYLTGLTSSLTSG-LWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVVMKGKDGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMP--GRKPGCVAMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVT-MYSNSGFWNDINCGYPNAFICQ 923          

HSP 6 Score: 102.449 bits (254), Expect = 2.356e-21
Identity = 140/702 (19.94%), Postives = 258/702 (36.75%), Query Frame = -3
Query:  201 TYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLV-YADGFWNDVECDQPNSVICEPMRHTTNK----------------------------YHIGK-DRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFD--YWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGL--WNDVTCDSLGEVICQPIQNKKRPSSNSL---------------------FYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPD-GGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVK----YCRNKKMELVKIDGDQ--------------------MNNQVYNLSVTFNLG----RYWINGNDNRKEGQ--WEDSKQNLLSFKKWHKSEPKGGR------NENC---ITGNNYQDALWNDEKCGSLNSVICQP------------------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFS-DGTWNDVKCDMKNKVICE 1964
            T+  A + C  ++  L TI++      +          ++W   +D+  +G +  +   ++ +T+W+   P  G++  C+      A G W+ ++CD+    +C+                                    Y  GK ++ T+ ++ ++C+     L +I N+   + + +L+  S  +   +W+     S    +  +D   +SY+NW   EP  Y+       L+ +    WND+ C+ L   ICQ IQ  + P                          +Y S EK     AR FC      +V I + S+      Y  +++    +  G   + +  +      K+ Y +W + EP+   + ENC V++   +G W+D +C   N+ IC+  N + N   +        +  K    +  NK  ++     ++                    + N+     +T+++       W   ND   E    W D +   + +  W K  P G R      + +C   I G + +   W D+ C S    ICQ                   +KYG S Y + + K  + +   YCK     +  I D   N F + L +++     WI  N    +  +  TD   + Y NW   +P    K  C+   Y   DG W    C+     +C+
Sbjct:  524 TFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMP--GRKPGCVAMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQ-IQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENC-VTMYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFLTYHMKDSTFSAWTGLNDVNSEHTFLWTDGRG--VHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPK--LKSACV---YLDLDGYWKTAHCNESFYFLCK 1213          

HSP 7 Score: 57.7658 bits (138), Expect = 1.371e-7
Identity = 38/135 (28.15%), Postives = 59/135 (43.70%), Query Frame = -2
Query: 2662 IIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTI--------------KNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPN-GKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3021
            +I  DY Y  + +K     A +FCK    +L++I              +N   +     + I     + W+DG+               + Y +W +GEPN     ENCV  +Y  +G WNDI+C  PN+ ICQ+
Sbjct:  805 VIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSK--------------VDYVSWATGEPNFANEDENCVT-MYSNSGFWNDINCGYPNAFICQR 924          

HSP 8 Score: 56.9954 bits (136), Expect = 2.374e-7
Identity = 53/255 (20.78%), Postives = 102/255 (40.00%), Query Frame = -3
Query:  195 MKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNL-GRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ---------------------PIKYGPSKYHISKSKRNYK----DGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPN--GGKKENCIQGLYFSDGTWNDVKCDMKNKVICELK 875
            + +  A K C+ +  EL+ I   +++ Q Y   +T +L    WI  N       W+ S ++   +  W    P     ++C++ N  ++A W + +C      IC+                     P ++ P   H  K  R+ K    D +  C+ +   L  I   ++  F+            WI  ND+  + ++  +D   +T+  W   +P+    ++E+C+  +   DG W D  C+     IC++K
Sbjct:  238 LTWHQARKSCQQQNAELLSIT--EIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVV-MKGKDGYWADRGCEWPLGYICKMK 489          
BLAST of SMED30004599 vs. Ensembl Human
Match: MRC2 (mannose receptor C type 2 [Source:HGNC Symbol;Acc:HGNC:16875])

HSP 1 Score: 93.2041 bits (230), Expect = 1.793e-18
Identity = 92/428 (21.50%), Postives = 170/428 (39.72%), Query Frame = -3
Query:  846 MTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECD---------QPNS--------------VICEP--MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRK--ENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPS--------------SNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNS-VICE-----PINDTKNGFHITSVKM-------KFDTAVKYC 1967
            ++++ A   C  Q  +L++I        ++ L   Y+    WI  NDL   G W  S+N+ L Y NW   +PD    ENC      + G W + +C          +PN+              V CEP       + Y +  ++ ++ ++   C +    L++I + +  + + K +K+ ++ + W+  ND   +  +  +D   +S+ +WHP EP  +R   E+C+      G WND  C+     IC+      + +              S S ++   +++    AR  C +   ++V I N  +     +        YFW    D  + G++      ++ Y +W   +P   +    A++   A GLW+  +C S  +  IC      P+     G   T             DT ++YC
Sbjct:  257 LSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSST-LWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITKQIKQEVE-ELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDTKLRYC 682          

HSP 2 Score: 65.4698 bits (158), Expect = 1.621e-16
Identity = 175/930 (18.82%), Postives = 308/930 (33.12%), Query Frame = -3
Query:  195 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFH-KNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEG--NWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVIC---------EP----------MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXX---XXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKE-NCIQGLRINGLWNDVTCDSLGEVIC------QPIQNKKRPSS-------------NSLFYSSTEKMNNLA----AREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSY-FWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGG-------KTENCAVSLTDAN----GLWDDAHC-QSMNSVICEPINDTK-------------------NG-FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWIN--GNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGS-LNSVICQPIKYGPSK-----YHISKSK----------------------RNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGT---FWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGK---KENCIQGLYFSDGTWNDVKC-DMKNKVICELK 2627
            Y + E+ +TY EA + C +   +L+TI N      V ++   +    +W    D +  GS+       + +  W + +P   R              W   NC   +   IC     +P  PE+               +  +  + W S T                      +YC   + +   Q    W++ +        Q+L   +     Y  E           +A  +N +  ++E      H         W+WI  N     G  +W  S+    SY N+     D      C   L  A   W  ++CD     IC         EP          +R    +Y   +   T+  A   C      L ++ +++         +   ++ +  +W+  + +  +G +  TD   I++ +W P +P+   K+  C+        W D  C +    IC      +  Q    P++             N  F    ++  +      A+  C  +  ++V I N  +   A   A   N+++  WI    S  +  WV+   + L Y NW   EP G        K  +CAV L   +    G WDD  C +  +  IC+   D                     NG F +    +++  A+  C ++   L  +  D         +        WI   G +  +   W    +  L++  W   EP+  +   C   +   D  W    C + L   +C  +  GP       YH S  +                        +K+  + C+    +++ I D+ +N FV++  L+S  G     W+  N     G  V  DN ++ Y NW    P  G      N    +  + G W    C ++   V+C+L 
Sbjct:  533 YWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGP-------DPTPSLTGSCPQGWASDTKL--------------------RYCYKVFSSERLQDKKSWVQAQG-----ACQELGAQLLSLASYEEEHF---------VANMLNKIFGESEPEIHEQH---------WFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDRSRHDDDDIRGCA-VLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQ--AFITASLPNVTFDLWIGLHASQRDFQWVE--QEPLMYANWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAYVP-DPYTQAFLTQAARGLRTPLWIGLAGEEGSRRYSW--VSEEPLNYVGWQDGEPQ--QPGGCTYVD--VDGAWRTTSCDTKLQGAVCG-VSSGPPPPRRISYHGSCPQGLADSAWIPFREHCYSFHMELLLGHKEARQRCQRAGGAVLSILDEMENVFVWE-HLQSYEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWG--PPGLGPSMLSHNSCYWIQSNSGLWRPGACTNITMGVVCKLP 1396          

HSP 3 Score: 41.9726 bits (97), Expect = 1.621e-16
Identity = 30/115 (26.09%), Postives = 53/115 (46.09%), Query Frame = -2
Query: 2662 YVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQ--ENCVHGLYYPAGLWNDISCNTPNSVICQK 3000
            Y +  +K ++  +   C     +L++I + +         IK ++   WI  ND  ++  +  S  + + + +W   EPN  R   E+CV  ++ P G WND  CN     IC+K
Sbjct:  394 YRLQAEKRSWQESKKACLRGGGDLVSI-HSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCV-TIWGPEGRWNDSPCNQSLPSICKK 506          

HSP 4 Score: 83.1889 bits (204), Expect = 2.397e-15
Identity = 82/354 (23.16%), Postives = 129/354 (36.44%), Query Frame = -3
Query:  204 SYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVIC--------EPINDTK-----------------NGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN--ENCITGNNYQDALWNDEKCGSLNSVICQPIK-------------------YGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSD-GTWNDVKC-DMKNKVIC 1121
            S  WI   D    G W    +  L Y NW S +PD    ENC V  T+++G W +  C      +C        EP    +                 + + + + K  +  + K C     +LV I       +     +   +   WI  ND + +  +E S  +L+SF  WH  EP   R+  E+C+T     +  WND  C      IC+                      + PS Y + + +  Y +  + C      LV IT+  +  FV  L    +   FW    D+ + G +     + + Y +WN  QP G  +  C+     S  G W    C   + + IC
Sbjct:  294 STLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSIH-SMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWG-PEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQP-GYSRGGCVALATGSAMGLWEVKNCTSFRARYIC 644          

HSP 5 Score: 56.6102 bits (135), Expect = 1.187e-9
Identity = 35/119 (29.41%), Postives = 58/119 (48.74%), Query Frame = -2
Query: 2659 TDYGYVVNLQK-MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKK 3012
            TD  Y  N Q  +++  A + C++Q  +LL+I   I  +   N  +       WI  ND    G W  S ++P++Y NW+S +P+   +ENC       +G W +  C+     +C+KK
Sbjct:  245 TDSCYQFNFQSTLSWREAWASCEQQGADLLSITE-IHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKK 362          

HSP 6 Score: 27.335 bits (59), Expect = 1.187e-9
Identity = 33/125 (26.40%), Postives = 50/125 (40.00%), Query Frame = -3
Query: 2292 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKN----EKINKRVFNIAVYYNLGTYWITGNDYSKEG--SWVDSRNVSLQFKKWYQGEPNGGRK--ENCIHGLRYDNEFWNDVNCFHKNMVICE 2642
            F  + Y +  E  ++ E+ K C      L++I +    E I K++        +   WI  ND   +    W D   VS  F  W+  EPN  R   E+C+     +   WND  C      IC+
Sbjct:  389 FQGHCYRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITKQIKQ-----EVEELWIGLNDLKLQMNFEWSDGSLVS--FTHWHPFEPNNFRDSLEDCVTIWGPEGR-WNDSPCNQSLPSICK 505          

HSP 7 Score: 63.929 bits (154), Expect = 1.625e-9
Identity = 66/310 (21.29%), Postives = 120/310 (38.71%), Query Frame = -3
Query:  201 WYSTEPDGGKTEN---CAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVY-NLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ-----------PIKYGPSK--------------YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKK--ENCIQGLYFSDGTWNDVKCDMKNKVICE 1037
            W +T  D GK E    C +   D    WD            + + D+   F+  S  + +  A   C  +  +L+ I   +++ Q Y N  +T      WI  ND    G W+ S  + L +  W   +P     ENC          W +  C      +C+           P ++   K              Y +   KR++++  K C      LV I    + +F+    +K ++   WI  ND+  + ++  +D   +++ +W+  +PN  +   E+C+  ++  +G WND  C+     IC+
Sbjct:  212 WCATTQDYGKDERWGFCPIKSNDCETFWDK-----------DQLTDSCYQFNFQST-LSWREAWASCEQQGADLLSIT--EIHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICK 505          
BLAST of SMED30004599 vs. Ensembl Human
Match: CLEC3B (C-type lectin domain family 3 member B [Source:HGNC Symbol;Acc:HGNC:11891])

HSP 1 Score: 74.7146 bits (182), Expect = 8.550e-15
Identity = 43/117 (36.75%), Postives = 58/117 (49.57%), Query Frame = -3
Query:  921 FYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKS--NLSYFWIDGTDSANEGNWVDYQDQKLSYKNW---YSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE 1256
            F + T+      A E C +R   +      S+ND    Y  +S  N +  W+   D A EG WVD    +++YKNW    + +PDGGKTENCAV    ANG W D  C+     IC+
Sbjct:   40 FLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQ 156          

HSP 2 Score: 58.9214 bits (141), Expect = 2.101e-9
Identity = 36/115 (31.30%), Postives = 56/115 (48.70%), Query Frame = -3
Query: 1653 YTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQY--NIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQ---EPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE 1982
            +T+ K T+  A + C+++   L T    + N  +++   Q   N    W+  ND+  EG WVD    +++Y NW  +   +PDGGK ENC      A+G W D  C      IC+
Sbjct:   43 FTQTK-TFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQ 156          

HSP 3 Score: 56.6102 bits (135), Expect = 1.632e-8
Identity = 33/114 (28.95%), Postives = 54/114 (47.37%), Query Frame = -3
Query:  192 RNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGT---FWINGNDVANEGHWVDTDNESLTYLNWNIR---QPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKV 515
            + + +  + C S+  +L       +N  +Y+  L+  +G     W+  ND+A EG WVD     + Y NW      QP+GGK ENC      ++G W D +C  +   IC+  +
Sbjct:   47 KTFHEASEDCISRGGTLGTPQTGSENDALYEY-LRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGI 159          
BLAST of SMED30004599 vs. Ensembl Human
Match: CLEC3B (C-type lectin domain family 3 member B [Source:HGNC Symbol;Acc:HGNC:11891])

HSP 1 Score: 73.559 bits (179), Expect = 5.277e-14
Identity = 43/117 (36.75%), Postives = 58/117 (49.57%), Query Frame = -3
Query:  921 FYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKS--NLSYFWIDGTDSANEGNWVDYQDQKLSYKNW---YSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE 1256
            F + T+      A E C +R   +      S+ND    Y  +S  N +  W+   D A EG WVD    +++YKNW    + +PDGGKTENCAV    ANG W D  C+     IC+
Sbjct:   82 FLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQ 198          

HSP 2 Score: 58.151 bits (139), Expect = 9.844e-9
Identity = 36/115 (31.30%), Postives = 56/115 (48.70%), Query Frame = -3
Query: 1653 YTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQY--NIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQ---EPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE 1982
            +T+ K T+  A + C+++   L T    + N  +++   Q   N    W+  ND+  EG WVD    +++Y NW  +   +PDGGK ENC      A+G W D  C      IC+
Sbjct:   85 FTQTK-TFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQ 198          

HSP 3 Score: 55.4546 bits (132), Expect = 7.237e-8
Identity = 33/114 (28.95%), Postives = 54/114 (47.37%), Query Frame = -3
Query:  192 RNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGT---FWINGNDVANEGHWVDTDNESLTYLNWNIR---QPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKV 515
            + + +  + C S+  +L       +N  +Y+  L+  +G     W+  ND+A EG WVD     + Y NW      QP+GGK ENC      ++G W D +C  +   IC+  +
Sbjct:   89 KTFHEASEDCISRGGTLGTPQTGSENDALYEY-LRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGI 201          
BLAST of SMED30004599 vs. Ensembl Human
Match: CLEC3A (C-type lectin domain family 3 member A [Source:HGNC Symbol;Acc:HGNC:2052])

HSP 1 Score: 72.7886 bits (177), Expect = 1.083e-13
Identity = 40/135 (29.63%), Postives = 69/135 (51.11%), Query Frame = -3
Query:  186 SLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGT--FWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEK 584
            +L +V  +  K     Y  S+  +++ +  + C SK   LV   +  +   + D   +S  G   FW+  ND+  EG +VD +  ++++LNW+  QPNGGK+ENC+     + G W+D  C    + ICE  + +
Sbjct:   72 ALQTVCLRGTKVHKKCYLASEGLKHFHEANEDCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKRYICEFTIPQ 206          

HSP 2 Score: 64.6994 bits (156), Expect = 6.075e-11
Identity = 27/65 (41.54%), Postives = 38/65 (58.46%), Query Frame = -3
Query: 1653 YWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE 1847
            +W+  ND++ EG +VD N   +S+ NW   +P+GGKRENC+     A G W+D  C      ICE
Sbjct:  137 FWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKRYICE 201          

HSP 3 Score: 60.077 bits (144), Expect = 1.874e-9
Identity = 41/148 (27.70%), Postives = 69/148 (46.62%), Query Frame = -3
Query:  921 RINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNL-AAREFCANRNMRIVKIDNASKNDLAMTYAIKS--NLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE 1355
            +I  LW +V  ++L E+        +    +   Y ++E + +   A E C ++   +V   N+ + +    Y  +S   ++ FW+   D   EG +VD     +S+ NW   +P+GGK ENC +    A G W D  C+S    ICE
Sbjct:   56 QIEKLWTEV--NALKEIQALQTVCLRGTKVHKKCYLASEGLKHFHEANEDCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKRYICE 201          

HSP 4 Score: 55.4546 bits (132), Expect = 6.872e-8
Identity = 33/114 (28.95%), Postives = 57/114 (50.00%), Query Frame = -3
Query: 2292 YLINEEIMTYDEAVKFCGEKNLRLLTIKN-EKINK-RVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2627
            YL +E +  + EA + C  K   L+  +N ++IN  + +       +  +W+  ND   EG +VD   +++ F  W + +PNGG++ENC+   +     W+D  C      ICE
Sbjct:   88 YLASEGLKHFHEANEDCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKRYICE 201          

HSP 5 Score: 51.6026 bits (122), Expect = 1.482e-6
Identity = 22/65 (33.85%), Postives = 34/65 (52.31%), Query Frame = -2
Query: 2665 YWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQ 2859
            +W+  ND   EG +VD     + + NW   +PNG ++ENCV       G W+D +C +    IC+
Sbjct:  137 FWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKRYICE 201          

HSP 6 Score: 51.6026 bits (122), Expect = 1.536e-6
Identity = 22/65 (33.85%), Postives = 35/65 (53.85%), Query Frame = -3
Query:  561 YWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ 755
            +W+  ND   EG++ D     +SF  W +++P GG+ ENC+  +      W+DE C S    IC+
Sbjct:  137 FWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKRYICE 201          
BLAST of SMED30004599 vs. Ensembl Celegans
Match: Y38H6C.8 (pep chromosome:WBcel235:V:20514637:20515706:1 gene:WBGene00012621.1 transcript:Y38H6C.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y38H6C.8)

HSP 1 Score: 51.2174 bits (121), Expect = 3.793e-7
Identity = 38/128 (29.69%), Postives = 60/128 (46.88%), Query Frame = -3
Query:  201 CQP--IKYGPSKYHISKSKRNYKDGVKYC-KSKKMSLVKITDDKDNKFVYDLA---LKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 566
            C P  + +G S Y  ++    +KD    C K    SLVKIT+  DN ++  LA   L +   +FWI  +D A+  +W   D   + + NW   QP   +  +C   +  S G W    CD + + +C+
Sbjct:   18 CVPGDVGFGDSCYSFNRVHGKFKDANDLCVKMFGGSLVKITNIIDNNWMQKLAVNHLDADYNSFWIGASDAAHYTNWTWIDGSPMRFSNWGPGQPL--EDRHC-GTMLISTGKWFSQVCDERIQFLCQ 142          
BLAST of SMED30004599 vs. Ensembl Celegans
Match: clec-53 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:P91429])

HSP 1 Score: 49.6766 bits (117), Expect = 5.877e-6
Identity = 43/153 (28.10%), Postives = 58/153 (37.91%), Query Frame = -2
Query: 2623 HLNAVICMKSPIIKTDYGYVVNLQKMA--YTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGN------DNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKSIC-RIRIP 3054
            HL +  C    I +      + L + A  + TA S C   +  L++I N I N  V + A KY  G  WI          N +  YW D  +    YQN+K G+P       C+  L      W   +C      IC    T    C  I IP
Sbjct:   14 HLISAQCGPGSIYQQSNSRCLTLFRAAVNFQTAESICATLSGHLVSIHNAIDNAFVSSQAQKYMDGGAWIGAQASAPDVTNPLNWYWTDGSN--FDYQNYKVGQPTPPGSTACMQ-LETGTAKWQTANCTNKLPFICSAAATVVPTCPTITIP 163          
BLAST of SMED30004599 vs. Ensembl Fly
Match: tfc (gene:FBgn0035199 transcript:FBtr0072661)

HSP 1 Score: 65.4698 bits (158), Expect = 1.085e-11
Identity = 43/136 (31.62%), Postives = 72/136 (52.94%), Query Frame = -3
Query:  195 IKYGPSKYHISKS-KRNYKDGVKYCKSKKMSLVKITDDKDN----KFVYDLALKSKLGTFWINGNDVANEGH--WVDTDNESLTYLNWNIRQPN-----GGKKENCIQGLYFSDG---TWNDVKCDMKNKVICELK 557
            +K G  +Y++    K N+    +YC+   M L  I+  ++N    K + D  L  +   FWI+G D+A+EG+  W+ T    +T+ NWN  +PN      G++ENC++ L+  DG    WND  C  +   +CE++
Sbjct:   55 LKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHE--HFWISGTDLADEGNFFWMAT-GRPITFTNWNAGEPNNFRYENGEEENCLE-LWNRDGKGLKWNDSPCSFETYFVCEVQ 186          

HSP 2 Score: 53.1434 bits (126), Expect = 1.954e-7
Identity = 37/119 (31.09%), Postives = 59/119 (49.58%), Query Frame = -3
Query: 1653 KMTYKSAVKYCLAQSMNLVTI----DNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWV-DSNNNKLSYTNWHYQEP-----DGGKRENCIQSLVYADG---FWNDVECDQPNSVICE 1970
            K  +  A +YC    M+L +I    +N+   K + D  L +  + +WI+G DL  EGN+   +    +++TNW+  EP     + G+ ENC++ L   DG    WND  C      +CE
Sbjct:   69 KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGH--EHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLE-LWNRDGKGLKWNDSPCSFETYFVCE 184          

HSP 3 Score: 50.8322 bits (120), Expect = 1.026e-6
Identity = 35/116 (30.17%), Postives = 55/116 (47.41%), Query Frame = -3
Query:  921 KMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSY--FWIDGTDSANEGNWV-DYQDQKLSYKNWYSTEP-----DGGKTENCA-VSLTDANGL-WDDAHCQSMNSVICE 1238
            K N   A ++C    M +  I +  +ND    +     L +  FWI GTD A+EGN+      + +++ NW + EP     + G+ ENC  +   D  GL W+D+ C      +CE
Sbjct:   69 KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 184          

HSP 4 Score: 50.447 bits (119), Expect = 1.275e-6
Identity = 35/124 (28.23%), Postives = 58/124 (46.77%), Query Frame = -2
Query: 2665 YVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGY--YWIDGNDNGMEG--YWVDSKSNPMQYQNWKSGEPNGKR-----QENCVHGLYYPAG---LWNDISCNTPNSVICQ 3000
            Y+    K  +  A  +C+   M L +I +   N R+      + +G+  +WI G D   EG  +W+ +   P+ + NW +GEPN  R     +ENC+  L+   G    WND  C+     +C+
Sbjct:   63 YLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWM-ATGRPITFTNWNAGEPNNFRYENGEEENCLE-LWNRDGKGLKWNDSPCSFETYFVCE 184          
BLAST of SMED30004599 vs. Ensembl Fly
Match: tfc (gene:FBgn0035199 transcript:FBtr0072660)

HSP 1 Score: 65.4698 bits (158), Expect = 1.085e-11
Identity = 43/136 (31.62%), Postives = 72/136 (52.94%), Query Frame = -3
Query:  195 IKYGPSKYHISKS-KRNYKDGVKYCKSKKMSLVKITDDKDN----KFVYDLALKSKLGTFWINGNDVANEGH--WVDTDNESLTYLNWNIRQPN-----GGKKENCIQGLYFSDG---TWNDVKCDMKNKVICELK 557
            +K G  +Y++    K N+    +YC+   M L  I+  ++N    K + D  L  +   FWI+G D+A+EG+  W+ T    +T+ NWN  +PN      G++ENC++ L+  DG    WND  C  +   +CE++
Sbjct:   55 LKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHE--HFWISGTDLADEGNFFWMAT-GRPITFTNWNAGEPNNFRYENGEEENCLE-LWNRDGKGLKWNDSPCSFETYFVCEVQ 186          

HSP 2 Score: 53.1434 bits (126), Expect = 1.954e-7
Identity = 37/119 (31.09%), Postives = 59/119 (49.58%), Query Frame = -3
Query: 1653 KMTYKSAVKYCLAQSMNLVTI----DNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWV-DSNNNKLSYTNWHYQEP-----DGGKRENCIQSLVYADG---FWNDVECDQPNSVICE 1970
            K  +  A +YC    M+L +I    +N+   K + D  L +  + +WI+G DL  EGN+   +    +++TNW+  EP     + G+ ENC++ L   DG    WND  C      +CE
Sbjct:   69 KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGH--EHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLE-LWNRDGKGLKWNDSPCSFETYFVCE 184          

HSP 3 Score: 50.8322 bits (120), Expect = 1.026e-6
Identity = 35/116 (30.17%), Postives = 55/116 (47.41%), Query Frame = -3
Query:  921 KMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSY--FWIDGTDSANEGNWV-DYQDQKLSYKNWYSTEP-----DGGKTENCA-VSLTDANGL-WDDAHCQSMNSVICE 1238
            K N   A ++C    M +  I +  +ND    +     L +  FWI GTD A+EGN+      + +++ NW + EP     + G+ ENC  +   D  GL W+D+ C      +CE
Sbjct:   69 KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 184          

HSP 4 Score: 50.447 bits (119), Expect = 1.275e-6
Identity = 35/124 (28.23%), Postives = 58/124 (46.77%), Query Frame = -2
Query: 2665 YVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGY--YWIDGNDNGMEG--YWVDSKSNPMQYQNWKSGEPNGKR-----QENCVHGLYYPAG---LWNDISCNTPNSVICQ 3000
            Y+    K  +  A  +C+   M L +I +   N R+      + +G+  +WI G D   EG  +W+ +   P+ + NW +GEPN  R     +ENC+  L+   G    WND  C+     +C+
Sbjct:   63 YLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWM-ATGRPITFTNWNAGEPNNFRYENGEEENCLE-LWNRDGKGLKWNDSPCSFETYFVCE 184          
BLAST of SMED30004599 vs. Ensembl Fly
Match: tfc (gene:FBgn0035199 transcript:FBtr0072659)

HSP 1 Score: 65.4698 bits (158), Expect = 9.711e-11
Identity = 43/136 (31.62%), Postives = 72/136 (52.94%), Query Frame = -3
Query:  195 IKYGPSKYHISKS-KRNYKDGVKYCKSKKMSLVKITDDKDN----KFVYDLALKSKLGTFWINGNDVANEGH--WVDTDNESLTYLNWNIRQPN-----GGKKENCIQGLYFSDG---TWNDVKCDMKNKVICELK 557
            +K G  +Y++    K N+    +YC+   M L  I+  ++N    K + D  L  +   FWI+G D+A+EG+  W+ T    +T+ NWN  +PN      G++ENC++ L+  DG    WND  C  +   +CE++
Sbjct:  243 LKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHE--HFWISGTDLADEGNFFWMAT-GRPITFTNWNAGEPNNFRYENGEEENCLE-LWNRDGKGLKWNDSPCSFETYFVCEVQ 374          

HSP 2 Score: 53.5286 bits (127), Expect = 6.322e-7
Identity = 37/119 (31.09%), Postives = 59/119 (49.58%), Query Frame = -3
Query: 1653 KMTYKSAVKYCLAQSMNLVTI----DNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWV-DSNNNKLSYTNWHYQEP-----DGGKRENCIQSLVYADG---FWNDVECDQPNSVICE 1970
            K  +  A +YC    M+L +I    +N+   K + D  L +  + +WI+G DL  EGN+   +    +++TNW+  EP     + G+ ENC++ L   DG    WND  C      +CE
Sbjct:  257 KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGH--EHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLE-LWNRDGKGLKWNDSPCSFETYFVCE 372          

HSP 3 Score: 50.447 bits (119), Expect = 5.345e-6
Identity = 34/118 (28.81%), Postives = 56/118 (47.46%), Query Frame = -2
Query: 2665 KMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGY--YWIDGNDNGMEG--YWVDSKSNPMQYQNWKSGEPNGKR-----QENCVHGLYYPAG---LWNDISCNTPNSVICQ 2982
            K  +  A  +C+   M L +I +   N R+      + +G+  +WI G D   EG  +W+ +   P+ + NW +GEPN  R     +ENC+  L+   G    WND  C+     +C+
Sbjct:  257 KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWM-ATGRPITFTNWNAGEPNNFRYENGEEENCLE-LWNRDGKGLKWNDSPCSFETYFVCE 372          

HSP 4 Score: 50.0618 bits (118), Expect = 8.479e-6
Identity = 36/117 (30.77%), Postives = 56/117 (47.86%), Query Frame = -3
Query:  921 KMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSY--FWIDGTDSANEGNWV-DYQDQKLSYKNWYSTEP-----DGGKTENCAVSL--TDANGL-WDDAHCQSMNSVICE 1238
            K N   A ++C    M +  I +  +ND    +     L +  FWI GTD A+EGN+      + +++ NW + EP     + G+ ENC + L   D  GL W+D+ C      +CE
Sbjct:  257 KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENC-LELWNRDGKGLKWNDSPCSFETYFVCE 372          
BLAST of SMED30004599 vs. Ensembl Fly
Match: CG12111 (gene:FBgn0030050 transcript:FBtr0331726)

HSP 1 Score: 49.6766 bits (117), Expect = 2.999e-6
Identity = 41/135 (30.37%), Postives = 59/135 (43.70%), Query Frame = -2
Query: 2650 IKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIG-------YYWIDGNDNGMEG--YWVDSKSNPMQYQNW---KSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTK 3018
            I  +Y Y+  + K+ +  A   C+  N  L +I++    K      IKY          Y+WI GND G EG  YW+ S   PM Y  W   K    N    ENCVH ++    + ND +C      +C+  + K
Sbjct:   51 IGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIED----KPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFYWM-SNGRPMTYAPWNGPKQMPDNYGGNENCVH-MFATREMINDANCKIQMLYVCEATEPK 179          
BLAST of SMED30004599 vs. Ensembl Fly
Match: CG12111 (gene:FBgn0030050 transcript:FBtr0071232)

HSP 1 Score: 49.6766 bits (117), Expect = 2.999e-6
Identity = 41/135 (30.37%), Postives = 59/135 (43.70%), Query Frame = -2
Query: 2650 IKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIG-------YYWIDGNDNGMEG--YWVDSKSNPMQYQNW---KSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTK 3018
            I  +Y Y+  + K+ +  A   C+  N  L +I++    K      IKY          Y+WI GND G EG  YW+ S   PM Y  W   K    N    ENCVH ++    + ND +C      +C+  + K
Sbjct:   51 IGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIED----KPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFYWM-SNGRPMTYAPWNGPKQMPDNYGGNENCVH-MFATREMINDANCKIQMLYVCEATEPK 179          
BLAST of SMED30004599 vs. Ensembl Zebrafish
Match: si:dkey-11o15.7 (si:dkey-11o15.7 [Source:ZFIN;Acc:ZDB-GENE-091204-328])

HSP 1 Score: 139.813 bits (351), Expect = 2.458e-33
Identity = 149/652 (22.85%), Postives = 251/652 (38.50%), Query Frame = -3
Query:  204 WMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDN-EATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNN-----KLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRH-TTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRIN------------------GLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNW-VDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVK-MKFDTAVKYCRNKKMELVKIDGDQMNNQVYNL-SVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPK-GGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLT-----YLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVIC 2057
            W++K+ +   P +   +      YH+    M++  A ++C     +L TIDN E  N+L+  ++  Y+    WI   D +    W   +N+     +  Y N++++  + G +E C+ +  Y  G W D  C      IC   R   T +Y        + +A  YC+     L+N+ N++ N+ + K          W+    N     W  +D +  SY+NW P+ P    + +  +   +N                  G W D  C S    IC      K       ++ S       A R FC      +  IDN  + +     A  +     WI   D  N   W +D    +  +K+WY  +      ++  V ++   G W ++ C  +   +C       +  ++   + + +  A  YCR    +LV I  +  N +V +L S  + +   WI    +R    W D  Q+  SF  W   +P   G +E C   +  +   W DE C +  + IC        +YH      N+ +  ++C+     L  I + ++ K +      S  G+ WI   D  N   W   DN+        Y NWN    N G +E C+   Y   G W DV CD     +C
Sbjct:  225 WLDKDCSYAFPFICYSEPASIRQYHFVSVPMSWTEAQRFCRQNYTDLATIDNMEEMNRLIDTVNGSYS-GVAWIGKYDDVNSWRWSLEDNHFYQEGERDYRNFYHEPDNSGGKELCVYTDPY--GKWIDYSCYNLLPFICYDGRQNATQRYIRFSGDKNWTEARRYCRDHYTDLVNVRNQTENQKILKTGGGG-----WIGLYRNR---TW--SDQQITSYENWRPQIPNSGLQPDNGEDYALNFFAEKGHQHCTAVSFGNAGQWTDEVCVSNMPFICYNRTCTKSSCVRQYYFVSVSTSWTEAQR-FCRQNYTDLATIDNMEEMNRLFKTARGTYYGKAWIGLYDDLNSWRWSLDNTALEGGFKSWYVQKQVNSGGQSLCVCMSRNPGTWSESPCSQIYPFVCYDGRVNASASYVFVYQYINWTEAQSYCRKHHTDLVSIRNEMENYRVQSLLSYDYTV---WIGLYRSRS---WSD--QSNSSFSNWRSGQPDNAGNSEYCTAVSFSESGSWTDENCNTQFAFICYSTIASSLQYHFVNQSMNWTEAQRFCRQNYTDLATIDNMEEMKRLIKTVNGSYNGSAWIGQYDDVNSWRWSLEDNDFYQEGERDYRNWNHEPNNIGGRELCV---YMHSGYWFDVPCDSYYPFVC 851          

HSP 2 Score: 106.301 bits (264), Expect = 7.900e-23
Identity = 143/641 (22.31%), Postives = 247/641 (38.53%), Query Frame = -3
Query:  204 TVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWV--DSNNNKLS---YTNWHYQEPDG-GKRENCIQSLVYADGFWNDVEC--DQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLN---TDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWV-----DYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHIT-SVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGR-----------------NENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPS----KYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLT--YLNWNI-RQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVIC 2003
            +V   Y +  E  T+  A +YC  +  +L TI+NE     + D     +ID  WI   D +K   W   DS+  K     + NW+   P+   ++  C+   +   G W    C  +   +V  +   + ++ Y       T+ +A +YC++    L++I NE+ N+I++            +  N+N+  G++     +D    S+  W+  + +G      +     +GLW D  C      IC        P+S   ++  +  M+   A+ FC      +  IDN  + +  +     S     WI   D  N   W       YQ+ +  Y+N+Y    + G  E C    TD  G W D  C ++   IC          +I  S    +  A +YCR+   +LV +      NQ  N  +    G  WI    NR    W D  Q + S++ W    P  G                  +++C   +      W DE C S    IC       S    +Y+      ++ +  ++C+     L  I + ++   ++  A  +  G  WI   D  N   W   DN +L   + +W + +Q N G +  C+  +  + GTW++  C      +C
Sbjct:    8 SVPRQYVFVNESKTWAEAQRYCRDKYTDLATIENEQQTIQLLDTVNDDSIDLAWIGLYDDLKSWRWTLEDSDFFKAGEKDFRNWYNPVPENYAQQRLCVYMYM---GIWKISFCTMEYLPAVCYDGRENASSAYVFIPQSQTWTEAQSYCREHYTDLVSIRNETENQIIES-----------IITNNNAWIGLYKTKYWSDQSNSSFLYWNSWQ-EGTSGHCTVTSFSDSGLWLDKDCSYAFPFIC-----YSEPASIRQYHFVSVPMSWTEAQRFCRQNYTDLATIDNMEEMNRLIDTVNGSYSGVAWIGKYDDVNSWRWSLEDNHFYQEGERDYRNFYHEPDNSGGKELCV--YTDPYGKWIDYSCYNLLPFICYDGRQNATQRYIRFSGDKNWTEARRYCRDHYTDLVNV-----RNQTENQKILKTGGGGWIGLYRNRT---WSD--QQITSYENWRPQIPNSGLQPDNGEDYALNFFAEKGHQHCTAVSFGNAGQWTDEVCVSNMPFICYNRTCTKSSCVRQYYFVSVSTSWTEAQRFCRQNYTDLATIDNMEEMNRLFKTARGTYYGKAWIGLYDDLNSWRW-SLDNTALEGGFKSWYVQKQVNSGGQSLCV-CMSRNPGTWSESPCSQIYPFVC 614          

HSP 3 Score: 56.6102 bits (135), Expect = 1.390e-11
Identity = 77/357 (21.57%), Postives = 134/357 (37.54%), Query Frame = -3
Query: 1656 TYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSW-VDSRNVSLQFKKWY-QGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVIC---------------EPMEKSPADPEICKSFLELCY------NSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYD------------KYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDN-EATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNN-----KLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVIC 2603
            ++ EA +FC +    L TI N +   R+F  A     G  WI   D      W +D+  +   FK WY Q + N G +  C+   R +   W++  C      +C               + +  + A     K   +L        N +++ +       W       I +  S+S  + S+  F +            +YC+    A  + +   W ++   T    +          YH+  + M +  A ++C     +L TIDN E   +L+  ++  YN    WI   D +    W   +N+     +  Y NW+++  + G RE C+       G+W DV CD     +C
Sbjct:  511 SWTEAQRFCRQNYTDLATIDNMEEMNRLFKTARGTYYGKAWIGLYDDLNSWRWSLDNTALEGGFKSWYVQKQVNSGGQSLCVCMSR-NPGTWSESPCSQIYPFVCYDGRVNASASYVFVYQYINWTEAQSYCRKHHTDLVSIRNEMENYRVQSLLSYDYTVW-------IGLYRSRSWSDQSNSSFSNWRSGQPDNAGNSEYCT----AVSFSESGSWTDENCNTQFAFICYSTIASSLQYHFVNQSMNWTEAQRFCRQNYTDLATIDNMEEMKRLIKTVNGSYNGS-AWIGQYDDVNSWRWSLEDNDFYQEGERDYRNWNHEPNNIGGRELCV---YMHSGYWFDVPCDSYYPFVC 851          

HSP 4 Score: 33.4982 bits (75), Expect = 1.390e-11
Identity = 28/129 (21.71%), Postives = 47/129 (36.43%), Query Frame = -2
Query: 2638 YTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNG-----------------KRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKSIC 2973
            +T A  +C++   +L+ ++N   N+++        IG Y            W D +     Y+NW+   PN                  K  ++C    +  AG W D  C +    IC  +   KS C
Sbjct:  381 WTEARRYCRDHYTDLVNVRNQTENQKILKTGGGGWIGLY--------RNRTWSDQQ--ITSYENWRPQIPNSGLQPDNGEDYALNFFAEKGHQHCTAVSFGNAGQWTDEVCVSNMPFICYNRTCTKSSC 499          

HSP 5 Score: 51.2174 bits (121), Expect = 4.340e-9
Identity = 34/114 (29.82%), Postives = 58/114 (50.88%), Query Frame = -2
Query: 2668 GYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFN-MAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEP-NGKRQENCVHGLYYPAGLWNDISCNTPNSVIC 3003
             YV   Q + +T A S+C++ + +L++I+N + N RV + ++  Y +   WI     G+      S  +   + NW+SG+P N    E C    +  +G W D +CNT  + IC
Sbjct:  624 SYVFVYQYINWTEAQSYCRKHHTDLVSIRNEMENYRVQSLLSYDYTV---WI-----GLYRSRSWSDQSNSSFSNWRSGQPDNAGNSEYCTAVSFSESGSWTDENCNTQFAFIC 729          

HSP 6 Score: 30.4166 bits (67), Expect = 4.340e-9
Identity = 30/117 (25.64%), Postives = 48/117 (41.03%), Query Frame = -3
Query: 2295 YLINEEIMTYDEAVKFCGEKNLRLLTIKN-EKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQ-----FKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVIC 2627
            Y    + M + EA +FC +    L TI N E++ + +  +   YN G+ WI   D      W    N   Q     ++ W     N G +E C++     + +W DV C      +C
Sbjct:  739 YHFVNQSMNWTEAQRFCRQNYTDLATIDNMEEMKRLIKTVNGSYN-GSAWIGQYDDVNSWRWSLEDNDFYQEGERDYRNWNHEPNNIGGRELCVY---MHSGYWFDVPCDSYYPFVC 851          

HSP 7 Score: 43.5134 bits (101), Expect = 1.625e-7
Identity = 34/112 (30.36%), Postives = 51/112 (45.54%), Query Frame = -3
Query: 2295 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEP-NGGRKENCIHGLRYDNEFWNDVNCFHKNMVIC 2627
            Y+   + + + EA  +C + +  L++I+NE  N RV ++  Y    T WI      +  SW D  N S  F  W  G+P N G  E C      ++  W D NC  +   IC
Sbjct:  625 YVFVYQYINWTEAQSYCRKHHTDLVSIRNEMENYRVQSLLSY--DYTVWI---GLYRSRSWSDQSNSS--FSNWRSGQPDNAGNSEYCTAVSFSESGSWTDENCNTQFAFIC 729          

HSP 8 Score: 32.7278 bits (73), Expect = 1.625e-7
Identity = 33/140 (23.57%), Postives = 57/140 (40.71%), Query Frame = -2
Query: 2626 ICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYW-VDSKSNPMQYQNWK-SGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKSICRIRI 3039
             C KS  ++  Y   V+    ++T A  FC++   +L TI N     R+F  A     G  WI   D+     W +D+ +    +++W    + N   Q  CV     P G W++  C+     +C   +   S   + +
Sbjct:  493 TCTKSSCVRQYYFVSVS---TSWTEAQRFCRQNYTDLATIDNMEEMNRLFKTARGTYYGKAWIGLYDDLNSWRWSLDNTALEGGFKSWYVQKQVNSGGQSLCVCMSRNP-GTWSESPCSQIYPFVCYDGRVNASASYVFV 628          

HSP 9 Score: 37.7354 bits (86), Expect = 1.413e-6
Identity = 30/118 (25.42%), Postives = 49/118 (41.53%), Query Frame = -2
Query: 2668 GYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEG-----YWVDSKSNPMQYQN-WKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVIC 3003
             YV   Q   +T A S+C+E   +L++I+N   N+ + ++             N+N   G     YW D  ++   Y N W+ G        +C    +  +GLW D  C+     IC
Sbjct:  137 AYVFIPQSQTWTEAQSYCREHYTDLVSIRNETENQIIESIIT-----------NNNAWIGLYKTKYWSDQSNSSFLYWNSWQEGTSG-----HCTVTSFSDSGLWLDKDCSYAFPFIC 238          

HSP 10 Score: 35.4242 bits (80), Expect = 1.413e-6
Identity = 31/110 (28.18%), Postives = 49/110 (44.55%), Query Frame = -3
Query: 2295 MTYDEAVKFCGEKNLRLLTIKN-EKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQ-----FKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVIC 2606
            M++ EA +FC +    L TI N E++N+ +  +   Y+ G  WI   D      W    N   Q     ++ +Y    N G KE C++   Y    W D +C++    IC
Sbjct:  255 MSWTEAQRFCRQNYTDLATIDNMEEMNRLIDTVNGSYS-GVAWIGKYDDVNSWRWSLEDNHFYQEGERDYRNFYHEPDNSGGKELCVYTDPYGK--WIDYSCYNLLPFIC 361          
BLAST of SMED30004599 vs. Ensembl Zebrafish
Match: mrc1a (mannose receptor, C type 1a [Source:ZFIN;Acc:ZDB-GENE-090915-4])

HSP 1 Score: 125.946 bits (315), Expect = 1.051e-28
Identity = 155/689 (22.50%), Postives = 244/689 (35.41%), Query Frame = -3
Query:  201 MTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVEC----------------------DQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGY--RKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKK---RPSSNSL-------------FYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWI--DGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDAN-GLWDDAHCQSMNSVICE--------------------PIN----DTKNGFHITS----VKMKFDTAVKYCRNKKMELVKIDGD-QMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNYQDALWNDEKCGSLNSVICQP-------------------------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWING-NDVANEGHWVDTDNESLTYLNWNIRQPN-GGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 1967
            +T+  A   C  Q  +L++I        +  L+  +     WI  N L  E  W  SN N   Y NW    P       C          W  + C                      DQPN      + +  N Y++ + +  +NDA+  C +    L +I N   +  +          + W+  ND   + ++  +D   +++  W   EP  +  R E+C+     +G W D  C+     IC+   + K    P   SL             + S+ E      A++ C      +V + +  +N   ++        YFWI    T+S     W +    K ++ N    E    K   C   LT  + GLWD   C S    IC+                    P+     D +N   I S     K  +  A  YC+    +L       Q+NN  Y +  T  +G   +N N       W D   +   F+ W   EP    N E C   + Y    WND  C + N  ICQ                          I+Y  S+Y I++     +D   +CK     LV IT   + KFV+    +     ++I    ++    +WVD     + Y +W+  +PN     ENC+  +Y S G WND+ C +    IC+
Sbjct:  239 LTWHQARTSCQQQEADLLSITELHEQSYISGLTNTFGSA-LWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLTCAALNAGKASKWESMACNKKLGYICRKGNSTDNTPPPGKDQPNFCPAAWVPYAGNCYYLQRTKKMWNDALAACHREGANLASIHNIEEHSFIISQSGYLPTDELWIGLNDQKTQNLFEWSDRTHVTFTTWLVGEPSHFINRLEDCVLIKGKDGKWADHACEMERGYICKKKSSSKPEGAPEVVSLGCQAGWVRYGSYCYMSAIESKTFNEAKQICEQTGANLVDVASRYENAFLISLVGLRPEKYFWIGLSNTESPESFRWSNSDKVKFTHFNVGMPE----KHRGCVAMLTGTSAGLWDVLDCNSKQKYICKKMAEGVTTTQIPPTTQPLSCPVGWTKKDPRNCIQIYSRPKEQKKTWFEARDYCKAIGGDLASFHSQKQINNLQYGMGETAWIGFNLLNINSGFV---WTDGTPS--DFENWSFGEPNNHNNQELCTESSFYYGRKWNDRDCEAYNDWICQIAIGTTPKSPPTTVTQVEYNKTSDGWIQYNDSQYFINEESLPMEDARSFCKKNNGDLVVITGQTERKFVWKQISRGSENQYYIGMIVNLDKSFNWVD--GSPVVYTSWDQNEPNFANNDENCVT-IYKSMGFWNDINCGVPLPSICK 914          

HSP 2 Score: 117.857 bits (294), Expect = 3.272e-26
Identity = 169/717 (23.57%), Postives = 268/717 (37.38%), Query Frame = -3
Query:  183 KNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNI-DWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDG-GKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNK-------------------------YHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGV-WLNTDNEEISYKNWHPKEPQ-GYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQN---------KKRPSSNS----LFYSS-----TEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWY----STEPDGGK------TEN--CAVSLTDA---NGLWDDAHCQSMNSVICEPINDTK------------------NGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGR-YWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC-QPIKYGPSK------------------------YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYD--LALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 2009
            +N ++       +K T+  A  YC A   +L +  ++   K +++L  QY + +  WI  N L     +V ++     + NW + EP+    +E C +S  Y    WND +C+  N  IC+    TT K                         Y I ++ +   DA ++CKK N  L+ I  ++  K V K + +  +  Y++    N ++   W+  D   + Y +W   EP      ENC+   +  G WND+ C      IC+   N           RP   S    +F  S       KM    AR  C +    +V I    +     T  + S +   WI   D   E  ++    + +SY NW     S+ PDG        +EN  C V L       G+W    C      IC+   DT+                  + + +   KM +D A + C+    +L  +      +Q Y +     L    WI  N N   GQ+      LLS+ +W   EPK   N  C+  +   D  W    C +    +C Q     P+                         Y    +  N+      C     SLV I D K++ F+      ++  + +FWI G   +  G W+  DN  + Y NW  +  N     +C++ +  S G WN V C+     IC  K EK+
Sbjct:  655 RNCIQIYSRPKEQKKTWFEARDYCKAIGGDLASFHSQ---KQINNL--QYGMGETAWIGFNLLNINSGFVWTDGTPSDFENWSFGEPNNHNNQELCTESSFYYGRKWNDRDCEAYNDWICQIAIGTTPKSPPTTVTQVEYNKTSDGWIQYNDSQYFINEESLPMEDARSFCKKNNGDLVVITGQTERKFVWKQISRGSENQYYIGMIVNLDKSFNWV--DGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVPLPSICKRSSNFINSTLPLPTVRPGGCSPEWTIFQGSCYKLFQNKMTWHDARNLCISHGGNLVSILTHEEQAFLTTLMLDS-VDDIWIGFNDVNWEMRFLWTDGKGVSYTNWAKGVPSSMPDGPSRMYEFGSENYDCVVMLRSPEKMTGMWKVQMCGDQQGFICKRKTDTQLIRPVTTAAPQHFFTLGNDSYKVQKEKMSWDEARRQCKASDADLASVRNSI--SQAYTILTVSKLKEPLWIGLNSNLTSGQYRWVDNWLLSYSRWATGEPK--NNLACVYIDT--DGRWKTATCNNTYYSLCKQSTDIAPTDPPQMPGNCPESKKRKTWIPFRGHCYAFMSNSENWAHATVECIRIGGSLVSIEDPKESHFIQRNVELMQDGVRSFWI-GMHRSYMGDWMWIDNAVVDYTNWRTQVTNNAG--HCVE-IQSSSGLWNAVNCNSYKPYIC--KTEKV 1351          

HSP 3 Score: 93.9745 bits (232), Expect = 7.576e-19
Identity = 158/743 (21.27%), Postives = 268/743 (36.07%), Query Frame = -3
Query:  132 YHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDG--GKRENCIQSLVYADGFWNDVECDQPNSVICEP---------------------MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWV--NGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQ---------------------NKKRPSSNSLFYSST--EKMNNLAAREFCANRNMRIVKID-----NASKNDLAMTYAIKSNL-----SYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDG-GKTENCAVSLTDANGLWDDAHCQSMNSVICE-----------------PINDTKNG--------FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNR-KEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNYQDALWNDEKCGSLNSVICQ----------PIK-------------YGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPN------------GGKKENCIQGLYFSD---GTWNDVKCDMKNKVICELKVEKL*T*ET*PNETFEIKHFL 1988
            Y+  R K  +  A+  C  +  NL +I N   +  +   S     D  WI  ND   +  +  S+   +++T W   EP     + E+C+  +   DG W D  C+     IC+                      +R+ +  Y    +  TFN+A   C++    L+++ +   N  +  LV    +  +W+  +  ++ E   W N+D  ++ + +++   P+ +R    +      GLW+ + C+S  + IC+ +                       KK P +    YS    +K     AR++C      +         N  +  +  T  I  NL      + W DGT S               ++NW   EP+     E C  S       W+D  C++ N  IC+                   N T +G        + I    +  + A  +C+    +LV I G      V+      +  +Y+I    N  K   W D     + +  W ++EP    N ENC+T        WND  CG     IC+          P+              +  S Y + ++K  + D    C S   +LV I   ++  F+  L L S +   WI  NDV  E  ++ TD + ++Y NW    P+            G +  +C+  L   +   G W    C  +   IC+ K +   T    P  T   +HF 
Sbjct:  373 YYLQRTKKMWNDALAACHREGANLASIHNIEEHSFIISQSGYLPTDELWIGLNDQKTQNLFEWSDRTHVTFTTWLVGEPSHFINRLEDCVL-IKGKDGKWADHACEMERGYICKKKSSSKPEGAPEVVSLGCQAGWVRYGSYCYMSAIESKTFNEAKQICEQTGANLVDVASRYENAFLISLVGLRPEKYFWIGLSNTESPESFRWSNSD--KVKFTHFNVGMPEKHRGCVAMLTGTSAGLWDVLDCNSKQKYICKKMAEGVTTTQIPPTTQPLSCPVGWTKKDPRNCIQIYSRPKEQKKTWFEARDYCKAIGGDLASFHSQKQINNLQYGMGETAWIGFNLLNINSGFVWTDGTPS--------------DFENWSFGEPNNHNNQELCTESSFYYGRKWNDRDCEAYNDWICQIAIGTTPKSPPTTVTQVEYNKTSDGWIQYNDSQYFINEESLPMEDARSFCKKNNGDLVVITGQTERKFVWKQISRGSENQYYIGMIVNLDKSFNWVDGSP--VVYTSWDQNEPNFANNDENCVTIYKSM-GFWNDINCGVPLPSICKRSSNFINSTLPLPTVRPGGCSPEWTIFQGSCYKLFQNKMTWHDARNLCISHGGNLVSILTHEEQAFLTTLMLDS-VDDIWIGFNDVNWEMRFLWTDGKGVSYTNWAKGVPSSMPDGPSRMYEFGSENYDCVVMLRSPEKMTGMWKVQMCGDQQGFICKRKTD---TQLIRPVTTAAPQHFF 1091          

HSP 4 Score: 86.6557 bits (213), Expect = 1.216e-16
Identity = 146/663 (22.02%), Postives = 243/663 (36.65%), Query Frame = -3
Query:  921 YIIQLACGMIFLAILPTXXXXXXXXXXXQFVEYG---YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITG-NDYSKEGSWVDSRNVSLQFKKWYQGEPN-GGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWH----YQEPDGGKRE--------NCIQSLVYAD---GFWNDVECDQPNSVICE---------------PMRHTT---NKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQ---------PIQ-------NKKR----PSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAM--TYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE 2729
            +I Q+A G    +   T + V   K    +++Y    Y INEE +  ++A  FC + N  L+ I  +   K V+      +   Y+I    +  K  +WVD   V   +  W Q EPN     ENC+  +     FWND+NC                                +  IC+ +  F  ST    +P+ T +              CS  +   ++Q  C                        Y   + KMT+  A   C++   NLV+I        +  L L  ++D  WI  ND+  E  ++ ++   +SYTNW        PDG  R         +C+  L   +   G W    C      IC+               P    T   + Y + K++M++++A   CK  +  L ++ N  S       V K  +   W+  N N   G +   DN  +SY  W   EP+      C+  +  +G W   TC++    +C+         P Q       +KKR    P     +   +   N   A   C      +V I++  ++         ++  +  FWI G   +  G+W+   +  + Y NW +   +     +C V +  ++GLW+  +C S    IC+
Sbjct:  767 WICQIAIGTTPKSPPTTVTQVEYNKTSDGWIQYNDSQYFINEESLPMEDARSFCKKNNGDLVVITGQTERKFVWKQISRGSENQYYIGMIVNLDKSFNWVDGSPVV--YTSWDQNEPNFANNDENCVT-IYKSMGFWNDINC-----------------------------GVPLPSICKRSSNFINST----LPLPTVRP-----------GGCSPEW--TIFQGSC------------------------YKLFQNKMTWHDARNLCISHGGNLVSILTHEEQAFLTTLMLD-SVDDIWIGFNDVNWEMRFLWTDGKGVSYTNWAKGVPSSMPDGPSRMYEFGSENYDCVVMLRSPEKMTGMWKVQMCGDQQGFICKRKTDTQLIRPVTTAAPQHFFTLGNDSYKVQKEKMSWDEARRQCKASDADLASVRNSISQAYTILTVSKLKE-PLWIGLNSNLTSGQYRWVDNWLLSYSRWATGEPK--NNLACVY-IDTDGRWKTATCNNTYYSLCKQSTDIAPTDPPQMPGNCPESKKRKTWIPFRGHCYAFMSNSENWAHATVECIRIGGSLVSIEDPKESHFIQRNVELMQDGVRSFWI-GMHRSYMGDWMWIDNAVVDYTNWRTQVTNNAG--HC-VEIQSSSGLWNAVNCNSYKPYICK 1347          

HSP 5 Score: 44.2838 bits (103), Expect = 6.346e-9
Identity = 31/115 (26.96%), Postives = 51/115 (44.35%), Query Frame = -2
Query: 2662 YVVNLQK-MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIG-YYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3000
            Y  N+Q  + +  A + C++Q  +LL+I    ++++ +   +    G   WI  N    E  W  S  NP +Y NW  G P+ +    C       A  W  ++CN     IC+K
Sbjct:  231 YQRNVQSILTWHQARTSCQQQEADLLSITE--LHEQSYISGLTNTFGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLTCAALNAGKASKWESMACNKKLGYICRK 343          

HSP 6 Score: 36.965 bits (84), Expect = 6.346e-9
Identity = 37/165 (22.42%), Postives = 66/165 (40.00%), Query Frame = -3
Query: 2199 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNG--GRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLEL------------CYNSKI--------RKICQNT 2627
            Y +      +++A+  C  +   L +I N + +  + + + Y      WI  ND   +  +  S    + F  W  GEP+    R E+C+  ++  +  W D  C  +   IC+  +KS + PE     + L            CY S I        ++IC+ T
Sbjct:  373 YYLQRTKKMWNDALAACHREGANLASIHNIEEHSFIISQSGYLPTDELWIGLNDQKTQNLFEWSDRTHVTFTTWLVGEPSHFINRLEDCVL-IKGKDGKWADHACEMERGYICK--KKSSSKPEGAPEVVSLGCQAGWVRYGSYCYMSAIESKTFNEAKQICEQT 534          

HSP 7 Score: 58.151 bits (139), Expect = 6.256e-8
Identity = 39/118 (33.05%), Postives = 57/118 (48.31%), Query Frame = -2
Query: 2662 DYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGY-WVDSKSNPMQYQNWKSGEPN-GKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3009
            D  Y +N + +    A SFCK+ N +L+ I      K V+    +     Y+I    N  + + WVD   +P+ Y +W   EPN     ENCV  +Y   G WNDI+C  P   IC++
Sbjct:  801 DSQYFINEESLPMEDARSFCKKNNGDLVVITGQTERKFVWKQISRGSENQYYIGMIVNLDKSFNWVDG--SPVVYTSWDQNEPNFANNDENCVT-IYKSMGFWNDINCGVPLPSICKR 915          

HSP 8 Score: 38.1206 bits (87), Expect = 5.052e-6
Identity = 25/116 (21.55%), Postives = 53/116 (45.69%), Query Frame = -2
Query: 2662 YGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLY-YPAGLWNDISCNTPNSVICQK 3006
            Y Y+  ++   +  A   C++    L+ + +   N  + ++       Y+WI  ++      +  S S+ +++ ++  G P  ++   CV  L    AGLW+ + CN+    IC+K
Sbjct:  513 YCYMSAIESKTFNEAKQICEQTGANLVDVASRYENAFLISLVGLRPEKYFWIGLSNTESPESFRWSNSDKVKFTHFNVGMP--EKHRGCVAMLTGTSAGLWDVLDCNSKQKYICKK 626          

HSP 9 Score: 33.4982 bits (75), Expect = 5.052e-6
Identity = 34/128 (26.56%), Postives = 55/128 (42.97%), Query Frame = -3
Query: 2241 EEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLG-TYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNG-GRKENCIHGLRYDNEFWNDVNCFHKNMVICE-PMEKSPADPEICKSFLE 2615
            E+  T+ EA  +C      L +  ++K   ++ N+   Y +G T WI  N  +    +V +      F+ W  GEPN    +E C     Y    WND +C   N  IC+  +  +P  P    + +E
Sbjct:  666 EQKKTWFEARDYCKAIGGDLASFHSQK---QINNLQ--YGMGETAWIGFNLLNINSGFVWTDGTPSDFENWSFGEPNNHNNQELCTESSFYYGRKWNDRDCEAYNDWICQIAIGTTPKSPPTTVTQVE 788          
BLAST of SMED30004599 vs. Ensembl Zebrafish
Match: si:dkey-11o15.7 (si:dkey-11o15.7 [Source:ZFIN;Acc:ZDB-GENE-091204-328])

HSP 1 Score: 116.701 bits (291), Expect = 5.592e-26
Identity = 144/665 (21.65%), Postives = 247/665 (37.14%), Query Frame = -3
Query:  204 QKICGWMEKEMTTVAPVVQKLKNTVEF--------GYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATN-KLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGF-WNDVECDQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNE-----EISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDY-------QDQKLSYKNWYS------TEPDGG-------KTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTK----NGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLS-FKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPS-KYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQP-NGGKKENCIQGLYFSDGTWNDVKCDMKNKVIC 2072
            Q IC +M + +        +L  TV +         Y +  +   +  A  YC     +L++I NE  N K+ + LS  YN    WI    L K  +W D +N+  SY      +PD   R      + ++D + W D  C+     IC  +  ++ +Y++    +++ +A  +C++    L  I+N      +   V  S     W+   D+     W   DN+     E  Y+N++ +      KE C+  +  NG W D +CD   + +C       R +++  +    +      AR +C N    +V + N ++N   +                +    G W+          +Q  +Y+NW         +PD G         ++C       +G W D  C S     C     T+      +H  S    +  A ++CR    +L  ID  +   +++        G+ WI   D+    +W  +   L   FK W+  +P      +     +Y    W++  C      IC   +   S  Y      +++ D   YC+     +V I ++ +N   Y +   S   T WI    +     W D  N S +  NW   QP N G  E C    +   G W D  C+     IC
Sbjct:  110 QSICVYMNRGIWYTTDCSNRLYPTVCYDGRKNASATYVFLYQYKNWTEAQSYCREHHTDLISIRNETENQKIEYFLSSYYNYA-VWIG---LYKTRSWSDQSNSSFSYW--SSWQPD---RSGSCAVVSFSDSWKWADEYCNYAFPFICYSVSGSSRQYYLVNQSLSWTEAQRFCRQNYTDLATIDNMEEMNRLINTVNGSYSGSAWIGQYDDVNSWRWSLEDNDFYLQGERDYRNFYHEPDNSGGKELCVY-MNSNGKWYDTSCDYTQQFVCY----DGRVNTSQRYIRIYDSKTWTEARRYCRNYYTDLVNVRNQTENQKIL----------------ERTGGGVWIGLYRNRVWSNNQNSTYENWRPQINGLLAQPDNGVNQGNEFGYQHCTAVSFGYSGQWTDEVCVSKMPFFCYSRTCTQYSCTRQYHFISEFKSWAEAQRFCRQNYTDLATIDNMEEMKKLFKTVRGTYYGKAWIGLYDDLNSWRWSLNNTTLQGGFKSWYVQKPVNSGGNSLCAYMSYSQGRWSEAPCSLSLFFICYDGRVNASTSYVFVYQYKSWTDAQSYCREHHTDIVSIRNEMEN---YRVQALSNSYTVWIG---LYRSRSWSDQSNSSFS--NWRSGQPDNAGNSEYCTAVSFSDSGNWTDENCNTAFPFIC 736          

HSP 2 Score: 98.5969 bits (244), Expect = 2.047e-20
Identity = 144/638 (22.57%), Postives = 250/638 (39.18%), Query Frame = -3
Query:  204 EKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQ------EPDGG-------KRENCIQSLVYADGFWNDVECDQPNSVICEPMRHT----TNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVW-LNTDNEEISYKNWHPKEPQGYRKEN-CIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIK--SNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPD-GGKTENC-AVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDG-DQMNNQVYNLSVTFNLGRYWINGNDNRKEGQW--EDS---KQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPS-KYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLA---LKSKLGTF--WINGNDVANEGHWVDTDNESLTY----LNWNIRQPNGGKKENCIQGL---------YFSDGTWNDVKCDMKNKVIC 1973
            +  T+  A +YC     +LV + N+  N+ +    L+      WI    L +   W  SNN   +Y NW  Q      +PD G         ++C        G W D  C       C     T    T +YH   +  ++ +A  +C++    L  I+N    K + K V+ +     W+   D+     W LN    +  +K+W+ ++P      + C       G W++  C      IC     +   S++ +F    +   +  A+ +C   +  IV I N  +N     Y ++  SN    WI    S +   W D  +   S+ NW S +PD  G +E C AVS +D+ G W D +C +    IC     +   +H  +  M +  A ++CR    +L  ID  ++MN  +  ++ ++N G  WI   D+    +W  ED+   ++    ++ W+      G  E C   +   +  W D  C S    +C   +   + KY +  +   +     YC+ +   L  + ++ + + + ++      S L  +  WI    +     W D  + S TY    +  ++ QP+ G      QG          YF  G W D +C       C
Sbjct:  388 DSKTWTEARRYCRNYYTDLVNVRNQTENQKI----LERTGGGVWIG---LYRNRVW--SNNQNSTYENWRPQINGLLAQPDNGVNQGNEFGYQHCTAVSFGYSGQWTDEVCVSKMPFFCYSRTCTQYSCTRQYHFISEFKSWAEAQRFCRQNYTDLATIDNMEEMKKLFKTVRGTYYGKAWIGLYDDLNSWRWSLNNTTLQGGFKSWYVQKPVNSGGNSLCAYMSYSQGRWSEAPCSLSLFFIC--YDGRVNASTSYVFVYQYKSWTD--AQSYCREHHTDIVSIRNEMEN-----YRVQALSNSYTVWIGLYRSRS---WSDQSNS--SFSNWRSGQPDNAGNSEYCTAVSFSDS-GNWTDENCNTAFPFICYSAITSSRQYHFVNQSMSWTDAQRFCRQSYTDLATIDNMEEMNRLINTVNSSYN-GSAWIGQYDDVNSWRWSLEDNDFYQEGERDYRNWYHEPNNYGGKELCAYMD--PNGNWYDTSCESYYPPVCYDGRENATQKYILVSTGMPWTSAQSYCRQRYTDLASVRNETEWQQILNITRYRYYSYLSGYNVWIG---LYRNRLWSDQSSSSFTYWLPQIQSDVAQPDNGASVPAEQGAQHCTTVSLKYF--GQWTDERCFATLPFFC 993          

HSP 3 Score: 97.8265 bits (242), Expect = 4.053e-20
Identity = 133/635 (20.94%), Postives = 244/635 (38.43%), Query Frame = -3
Query:  204 EFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKL-----SYTNWHYQEP-DGGKRENCIQSLVYAD-GFWNDVEC-DQPNSVIC-EPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLN-TDNEEISYKNWHPKEPQGYRKENC-IQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWV-----DYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEP--INDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLS-----VTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDAL-------WNDEKCGSLNSVICQP---IKYGPSK-YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLT--YLNWNIRQP-NGGKKENCIQGLYFSDGTWNDVKCDMKNKVIC 1997
            +  Y +  +  T+  A +YC  +  +L TI+NE     + D     +ID  WI   D +    W   N++        + NW+  +P   G +  C    VY + G W   +C ++    +C +  ++ +  Y        + +A +YC++ +  LI+I NE+ N+ ++  +     +  W+          W + +++    + +W P      R  +C +     +  W D  C+     IC  +    R      +Y   + ++   A+ FC      +  IDN  + +  +     S     WI   D  N   W       Y   +  Y+N+Y    + G  E C     ++NG W D  C      +C    +N ++    I   K  +  A +YCRN   +LV +     N ++   +     +     R W N N N     W      LL       ++P  G N+    G  +  A+       W DE C S     C      +Y  ++ YH     +++ +  ++C+     L  I + ++ K ++     +  G  WI   D  N   W   +N +L   + +W +++P N G    C   + +S G W++  C +    IC
Sbjct:   18 DLQYVFVNQSKTWAEAQRYCRDKYTDLATIENEQQTIQLLDTVNDDSIDLAWIGLYDDLNSWKWTLENSDFFKAGEKDFRNWYNPDPYSYGAQSIC----VYMNRGIWYTTDCSNRLYPTVCYDGRKNASATYVFLYQYKNWTEAQSYCREHHTDLISIRNETENQKIEYFLSSYYNYAVWIGLYKTRS---WSDQSNSSFSYWSSWQPD-----RSGSCAVVSFSDSWKWADEYCNYAFPFICYSVSGSSRQ-----YYLVNQSLSWTEAQRFCRQNYTDLATIDNMEEMNRLINTVNGSYSGSAWIGQYDDVNSWRWSLEDNDFYLQGERDYRNFYHEPDNSGGKELCV--YMNSNGKWYDTSCDYTQQFVCYDGRVNTSQRYIRIYDSKT-WTEARRYCRNYYTDLVNVRNQTENQKILERTGGGVWIGLYRNRVWSN-NQNSTYENWRPQINGLL-------AQPDNGVNQGNEFGYQHCTAVSFGYSGQWTDEVCVSKMPFFCYSRTCTQYSCTRQYHFISEFKSWAEAQRFCRQNYTDLATIDNMEEMKKLFKTVRGTYYGKAWIGLYDDLNSWRW-SLNNTTLQGGFKSWYVQKPVNSGGNSLCAY-MSYSQGRWSEAPCSLSLFFIC 622          

HSP 4 Score: 80.1073 bits (196), Expect = 9.200e-15
Identity = 95/405 (23.46%), Postives = 160/405 (39.51%), Query Frame = -3
Query: 1539 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDS-RNVSLQ--FKKWYQGEP-NGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQS-------------------TTTRKIPVSTSKSLDNISDKEFYD------------KYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDN-EATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNN-----KLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMR-HTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENE 2627
            Y    E  ++ EA +FC +    L TI N +  K++F        G  WI    Y    SW  S  N +LQ  FK WY  +P N G    C + + Y    W++  C      IC     + +   +        Y  K     Q+ C+   +                   + T  I +  S+S  + S+  F +            +YC+    A  +     W ++   T  P +     T    YH+  + M++  A ++C     +L TIDN E  N+L++ ++  YN    WI   D +    W   +N+     +  Y NW+++  + G +E C  + +  +G W D  C+     +C   R + T KY +    M +  A +YC++R   L ++ NE
Sbjct:  511 YHFISEFKSWAEAQRFCRQNYTDLATIDNMEEMKKLFKTVRGTYYGKAWI--GLYDDLNSWRWSLNNTTLQGGFKSWYVQKPVNSGGNSLCAY-MSYSQGRWSEAPCSLSLFFICYDGRVNASTSYV------FVYQYKSWTDAQSYCREHHTDIVSIRNEMENYRVQALSNSYTVWIGLYRSRSWSDQSNSSFSNWRSGQPDNAGNSEYCT----AVSFSDSGNWTDENCNTAFPFICYSAITSSRQYHFVNQSMSWTDAQRFCRQSYTDLATIDNMEEMNRLINTVNSSYNGS-AWIGQYDDVNSWRWSLEDNDFYQEGERDYRNWYHEPNNYGGKELC--AYMDPNGNWYDTSCESYYPPVCYDGRENATQKYILVSTGMPWTSAQSYCRQRYTDLASVRNE 899          

HSP 5 Score: 53.9138 bits (128), Expect = 1.109e-6
Identity = 35/120 (29.17%), Postives = 57/120 (47.50%), Query Frame = -2
Query: 2647 GYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEP-NGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKK 3003
             YV   Q  ++T A S+C+E + ++++I+N + N RV  ++  Y +   WI     G+      S  +   + NW+SG+P N    E C    +  +G W D +CNT    IC    T  
Sbjct:  632 SYVFVYQYKSWTDAQSYCREHHTDIVSIRNEMENYRVQALSNSYTV---WI-----GLYRSRSWSDQSNSSFSNWRSGQPDNAGNSEYCTAVSFSDSGNWTDENCNTAFPFICYSAITSS 743          
BLAST of SMED30004599 vs. Ensembl Zebrafish
Match: mrc2 (mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GENE-090915-5])

HSP 1 Score: 110.538 bits (275), Expect = 5.974e-24
Identity = 145/709 (20.45%), Postives = 265/709 (37.38%), Query Frame = -3
Query:  201 LKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTT--------------------------NKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRK--ENCIQGLRINGLWNDVTCD-SLGEVICQPIQNK---------KRP---SSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNS-VICEP-------------------INDTKNG-------------FHITSV--KMKFDTAVKYCRNKKMELVKIDGDQMNNQVYN-LSVTFNLG----RYWI-NGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC---------QP----------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKL---GTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKEN-CIQGLYFSDGTWNDVKCDMKNKVICE 2012
            + N  +F +  T   +++  A   C  Q  +L++I        V+ L + Y+    W+  NDL   G W  +++  L Y NW  + P   + ENC      A G W++ +C      IC+   + T                            Y +  D++ +  A   C+K    L++I      + + K +KK ++ + W+  +D + +  +  TD   + +  WHP EP  +R+  E+C+      G WND  C+ SL  +  +P Q           KR     S S F    E +    A+E C + N  +  I+N  +     +         FW+   +  + G +      +L+Y NW   +P   K     +    A GLW+   C S+ S  IC+                         +G             FH  ++  ++ +  A K+C+    +L      +    V+  L   F       ++W+  G   R    W  S  + ++++ +     +G          N  D  W    C S    IC         +P          + +  ++Y + + +  +    + C   + SLV +   K+N+F+     K        +W+  +   N+G +  +D+  L Y++W   QP    KE  C+Q +  S G W+D +C +    +C+
Sbjct:  250 MDNCYQFNFQAT---LSWSEARTSCQQQGADLLSITKVEEQIYVNGLLIGYSAT-LWMGLNDLDLNGGWQWADSAPLKYLNWEAEMPSYDEEENCGVISTDAQGRWHNRDCSVALPYICKKRPNATLDPFTTDSWADDGHYQCDVGWQNFQTGCYWLNSDKLDWRSADRTCQKMEANLVSIHTLPELEYITKHMKKDIE-ELWIGLHDTAMQMNFEWTDRTPVIFTYWHPFEPNNFREVNEDCVTIWGPEGRWNDSPCNYSLPSICKKPAQKADDRIQDHGCKRGWKWHSPSCFKVGEESLTFKDAKEMCISNNATLAIINNRFEQAFVSSLVFGRTDDQFWLGLNNENSSGTFGWITGDELTYTNWNRDQPAQVKGGCVVMVAGQAMGLWEVKDCASIRSKYICKQNQGSSSIPSPPAPVPTPSLTGSCPSGWKSSNSFRHCYKVFHAGALEKRLTWIQAHKFCQKHGAQLASFSTPEEEAFVFQILHEAFGEAEEHEQHWLWIGISRRNSDSWTWSDGSAVTYQNFG----RGNYGSAECGAANMADTNWLVSHCESELDWICKIPKGKVEEEPESHEDTGLEWVDFEEAQYKMFEHRSTWDQAQRICSWFEASLVSMHSPKENQFLVSTLRKMSRQENDLWWVGLHTFKNDGRFRWSDHSVLNYVSWGPGQPRPISKETKCVQ-ISASKGDWSDQRCHVDLPYVCK 948          

HSP 2 Score: 51.2174 bits (121), Expect = 9.290e-8
Identity = 33/118 (27.97%), Postives = 57/118 (48.31%), Query Frame = -2
Query: 2659 DYGYVVNLQ-KMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKK 3009
            D  Y  N Q  ++++ A + C++Q  +LL+I        V  + I Y     W+  ND  + G W  + S P++Y NW++  P+   +ENC        G W++  C+     IC+K+
Sbjct:  251 DNCYQFNFQATLSWSEARTSCQQQGADLLSITKVEEQIYVNGLLIGYS-ATLWMGLNDLDLNGGWQWADSAPLKYLNWEAEMPSYDEEENCGVISTDAQGRWHNRDCSVALPYICKKR 367          

HSP 3 Score: 26.1794 bits (56), Expect = 9.290e-8
Identity = 28/124 (22.58%), Postives = 55/124 (44.35%), Query Frame = -3
Query: 2277 YLINEEIMTYDEAVKFCGEKNLRLLTIKN----EKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRK--ENCIHGLRYDNEFWNDVNCFHKNMVIC-EPMEKS 2627
            Y +N + + +  A + C +    L++I      E I K +       ++   WI  +D + + ++  +    + F  W+  EPN  R+  E+C+     +   WND  C +    IC +P +K+
Sbjct:  400 YWLNSDKLDWRSADRTCQKMEANLVSIHTLPELEYITKHMKK-----DIEELWIGLHDTAMQMNFEWTDRTPVIFTYWHPFEPNNFREVNEDCVTIWGPEGR-WNDSPCNYSLPSICKKPAQKA 517          
BLAST of SMED30004599 vs. Ensembl Zebrafish
Match: si:dkey-11o15.5 (si:dkey-11o15.5 [Source:ZFIN;Acc:ZDB-GENE-091204-172])

HSP 1 Score: 108.612 bits (270), Expect = 1.667e-23
Identity = 147/662 (22.21%), Postives = 253/662 (38.22%), Query Frame = -3
Query:  204 LYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGF-WNDVECDQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNE-----EISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDY-------QDQKLSYKNWY------STEPDGG-------KTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNG----FHITSVKMKFDTAVKYCRNKKMELVKIDG-DQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLS-FKKWHKSEP--KGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSK-RNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLG-TFWINGNDVANEGHWVDTDNESLTYLNWNIRQP-NGGKKENCIQGLYFSDGTWNDVKCDMKNKVIC 2078
            LY  +C    K  +    V+ + KN  E              A  YC     +L++I NE  ++        ++    WI    L K  +W D +N+  SY +  +Q    G        + ++D + W D  C+     IC     ++ +Y+     +++N+A  +C++    L  I+N      +   V  S     W+   D+     W   DN+     E  Y+NW+ +      KE C+  +  NG W D +CD   + +C       R +++  + +  +      A  +C +    +V + N ++N   +                +S   G W+          +Q  +Y+NW         +PD G         ++C       +G W D  C S    IC     T++     +H  S    +  A ++CR    +L  ID  ++M   +  +  T+  G+ WI   D+    +W  +   L   FK W   +P   GG++  C+  +N Q  +W++  C      IC       +  ++   + +N+ +   YC+     LV I ++ +N  V  LAL S    T WI    +     W D  N S +  NW   QP N G  E C    +   G W D  C+     IC
Sbjct:  129 LYPTVCYDGRKNASATYVVIYQHKNWTE--------------AQSYCREHHTDLISIRNETESQKFEYFIKSFSYYAVWIG---LYKTRSWSDQSNSSFSYWS-SWQPNIAGS----CTVVSFSDSWKWADENCNYAFPFICYSGLGSSRQYYFMNQFLSWNEAQRFCRQNYTDLATIDNMEEMNRLINTVNGSYSGSAWIGQYDDVNSWRWSLEDNDFYQEGERDYRNWYHEPDNTGGKELCVY-MNSNGKWYDTSCDYTQKFVCY----DGRENASQRYITIYDYKTWTEACRYCRDYYTDLVNVRNLTENQKIL----------------ESTGGGVWIGLYRNRIWSNNQNSTYQNWRPQISGSQAQPDNGVNQGIEYGYQHCTAVSFRYSGQWTDEVCVSSMPFICYSRICTQSSCTRQYHFVSESKSWTEAQRFCRQNYTDLATIDNMEEMKRLIKTVRGTY-YGKAWIGLYDDMNSWRWSLNNTTLQGGFKSWFVQKPVNSGGKSL-CVYMSNSQ-GIWSEAPCSWTFPFICYDGTVNATTSYVYVYQFKNWTEAQSYCREHHTDLVSIRNEIENYRV--LALTSNYYYTSWIG---LYRSRSWSDQSNSSFS--NWRSGQPDNAGNSEYCTAVSFSDSGNWTDENCNTAFPFIC 737          

HSP 2 Score: 105.531 bits (262), Expect = 1.595e-22
Identity = 169/765 (22.09%), Postives = 294/765 (38.43%), Query Frame = -3
Query:  564 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQ-----FKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEIC----KSFLELC-----YNSKI---------RKICQNTC----------KFW---QSTTTR--KIPVSTSKSL-DNISDK--EFYDKYC---SVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDN-EATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKL--SYTNWHYQEP-DGGKRENCIQSLVYADGFWNDVECDQPNSVIC-EPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQ-GYRKENCIQ-GLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWV-----DYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVIC-EPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVT-------FNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHK------SEPKGGRN-------ENCITGNNYQDALWNDEKCGSLNSVIC 2627
            Y    + ++++EA +FC +    L TI N +   R+ N       G+ WI   D      W    N   Q     ++ WY    N G KE C++     N  W D +C +    +C    ++ +   I     K++ E C     Y + +         +KI ++T           + W   Q++T +  +  +S S++  DN  ++  E+  ++C   S RY      ++C      M  +       +++    YH+  E  ++  A ++C     +L TIDN E   +L+  +   Y     WI   D +    W   NN  L   + +W  Q+P + G +  C+  +  + G W++  C      IC +   + T  Y        + +A +YC++ +  L++I NE  N  V  L        Y+ +         W  +D    S+ NW   +P      E C       +G W D  C++    IC  +    R      +Y   + ++   A+ FC +    +  IDN  + +  +     S     WI   D  N   W       YQ+ +  Y+N+Y    + G  E C     D NG W D  C+   + +C +   +    + + +  M + +A  YCR    +L  +  +    Q+  LS+T       ++    WI    NR    W D  Q+  SF  W        ++P  G N       ++C T +    A W DE+C +     C
Sbjct:  258 YYFMNQFLSWNEAQRFCRQNYTDLATIDNMEEMNRLINTVNGSYSGSAWIGQYDDVNSWRWSLEDNDFYQEGERDYRNWYHEPDNTGGKELCVY--MNSNGKWYDTSCDYTQKFVCYDGRENASQRYITIYDYKTWTEACRYCRDYYTDLVNVRNLTENQKILESTGGGVWIGLYRNRIWSNNQNSTYQNWRPQISGSQAQPDNGVNQGIEYGYQHCTAVSFRYSGQWTDEVC---VSSMPFICYSRICTQSSCTRQYHFVSESKSWTEAQRFCRQNYTDLATIDNMEEMKRLIKTVRGTYYGK-AWIGLYDDMNSWRW-SLNNTTLQGGFKSWFVQKPVNSGGKSLCVY-MSNSQGIWSEAPCSWTFPFICYDGTVNATTSYVYVYQFKNWTEAQSYCREHHTDLVSIRNEIENYRVLALTSNY----YYTSWIGLYRSRSW--SDQSNSSFSNWRSGQPDNAGNSEYCTAVSFSDSGNWTDENCNTAFPFICYSVLGSSRQ-----YYFVNQSLSWTEAQRFCRHNYTDLATIDNMEEMNRLINTVNGSYSGSAWIGQYDDVNSWRWSLEDNDFYQEGERDYRNFYHEPDNSGGKELCV--FMDRNGNWYDTSCERYYTPVCYDGRENATQKYIVVNTGMPWTSAQSYCRATYTDLASVRNETEWQQI--LSITRYSYYGYYSGYNMWIGLYRNRL---WSD--QSSSSFTYWLPQIQGDVAQPDNGVNVPGEQGAQHCTTVSLKYFAQWTDERCFATLPFFC 994          

HSP 3 Score: 97.4413 bits (241), Expect = 4.161e-20
Identity = 138/635 (21.73%), Postives = 248/635 (39.06%), Query Frame = -3
Query:  204 TYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQ------EPDGG-------KRENCIQSLVYADGFWNDVECDQPNSVICEPMRHT----TNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVW-LNTDNEEISYKNWHPKEP-QGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPD-GGKTENC-AVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQW--------EDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPS-KYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLA-----LKSKLGTFWINGNDVANEGHWVDTDNESLTY----LNWNIRQPNGGKKENCIQGL---------YFSDGTWNDVKCDMKNKVIC 1964
            T+  A +YC     +LV + N   N+ +    L+      WI    L +   W  SNN   +Y NW  Q      +PD G         ++C        G W D  C      IC     T    T +YH   +  ++ +A  +C++    L  I+N    K + K V+ +     W+   D+     W LN    +  +K+W  ++P     K  C+      G+W++  C      IC    +    ++ S  Y    K N   A+ +C   +  +V I N  +N   +  A+ SN  Y++          +W D  +   S+ NW S +PD  G +E C AVS +D+ G W D +C +    IC  +  +   ++  +  + +  A ++CR+   +L  ID  +  N++ N       G  WI   D+    +W        ++ +++  +F  +H+ +  GG+ E C+  +  ++  W D  C    + +C   +   + KY +  +   +     YC++    L  + ++ + + +  +              WI    +     W D  + S TY    +  ++ QP+ G      QG          YF+   W D +C       C
Sbjct:  390 TWTEACRYCRDYYTDLVNVRNLTENQKI----LESTGGGVWIG---LYRNRIW--SNNQNSTYQNWRPQISGSQAQPDNGVNQGIEYGYQHCTAVSFRYSGQWTDEVCVSSMPFICYSRICTQSSCTRQYHFVSESKSWTEAQRFCRQNYTDLATIDNMEEMKRLIKTVRGTYYGKAWIGLYDDMNSWRWSLNNTTLQGGFKSWFVQKPVNSGGKSLCVYMSNSQGIWSEAPCSWTFPFICY---DGTVNATTSYVYVYQFK-NWTEAQSYCREHHTDLVSIRNEIENYRVL--ALTSN--YYYTSWIGLYRSRSWSDQSNS--SFSNWRSGQPDNAGNSEYCTAVSFSDS-GNWTDENCNTAFPFICYSVLGSSRQYYFVNQSLSWTEAQRFCRHNYTDLATIDNMEEMNRLINTVNGSYSGSAWIGQYDDVNSWRWSLEDNDFYQEGERDYRNF--YHEPDNSGGK-ELCVFMD--RNGNWYDTSCERYYTPVCYDGRENATQKYIVVNTGMPWTSAQSYCRATYTDLASVRNETEWQQILSITRYSYYGYYSGYNMWIG---LYRNRLWSDQSSSSFTYWLPQIQGDVAQPDNGVNVPGEQGAQHCTTVSLKYFAQ--WTDERCFATLPFFC 994          

HSP 4 Score: 95.9005 bits (237), Expect = 1.498e-19
Identity = 132/633 (20.85%), Postives = 245/633 (38.70%), Query Frame = -3
Query:  204 EFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWV--DSNNNKLS---YTNWHYQEP-DGGKRENCIQSLVYADGFWNDVECDQP--NSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLN-TDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWV-----DYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMK-FDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWH------KSEPKGGRNENCITGNNYQDAL-------WNDEKCGSLNSVICQPIKYGPS----KYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLT--YLNWNIRQP-NGGKKENCIQGLYFSDGTWNDVKCDMKNKVIC 1997
            +  Y +  +  T+  A +YC  +  +L TI+N+     + D     +ID  WI   D +    W   DS+  K     + NW+  +P + G +  C+      +G W    C      +V  +  ++ +  Y +      + +A +YC++ +  LI+I NE+ ++  +  +K    +  W+          W + +++    + +W P           +     +  W D  C+     IC       R      +Y   + ++   A+ FC      +  IDN  + +  +     S     WI   D  N   W       YQ+ +  Y+NWY    + G  E C     ++NG W D  C      +C    +  +  +IT    K +  A +YCR+   +LV +     N ++    +    G  WI    NR    W +++ +  +++ W       +++P  G N+    G  +  A+       W DE C S    IC       S    +YH     +++ +  ++C+     L  I + ++ K +      +  G  WI   D  N   W   +N +L   + +W +++P N G K  C+  +  S G W++  C      IC
Sbjct:   17 DLQYVFVNQSKTWAEAQRYCRDKYTDLATIENKQQTIQLLDTVNDDSIDLAWIGLYDDLNSWKWTLEDSDFFKAGGKDFRNWYNPDPYNYGAQSLCVYMY---NGIWYPASCFNTLYPTVCYDGRKNASATYVVIYQHKNWTEAQSYCREHHTDLISIRNETESQKFEYFIKSFSYYAVWIGLYKTRS---WSDQSNSSFSYWSSWQPNIA----GSCTVVSFSDSWKWADENCNYAFPFICYSGLGSSRQ-----YYFMNQFLSWNEAQRFCRQNYTDLATIDNMEEMNRLINTVNGSYSGSAWIGQYDDVNSWRWSLEDNDFYQEGERDYRNWYHEPDNTGGKELCV--YMNSNGKWYDTSCDYTQKFVCYDGRENASQRYITIYDYKTWTEACRYCRDYYTDLVNVRNLTENQKI----LESTGGGVWIGLYRNRI---WSNNQNS--TYQNWRPQISGSQAQPDNGVNQGIEYGYQHCTAVSFRYSGQWTDEVCVSSMPFICYSRICTQSSCTRQYHFVSESKSWTEAQRFCRQNYTDLATIDNMEEMKRLIKTVRGTYYGKAWIGLYDDMNSWRW-SLNNTTLQGGFKSWFVQKPVNSGGKSLCVY-MSNSQGIWSEAPCSWTFPFIC 621          

HSP 5 Score: 54.6842 bits (130), Expect = 5.767e-7
Identity = 40/130 (30.77%), Postives = 58/130 (44.62%), Query Frame = -2
Query: 2668 VICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYK----IGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEP-NGKRQENCVHGLYYPAGLWNDISCNTPNSVIC 3042
             IC    +  T   YV   Q   +T A S+C+E + +L++I+N I N RV  +   Y     IG Y            W D  ++   + NW+SG+P N    E C    +  +G W D +CNT    IC
Sbjct:  619 FICYDGTVNATT-SYVYVYQFKNWTEAQSYCREHHTDLVSIRNEIENYRVLALTSNYYYTSWIGLY--------RSRSWSDQSNSS--FSNWRSGQPDNAGNSEYCTAVSFSDSGNWTDENCNTAFPFIC 737          
BLAST of SMED30004599 vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 124.79 bits (312), Expect = 3.676e-28
Identity = 172/720 (23.89%), Postives = 288/720 (40.00%), Query Frame = -3
Query:  177 HYTR---EKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYN-IDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKR-ENCIQSLVYADGFWNDVECDQPNSVICE-----PMR-----------------HTTNKYHIGKDRMTFNDAVNYCKKR--NMVLINIENEXXXXXXXXXXXXXXKFDY----WVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQ-GYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSST---------------------------EKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQK-LSYKNWYSTEPDGGK-------TENCAV---SLTDANGLWDDAHCQSMNSVICE-----PINDT-----------KNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ----------PIKYG------------PSKYH-----ISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLA--LKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL*T 1985
            H++R   EK T+  +  +C A   +LV+I+++    ++    L YN I W  +  +D  +   WVD +   LSY NW Y EP+  +  E C +  V     WND  C+     ICE     P++                 +  N+Y I  + +  + A  +CKK   ++V+IN + E        ++ +   + +    W++G+               ++Y  W   EP      ENC+   +  G WND+ C      IC+    +K  S N+ F  +                            E  +  +AR  C   N  +  ++N       +TY +K      WI G +  NE +   + DQ+ + Y NW    P G +       T+  ++   S  DA G W +  C      IC+     P + T              F I + KM +D A + C+++  ELV I  D+  N    +  +     +WI  N N+   Q++ +    L + KW   EPK  +   C+  +   D  W    C      IC+          P K G            P + H     +S +K  Y+  ++ C     SL    D  ++ FV+     L+ ++ +FWI G     E  W+  DN  + ++NWNI +P+    E+C++ +Y S GTWN++ C      IC+++  K+ T
Sbjct:  642 HFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILS--QLYYNQIFWIGLQTSDPEEGFEWVDGS--ALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLFFRWMDGS--------------VMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICE----RKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAF-LTYNLKDLNIDVWI-GMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDA-GSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSIT-DEYTNSFLRVYTSKYREPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTACVYMD--IDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVE-MYSSHGTWNNLYCSSYRGYICKIQKNKIKT 1328          

HSP 2 Score: 104.375 bits (259), Expect = 6.548e-22
Identity = 144/696 (20.69%), Postives = 238/696 (34.20%), Query Frame = -3
Query:  195 REKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEP------------------------MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEP--QGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSL----------------FYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLT-DANGLWDDAHCQSMNSVICEP-------------------INDTKNGFHITSVKMKFDTAVK----------YCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNYQDALWNDEKCGSLNSVICQ-----PIKYGPSK-----------------YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFV------YDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPN-GGKKENCIQGLYFSDGTWNDVKCDMKNKVICELK 1976
            +  +T+  A K CL Q   L++I        +  LS        W   N L     W  S  +   Y NW    P      NC+      +G W + EC+Q    IC+                         + +  N Y + K+   + +A++ C+K    L +  N      +    +       W+  ND      +  +D   +SY  W   EP  +  ++E+C+     +G W+D  C+   + IC+       P    +                +  S    +   A + C      +V +++  +     +         FW   TDS   G +     +++ + +W S  P  G+   C V  T +  GLWD   C+     +C+                      D K    I S    F    +          +C+    +LV I+  +       LS  +    +WI    +  E  +E    + LS++ W   EP   +  E C   +      WND  C S    IC+     P++  P+K                 Y IS          ++CK     LV I DD + KF+      Y++ L   L   W++G+               + Y+ W   +PN     ENC+  +Y + G WND+ C   N  ICE K
Sbjct:  215 QAALTWFQARKSCLQQESELLSITEIHEQTFLTGLSNTMTTS-LWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCVAFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMP--GRRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETI---LSQLYYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLFFRWMDGS--------------VMNYVAWASYEPNFANNDENCVV-MYKNMGFWNDINCGYPNPYICERK 889          

HSP 3 Score: 86.2705 bits (212), Expect = 2.453e-16
Identity = 133/558 (23.84%), Postives = 204/558 (36.56%), Query Frame = -3
Query:  561 YHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPD-GGKRENCIQSLVYAD-GFWNDVECDQPNSVICEPMRHTTNK------------------------YHI---GKDRMT-FNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYR------KENCIQGLRIN----GLWNDVTCDSLGEVICQ-----PIQNKKRPS------SNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQ-KLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE------PIN----------DTKNGFHITSVKMKFDTAVKYCRN---KKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNL-----------LSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ 1988
            Y  + E +    A ++C     +LV I+++   K +    + Y I  Y            W+D +   ++Y  W   EP+     ENC+  ++Y + GFWND+ C  PN  ICE    + N                         Y I   GK   T ++ A   C + N  L  +ENE     +   +K     D W+  ND +EE  +L TD   + Y NW    P G R        +C+   R +    G W +  C      ICQ     P      PS       N  F     KM+   A   C + +  +V I +   N     Y  K     FWI G +S   GN   + D  KL Y  W + EP   KT  C     D +G W  + C      IC+      P +          D+ +   I      +   V Y +N     +E ++  G   +   ++ S+  N   + I   ++R +  W    QN+           + F  W+  EP    +E+C+   +     WN+  C S    IC+
Sbjct:  784 YFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLY------FFLFFRWMDGS--VMNYVAWASYEPNFANNDENCV--VMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLN-IDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYREP-FWI-GLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTACV--YMDIDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLAS---FDDSLESNFVWHQIERLEDRVKSFWIGMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVEMYS-SHGTWNNLYCSSYRGYICK 1320          

HSP 4 Score: 56.9954 bits (136), Expect = 1.747e-13
Identity = 39/124 (31.45%), Postives = 60/124 (48.39%), Query Frame = -2
Query: 2653 IIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPN-GKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKT 3021
            I   D  Y ++ + +A   A  FCK+   +L+ I +    K ++   + Y+I  Y+       +   W+D   + M Y  W S EPN     ENCV  +Y   G WNDI+C  PN  IC++K +
Sbjct:  777 IANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFF------LFFRWMDG--SVMNYVAWASYEPNFANNDENCVV-MYKNMGFWNDINCGYPNPYICERKNS 891          

HSP 5 Score: 40.0466 bits (92), Expect = 1.747e-13
Identity = 41/151 (27.15%), Postives = 58/151 (38.41%), Query Frame = -3
Query: 2211 EIMTYDEAVKFCGEKNLRLLTIKNEKI------NKRVFNIAVYYNLGTYWITGNDYSKEGS--WVDSRNVSLQFKKWYQGEPNGGR------KENCI---HGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKI 2612
            E   +D A   C   N  L T++NE +      N +  NI V       WI  ND ++E    W D R V   +  W +G P G R        +C+    G   D   W +  C      IC+  +  PA P I  S     + ++  KI
Sbjct:  929 EATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-------WIGMNDKNEEHRFLWTDQRGV--YYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKI 1070          

HSP 6 Score: 49.6766 bits (117), Expect = 4.027e-11
Identity = 39/139 (28.06%), Postives = 62/139 (44.60%), Query Frame = -3
Query: 2262 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKR-------VFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPN-GGRKENCIHGLRYDN-EFWNDVNCFHKNMVICE--------PMEKSPADPE 2627
            Y I+ EI+  D+A +FC +KN   L + N+   ++       ++ I +Y+ L   W+ G+               + +  W   EPN     ENC+  + Y N  FWND+NC + N  ICE            +PA P+
Sbjct:  784 YFISTEIVAMDKAREFC-KKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLFFRWMDGS--------------VMNYVAWASYEPNFANNDENCV--VMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQ 905          

HSP 7 Score: 39.6614 bits (91), Expect = 4.027e-11
Identity = 33/117 (28.21%), Postives = 54/117 (46.15%), Query Frame = -2
Query: 2656 QKMAYTTAVSFCKEQNMELLTI----KNGIINKRVFNMAIKYKIGYYWID-GNDNGMEGY-WVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGL-WNDISCNTPNSVICQKKK 2985
            +K  +  + SFCK    +L++I    +  I+++  +N         +WI     +  EG+ WVD  +  + Y+NW  GEPN  +       L+    L WND  C +    IC+ KK
Sbjct:  649 EKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYYNQI-------FWIGLQTSDPEEGFEWVDGSA--LSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKK 756          

HSP 8 Score: 67.0106 bits (162), Expect = 1.490e-10
Identity = 78/408 (19.12%), Postives = 147/408 (36.03%), Query Frame = -3
Query:  183 LFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSAN-EGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITS---------------------VKMK---FDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEP--KGGRNENCITGNNYQDALWNDEKCGSLNSVIC--QPIKYGPSK-------------------YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENC-IQGLYFSDGTWNDVKCDMKNKVICELKVEKL 1259
             F ++   +    AR+ C  +   ++ I    +    +T    +  +  W  G +S N    W         Y NW    P      NC    T  NG W++  C      IC+  + T + F + S                     VK +   +  A+  CR ++ +L      +  + + +        + WI  ND +    +E S    +S+  W + EP  +  + E+C+  +  +   W+D+ C      IC  +P+ + P +                   Y IS +  ++ +  + C      LV + D  +  ++  L        FW    D    G +  T+ E + + +WN   P  G++  C +       G W+ + C+ K K +C+   E +
Sbjct:  210 FFINNQAALTWFQARKSCLQQESELLSITEIHEQTF-LTGLSNTMTTSLWT-GLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCVAFDP-KSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMP--GRRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGV 612          

HSP 9 Score: 63.5438 bits (153), Expect = 2.114e-9
Identity = 73/303 (24.09%), Postives = 115/303 (37.95%), Query Frame = -3
Query: 1260 TVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNID-WYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE---------------------------PMR---------HTTNKYH-------IGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNS 2036
            T+AP V+  K   E  +     KM++  A + C ++   LV+I +E TN  +   + +Y    W  +N N    +  W D  N KL YT W  +EP   K   C+   +  DG W    C +    IC+                           P R         +T N Y         G    +F+D++    + N V   IE                   +W+    N E   WL  DN  + + NW+  EP  +  E+C++    +G WN++ C S    IC+  +NK +  + S
Sbjct: 1053 TIAPSVRFFKFGNE-TFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYREPFWIGLNSNKTGNQYKWTD--NWKLRYTKWAAEEPK--KTTACVYMDI--DGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSL----ESNFVWHQIERLEDRVK-----------SFWIGMYQNVENK-WLWLDNAPVDFVNWNIGEPSDHNDEHCVEMYSSHGTWNNLYCSSYRGYICKIQKNKIKTDAPS 1332          

HSP 10 Score: 43.1282 bits (100), Expect = 5.262e-7
Identity = 40/129 (31.01%), Postives = 58/129 (44.96%), Query Frame = -3
Query: 2238 EEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWI--TGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEF-WNDVNCFHKNMVICEPMEKSPADPEICKSFLEL 2615
            EE  T+ E+  FC      L++I N K  + + +  +YYN   +WI    +D  +   WVD    +L ++ W  GEPN  +       L       WND +C      ICE  + +P  PE  KS  EL
Sbjct:  648 EEKRTWFESRSFCKAIGGDLVSI-NSKEEETILS-QLYYNQ-IFWIGLQTSDPEEGFEWVDGS--ALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSYEL 771          

HSP 11 Score: 31.9574 bits (71), Expect = 5.262e-7
Identity = 22/115 (19.13%), Postives = 48/115 (41.74%), Query Frame = -2
Query: 2662 YGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3006
            Y Y+++    ++T A   C      L+T+++      + ++        +W    D+   G +  +    + + +W S  P G+R+   V       GLW+ I+C      +C++
Sbjct:  494 YCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMP-GRRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQ 607          

HSP 12 Score: 39.2762 bits (90), Expect = 1.489e-6
Identity = 32/126 (25.40%), Postives = 50/126 (39.68%), Query Frame = -2
Query: 2653 QKMAYTTAVSFCKEQNMELLTIKNGII------NKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKR------QENCV---HGLYYPAGLWNDISCNTPNSVICQKKKT 2985
            +   + +A + C   N  L T++N ++      N +  N+ +       WI  ND   E  ++ +    + Y NW  G P G R        +CV    G    AG W +  C+     ICQ  KT
Sbjct:  929 EATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-------WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKT 1047          

HSP 13 Score: 34.2686 bits (77), Expect = 1.489e-6
Identity = 36/136 (26.47%), Postives = 60/136 (44.12%), Query Frame = -3
Query: 2265 FVEYG---YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWI------TGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEK-SPADP 2642
            F ++G   + I    M++DEA + C  ++  L++I +E  N  +      Y    +WI      TGN Y     W D  N  L++ KW   EP   +   C++ +  D + W   +C      IC+  +  +P DP
Sbjct: 1060 FFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYK----WTD--NWKLRYTKWAAEEPK--KTTACVY-MDIDGQ-WKTSSCTENYFSICKQSDAIAPTDP 1184          

HSP 14 Score: 40.4318 bits (93), Expect = 9.468e-6
Identity = 31/120 (25.83%), Postives = 48/120 (40.00%), Query Frame = -2
Query: 2644 YVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGY-YWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKS 3000
            ++ N   + +  A   C +Q  ELL+I    I+++ F   +   +    W   N       W  S  +P +Y NW  G P+ +   NCV       G W +  CN     IC+K     S
Sbjct:  211 FINNQAALTWFQARKSCLQQESELLSITE--IHEQTFLTGLSNTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSS 328          

HSP 15 Score: 30.8018 bits (68), Expect = 9.468e-6
Identity = 27/127 (21.26%), Postives = 52/127 (40.94%), Query Frame = -3
Query: 2259 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPN--GGRKENCIHGLRYDNEFWNDVNCFHKNMVIC--EPMEKSPADPEI 2627
            Y + +E   + EA+  C ++   L +  N +    + +   +      WI  ND      +  S    + +  W +GEP+    ++E+C+      +  W+D  C  K   IC  +P+   P   +I
Sbjct:  354 YTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDI 479          
BLAST of SMED30004599 vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 124.405 bits (311), Expect = 4.463e-28
Identity = 167/687 (24.31%), Postives = 270/687 (39.30%), Query Frame = -3
Query:  177 HYTR---EKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQY--NIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKR-ENCIQSLVYADGFWNDVECDQPNSVICE-----PMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGV-WLNTDNEEISYKNWHPKEPQ-GYRKENCIQGLRINGLWNDVTCDSLGEVICQ-----------PIQNKKR---PSSNSLFYSSTEKMNNL-----AAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQK-LSYKNWYSTEPDGGK--TENCAV----SLTDANGLWDDAHCQSMNSVICE-----PINDT-----------KNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ----------PIKYG------------PSKYH-----ISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLA--LKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL*T 1985
            H++R   EK T+  +  +C A   +LV+I+++    ++  L+ +Y   I W  +  +D  +   WVD +   LSY NW Y EP+  +  E C +  V     WND  C+     ICE     P++    K  + +  +T                                     D W+   DN    + W+  D   ++Y  W   EP      ENC+   +  G WND+ C      IC+           P     +   PS    F     K +N      +AR  C   N  +  ++N       +TY +K      WI G +  NE +   + DQ+ + Y NW    P G +  + +C      S  DA G W +  C      IC+     P + T              F I + KM +D A + C+++  ELV I  D+  N    +  +     +WI  N N+   Q++ +    L + KW   EPK  +   C+  +   D  W    C      IC+          P K G            P + H     +S +K  Y+  ++ C     SL    D  ++ FV+     L+ ++ +FWI G     E  W+  DN  + ++NWNI +P+    E+C++ +Y S GTWN++ C      IC+++  K+ T
Sbjct:  652 HFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLNYRYYNQIFWIGLQTSDPEEGFEWVDGS---LSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTS------------------------------------DGWIANKDNHFFIIMWM--DGSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRVIKNSNRTTDWDSARTACMRFNGNLATVENELVQAF-LTYNLKDLNIDVWI-GMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSTDCVSIKRGSTLDA-GSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSIT-DEYTNSFLRVYTSKYREPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTACVYMD--IDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVE-MYSSHGTWNNLYCSSYRGYICKIQKNKIKT 1286          

HSP 2 Score: 94.7449 bits (234), Expect = 4.788e-19
Identity = 142/682 (20.82%), Postives = 230/682 (33.72%), Query Frame = -3
Query:  201 YHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPD--GGKRENCIQSLVYADGFWNDVECDQPNSVIC-------EP--------------MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRIN--GLWNDVTCDSLGEVICQ--------------------PIQNKKRPSSNSLF----YSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGK-TENCAVSLTDANGLWDDAHCQSMNSVICE-----PINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNYQD-ALWNDEKCGSLNSVICQ-----------PIKYGP-----------SKYHISKSKR--NYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGK--KENCI---QGLYFSDGTWNDVKCDMKNKVICE 1988
            Y   +E   +K A+  C  +  +L +  N      +            WI  ND      +  S+   +SYT W   EP     K+E+C   L Y         C+     IC       EP               RH    Y I     +F +A   C      L+ +E+      +  L+    +  +W    D+ E GV+  T+ E + + +W+ + P   R+  C+     N  GLW+ +TC+   + +C+                    P   K  P   S +        EK     +R FC      +V I++  +  +      +     FWI G  +++     ++ D  LSY+NW   EP+  +  E C          W+D HC+S    ICE     P+        +   ++  D  +    N    ++ +DG  MN                                     +  W   EP    N ENC+    Y++   WND  CG  N  IC+           P    P            K  I  S R  ++      C     +L  + ++    F+    LK      WI  ND   E  ++ TD   + Y NW    P G +    +C+   +G     G+W + +C +    IC+
Sbjct:  370 YTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCPFYLFYD-------MCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLNYRYYNQIFWI-GLQTSDPEEGFEWVDGSLSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNHFFIIMWMDGSVMN-------------------------------------YVAWASYEPNFANNDENCVV--MYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRVIKNSNRTTDWDSARTACMRFNGNLATVENELVQAFL-TYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSTDCVSIKRGSTLDAGSWFEEECSLSRGYICQ 1001          

HSP 3 Score: 82.0333 bits (201), Expect = 2.189e-18
Identity = 137/635 (21.57%), Postives = 239/635 (37.64%), Query Frame = -3
Query:  921 EEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWI--TGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEF-WNDVNCFHKNMVICEPMEKSPADPEICKSFL---ELCYNSKIR-KICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYL-ANLYQKI-CGWMEKEM---------TTVAPVVQKLKNT-----VEFGYHYTR---EKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGK--RENCI---QSLVYADGFWNDVECDQPNSVICE-----PMRHTT-----------NKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQ------PIQNKKRPS---------------SNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLA--MTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE 2615
            EE  T+ E+  FC      L++I +++    +  +   Y    +WI    +D  +   WVD    SL ++ W  GEPN  +       L       WND +C      ICE  + +P  PE  KS +   EL  +  I  K        W   +     V+ +    N ++    D+ C V Y     +  I CG+    +          T AP     +       + FG    +       + SA   C+  + NL T++NE     +       NID  WI  ND  +E  ++ ++   + YTNW    P G +    +C+   +      G W + EC      IC+     P   T              + I   +M++++A   CK  +  L++I +E +N  ++    K  +  +W+  N N     +  TDN ++ Y  W  +EP+  +   C+  + I+G W   +C      IC+      P    ++P                 +      +   N   A   C      +   D++ +++        ++  +  FWI G     E  W+   +  + + NW   EP     E+C V +  ++G W++ +C S    IC+
Sbjct:  658 EEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLNYRYYNQIFWIGLQTSDPEEGFEWVDG---SLSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNHFFIIMWMDGSVMNY-VAWASYEPNFANN---DENCVVMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRVIKNSNRTTDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNID-VWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYRE-PFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTACVY-MDIDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHC-VEMYSSHGTWNNLYCSSYRGYICK 1278          

HSP 4 Score: 31.9574 bits (71), Expect = 2.189e-18
Identity = 22/115 (19.13%), Postives = 48/115 (41.74%), Query Frame = -2
Query: 2662 YGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3006
            Y Y+++    ++T A   C      L+T+++      + ++        +W    D+   G +  +    + + +W S  P G+R+   V       GLW+ I+C      +C++
Sbjct:  504 YCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMP-GRRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQ 617          

HSP 5 Score: 82.8037 bits (203), Expect = 2.752e-15
Identity = 135/678 (19.91%), Postives = 227/678 (33.48%), Query Frame = -3
Query:  195 GYHYT---REKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEP------------------------MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEP--QGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSL----------------FYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLT-DANGLWDDAHCQSMNSVICEP-------------------INDTKNGFHITSVKMKFDTAVK----------YCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWI--NGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPN-GGKKENCIQGLYFSDGTWNDVKCDMKNKVICELK 1991
            G HY    +  +T+  A K CL Q   L++I        +  LS        W   N L     W  S  +   Y NW    P      NC+      +G W + EC+Q    IC+                         + +  N Y + K+   + +A++ C+K    L +  N      +    +       W+  ND      +  +D   +SY  W   EP  +  ++E+C   L  +       C+   + IC+       P    +                +  S    +   A + C      +V +++  +     +         FW   TDS   G +     +++ + +W S  P  G+   C V  T +  GLWD   C+     +C+                      D K    I S    F    +          +C+    +LV I+  +    +  L+  +    +WI    +D  +  +W D     LS++ W   EP   +  E C   +      WND  C S    IC+  K  P +   +KS              +++      +KDN F   +         W++G+               + Y+ W   +PN     ENC+  +Y + G WND+ C   N  ICE K
Sbjct:  223 GVHYQINNQAALTWFQARKSCLQQESELLSITEIHEQTFLTGLSNTMTTS-LWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCPFYLFYD------MCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMP--GRRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQLNYRYYNQIFWIGLQTSDPEEGFEWVDGS---LSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSS---------VPEYELTSDGWIANKDNHFFIIM---------WMDGS--------------VMNYVAWASYEPNFANNDENCVV-MYKNMGFWNDINCGYPNPYICERK 855          

HSP 6 Score: 63.1586 bits (152), Expect = 2.595e-9
Identity = 73/303 (24.09%), Postives = 115/303 (37.95%), Query Frame = -3
Query: 1260 TVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNID-WYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE---------------------------PMR---------HTTNKYH-------IGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNS 2036
            T+AP V+  K   E  +     KM++  A + C ++   LV+I +E TN  +   + +Y    W  +N N    +  W D  N KL YT W  +EP   K   C+   +  DG W    C +    IC+                           P R         +T N Y         G    +F+D++    + N V   IE                   +W+    N E   WL  DN  + + NW+  EP  +  E+C++    +G WN++ C S    IC+  +NK +  + S
Sbjct: 1011 TIAPSVRFFKFGNE-TFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYREPFWIGLNSNKTGNQYKWTD--NWKLRYTKWAAEEPK--KTTACVYMDI--DGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSL----ESNFVWHQIERLEDRVK-----------SFWIGMYQNVENK-WLWLDNAPVDFVNWNIGEPSDHNDEHCVEMYSSHGTWNNLYCSSYRGYICKIQKNKIKTDAPS 1290          

HSP 7 Score: 56.225 bits (134), Expect = 3.328e-7
Identity = 76/397 (19.14%), Postives = 138/397 (34.76%), Query Frame = -3
Query:  183 LAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSAN-EGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITS---------------------VKMK---FDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEP--KGGRNENCITGNNYQDALWNDEKCGSLNSVIC--QPIKYGPSK-------------------YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENC-IQGLYFSDGTWNDVKCDMKNKVICELKVEKL 1226
              AR+ C  +   ++ I    +    +T    +  +  W  G +S N    W         Y NW    P      NC    T  NG W++  C      IC+  + T + F + S                     VK +   +  A+  CR ++ +L      +  + + +        + WI  ND +    +E S    +S+  W + EP  +  + E+C     Y       + C      IC  +P+ + P +                   Y IS +  ++ +  + C      LV + D  +  ++  L        FW    D    G +  T+ E + + +WN   P  G++  C +       G W+ + C+ K K +C+   E +
Sbjct:  237 FQARKSCLQQESELLSITEIHEQTF-LTGLSNTMTTSLWT-GLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCPFYLFY-------DMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMP--GRRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGV 622          
BLAST of SMED30004599 vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 123.25 bits (308), Expect = 8.948e-28
Identity = 171/720 (23.75%), Postives = 285/720 (39.58%), Query Frame = -3
Query:  186 HYTR---EKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYN-IDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKR-ENCIQSLVYADGFWNDVECDQPNSVICE----------PMRHTT---------------NKYHIGKDRMTFNDAVNYCKKR--NMVLINIENEXXXXXXXXXXXXXXKFDY----WVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQ-GYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSST---------------------------EKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQK-LSYKNWYSTEPDGGK-------TENCAV---SLTDANGLWDDAHCQSMNSVICE-----PINDT-----------KNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ----------PIKYG------------PSKYH-----ISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLA--LKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEK 1985
            H++R   EK T+  +  +C A   +LV+I+++    ++  L   YN I W  +  +D  +   WVD   + LSY NW Y EP+  +  E C +  V     WND  C+     ICE          P + +                N+Y I  + +  + A  +CKK   ++V+IN + E        ++ +   + +    W++G+               ++Y  W   EP      ENC+   +  G WND+ C      IC+    +K  S N+ F  +                            E  +  +AR  C   N  +  ++N       +TY +K      WI G +  NE +   + DQ+ + Y NW    P G +       T+  ++   S  DA G W +  C      IC+     P + T              F I + KM +D A + C+++  ELV I  D+  N    +  +     +WI  N N+   Q++ +    L + KW   EPK  +   C+  +   D  W    C      IC+          P K G            P + H     +S +K  Y+  ++ C     SL    D  ++ FV+     L+ ++ +FWI G     E  W+  DN  + ++NWNI +P+    E+C++ +Y S GTWN++ C      IC+++  K
Sbjct:  659 HFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL--YYNQIFWIGLQTSDPEEGFEWVD--GSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLFFRWMDGS--------------VMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICE----RKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAF-LTYNLKDLNIDVWI-GMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDA-GSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSIT-DEYTNSFLRVYTSKYREPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTACVYMD--IDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVE-MYSSHGTWNNLYCSSYRGYICKIQKSK 1345          

HSP 2 Score: 105.145 bits (261), Expect = 4.065e-22
Identity = 147/707 (20.79%), Postives = 241/707 (34.09%), Query Frame = -3
Query:  195 GYHYT---REKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEP------------------------MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEP--QGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSL----------------FYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLT-DANGLWDDAHCQSMNSVICEP-------------------INDTKNGFHITSVKMKFDTAVK----------YCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNYQDALWNDEKCGSLNSVICQ-----PIKYGPSK--------------------YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFV------YDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPN-GGKKENCIQGLYFSDGTWNDVKCDMKNKVICELK 1991
            G HY    +  +T+  A K CL Q   L++I        +  LS        W   N L     W  S  +   Y NW    P      NC+      +G W + EC+Q    IC+                         + +  N Y + K+   + +A++ C+K    L +  N      +    +       W+  ND      +  +D   +SY  W   EP  +  ++E+C+     +G W+D  C+   + IC+       P    +                +  S    +   A + C      +V +++  +     +         FW   TDS   G +     +++ + +W S  P  G+   C V  T +  GLWD   C+     +C+                      D K    I S    F    +          +C+    +LV I+  +       LS  +    +WI    +  E  +E    + LS++ W   EP   +  E C   +      WND  C S    IC+     P++  P+K                    Y IS          ++CK     LV I DD + KF+      Y++ L   L   W++G+               + Y+ W   +PN     ENC+  +Y + G WND+ C   N  ICE K
Sbjct:  224 GVHYQINNQAALTWFQARKSCLQQESELLSITEIHEQTFLTGLSNTMTTS-LWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCVAFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMP--GRRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETI---LSQLYYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLFFRWMDGS--------------VMNYVAWASYEPNFANNDENCVV-MYKNMGFWNDINCGYPNPYICERK 909          

HSP 3 Score: 85.8853 bits (211), Expect = 3.000e-16
Identity = 133/558 (23.84%), Postives = 204/558 (36.56%), Query Frame = -3
Query:  561 YHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPD-GGKRENCIQSLVYAD-GFWNDVECDQPNSVICEPMRHTTNK------------------------YHI---GKDRMT-FNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYR------KENCIQGLRIN----GLWNDVTCDSLGEVICQ-----PIQNKKRPS------SNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQ-KLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE------PIN----------DTKNGFHITSVKMKFDTAVKYCRN---KKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNL-----------LSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ 1988
            Y  + E +    A ++C     +LV I+++   K +    + Y I  Y            W+D   + ++Y  W   EP+     ENC+  ++Y + GFWND+ C  PN  ICE    + N                         Y I   GK   T ++ A   C + N  L  +ENE     +   +K     D W+  ND +EE  +L TD   + Y NW    P G R        +C+   R +    G W +  C      ICQ     P      PS       N  F     KM+   A   C + +  +V I +   N     Y  K     FWI G +S   GN   + D  KL Y  W + EP   KT  C     D +G W  + C      IC+      P +          D+ +   I      +   V Y +N     +E ++  G   +   ++ S+  N   + I   ++R +  W    QN+           + F  W+  EP    +E+C+   +     WN+  C S    IC+
Sbjct:  804 YFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLY------FFLFFRWMD--GSVMNYVAWASYEPNFANNDENCV--VMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLN-IDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYREP-FWI-GLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTACV--YMDIDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLAS---FDDSLESNFVWHQIERLEDRVKSFWIGMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVEMYS-SHGTWNNLYCSSYRGYICK 1340          

HSP 4 Score: 56.9954 bits (136), Expect = 1.746e-13
Identity = 39/124 (31.45%), Postives = 60/124 (48.39%), Query Frame = -2
Query: 2653 IIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPN-GKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKT 3021
            I   D  Y ++ + +A   A  FCK+   +L+ I +    K ++   + Y+I  Y+       +   W+D   + M Y  W S EPN     ENCV  +Y   G WNDI+C  PN  IC++K +
Sbjct:  797 IANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYVMMYEIPLYFF------LFFRWMDG--SVMNYVAWASYEPNFANNDENCVV-MYKNMGFWNDINCGYPNPYICERKNS 911          

HSP 5 Score: 40.4318 bits (93), Expect = 1.746e-13
Identity = 41/151 (27.15%), Postives = 58/151 (38.41%), Query Frame = -3
Query: 2211 EIMTYDEAVKFCGEKNLRLLTIKNEKI------NKRVFNIAVYYNLGTYWITGNDYSKEGS--WVDSRNVSLQFKKWYQGEPNGGR------KENCI---HGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKI 2612
            E   +D A   C   N  L T++NE +      N +  NI V       WI  ND ++E    W D R V   +  W +G P G R        +C+    G   D   W +  C      IC+  +  PA P I  S     + ++  KI
Sbjct:  949 EATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-------WIGMNDKNEEHRFLWTDQRGV--YYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKTLPASPTIAPSVRFFKFGNETFKI 1090          

HSP 6 Score: 50.0618 bits (118), Expect = 3.711e-11
Identity = 39/139 (28.06%), Postives = 62/139 (44.60%), Query Frame = -3
Query: 2262 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKR-------VFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPN-GGRKENCIHGLRYDN-EFWNDVNCFHKNMVICE--------PMEKSPADPE 2627
            Y I+ EI+  D+A +FC +KN   L + N+   ++       ++ I +Y+ L   W+ G+               + +  W   EPN     ENC+  + Y N  FWND+NC + N  ICE            +PA P+
Sbjct:  804 YFISTEIVAMDKAREFC-KKNFGDLVVINDDTERKFLWRYVMMYEIPLYFFLFFRWMDGS--------------VMNYVAWASYEPNFANNDENCV--VMYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQ 925          

HSP 7 Score: 39.6614 bits (91), Expect = 3.711e-11
Identity = 33/117 (28.21%), Postives = 54/117 (46.15%), Query Frame = -2
Query: 2656 QKMAYTTAVSFCKEQNMELLTI----KNGIINKRVFNMAIKYKIGYYWID-GNDNGMEGY-WVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGL-WNDISCNTPNSVICQKKK 2985
            +K  +  + SFCK    +L++I    +  I+++  +N         +WI     +  EG+ WVD  +  + Y+NW  GEPN  +       L+    L WND  C +    IC+ KK
Sbjct:  666 EKRTWFESRSFCKAIGGDLVSINSKEEETILSQLYYNQI-------FWIGLQTSDPEEGFEWVDGSA--LSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKK 773          

HSP 8 Score: 65.0846 bits (157), Expect = 6.648e-10
Identity = 73/299 (24.41%), Postives = 114/299 (38.13%), Query Frame = -3
Query: 1272 TVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNID-WYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE---------------------------PMR---------HTTNKYH-------IGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRP 2036
            T+AP V+  K   E  +     KM++  A + C ++   LV+I +E TN  +   + +Y    W  +N N    +  W D  N KL YT W  +EP   K   C+   +  DG W    C +    IC+                           P R         +T N Y         G    +F+D++    + N V   IE                   +W+    N E   WL  DN  + + NW+  EP  +  E+C++    +G WN++ C S    IC+  ++KK P
Sbjct: 1073 TIAPSVRFFKFGNE-TFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYREPFWIGLNSNKTGNQYKWTD--NWKLRYTKWAAEEPK--KTTACVYMDI--DGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLECLRFGGSLASFDDSL----ESNFVWHQIERLEDRVK-----------SFWIGMYQNVENK-WLWLDNAPVDFVNWNIGEPSDHNDEHCVEMYSSHGTWNNLYCSSYRGYICKIQKSKKDP 1348          

HSP 9 Score: 39.2762 bits (90), Expect = 1.453e-6
Identity = 32/126 (25.40%), Postives = 50/126 (39.68%), Query Frame = -2
Query: 2653 QKMAYTTAVSFCKEQNMELLTIKNGII------NKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKR------QENCV---HGLYYPAGLWNDISCNTPNSVICQKKKT 2985
            +   + +A + C   N  L T++N ++      N +  N+ +       WI  ND   E  ++ +    + Y NW  G P G R        +CV    G    AG W +  C+     ICQ  KT
Sbjct:  949 EATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-------WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKT 1067          

HSP 10 Score: 34.2686 bits (77), Expect = 1.453e-6
Identity = 36/136 (26.47%), Postives = 60/136 (44.12%), Query Frame = -3
Query: 2265 FVEYG---YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWI------TGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEK-SPADP 2642
            F ++G   + I    M++DEA + C  ++  L++I +E  N  +      Y    +WI      TGN Y     W D  N  L++ KW   EP   +   C++ +  D + W   +C      IC+  +  +P DP
Sbjct: 1080 FFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYK----WTD--NWKLRYTKWAAEEPK--KTTACVY-MDIDGQ-WKTSSCTENYFSICKQSDAIAPTDP 1204          

HSP 11 Score: 40.817 bits (94), Expect = 2.697e-6
Identity = 38/125 (30.40%), Postives = 56/125 (44.80%), Query Frame = -3
Query: 2250 EEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWI--TGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEF-WNDVNCFHKNMVICEPMEKSPADPEICKS 2615
            EE  T+ E+  FC      L++I N K  + + +  +YYN   +WI    +D  +   WVD    +L ++ W  GEPN  +       L       WND +C      ICE  + +P  PE  KS
Sbjct:  665 EEKRTWFESRSFCKAIGGDLVSI-NSKEEETILS-QLYYNQ-IFWIGLQTSDPEEGFEWVDGS--ALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKS 784          

HSP 12 Score: 31.9574 bits (71), Expect = 2.697e-6
Identity = 22/115 (19.13%), Postives = 48/115 (41.74%), Query Frame = -2
Query: 2662 YGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3006
            Y Y+++    ++T A   C      L+T+++      + ++        +W    D+   G +  +    + + +W S  P G+R+   V       GLW+ I+C      +C++
Sbjct:  511 YCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMP-GRRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQ 624          
BLAST of SMED30004599 vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 115.546 bits (288), Expect = 1.982e-25
Identity = 165/694 (23.78%), Postives = 268/694 (38.62%), Query Frame = -3
Query:  195 HYTR---EKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYN-IDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKR-ENCIQSLVYADGFWNDVECDQPNSVICE-----PMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGV-WLNTDNEEISYKNWHPKEPQ-GYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSST---------------------------EKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQK-LSYKNWYSTEPDGGK-------TENCAV---SLTDANGLWDDAHCQSMNSVICE-------PINDT-----------KNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ----------PIKYG------------PSKYH-----ISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLA--LKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELK 1985
            H++R   EK T+  +  +C A   +LV+I+++    ++  L   YN I W  +  +D  +   WVD +   LSY NW Y EP+  +  E C +  V     WND  C+     ICE     P++    K  + +  +T                                     D W+   DN    + W+  D   ++Y  W   EP      ENC+   +  G WND+ C      IC+    +K  S N+ F  +                            E  +  +AR  C   N  +  ++N       +TY +K      WI G +  NE +   + DQ+ + Y NW    P G +       T+  ++   S  DA G W +  C      IC+       P + T              F I + KM +D A + C+++  ELV I  D+  N    +  +     +WI  N N+   Q++ +    L + KW   EPK  +   C+  +   D  W    C      IC+          P K G            P + H     +S +K  Y+  ++ C     SL    D  ++ FV+     L+ ++ +FWI G     E  W+  DN  + ++NWNI +P+    E+C++ +Y S GTWN++ C      IC+++
Sbjct:  646 HFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL--YYNQIFWIGLQTSDPEEGFEWVDGS--ALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTS------------------------------------DGWIANKDNHFFIIMWM--DGSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICE----RKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAF-LTYNLKDLNIDVWI-GMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDA-GSWFEEECSLSRGYICQTDKNPALPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSIT-DEYTNSFLRVYTSKYREPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTACVYMD--IDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVE-MYSSHGTWNNLYCSSYRGYICKIQ 1282          

HSP 2 Score: 97.8265 bits (242), Expect = 5.448e-20
Identity = 153/696 (21.98%), Postives = 237/696 (34.05%), Query Frame = -3
Query:  201 YHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPD--GGKRENCIQSLVYADGFWNDVECDQPNSVIC-------EP--------------MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRIN--GLWNDVTCDSLGEVICQ--------------------PIQNKKRPSSNSLF----YSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSY---FWID-GTDSANEG-NWVDYQDQKLSYKNWYSTEPDGGK-TENCAVSLTDANGLWDDAHCQSMNSVICE-----PINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNYQD-ALWNDEKCGSLNSVICQ----------------PIKYGPSKYHISKSKRNYK-------------DGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGK------KENCI---QGLYFSDGTWNDVKCDMKNKVICE 1988
            Y   +E   +K A+  C  +  +L +  N      +            WI  ND      +  S+   +SYT W   EP     K+E+C+ +     G W+D  C+     IC       EP               RH    Y I     +F +A   C      L+ +E+      +  L+    +  +W    D+ E GV+  T+ E + + +W+ + P   R+  C+     N  GLW+ +TC+   + +C+                    P   K  P   S +        EK     +R FC      +V I++  +        I S L Y   FWI   T    EG  WVD     LSY+NW   EP+  +  E C          W+D HC+S    ICE     P+        +   ++  D  +    N    ++ +DG  MN                                     +  W   EP    N ENC+    Y++   WND  CG  N  IC+                P    PS + I+  KR YK                  C     +L  + ++    F+    LK      WI  ND   E  ++ TD   + Y NW    P G +        +C+   +G     G+W + +C +    IC+
Sbjct:  358 YTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEE------TILSQLYYNQIFWIGLQTSDPEEGFEWVD--GSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNHFFIIMWMDGSVMN-------------------------------------YVAWASYEPNFANNDENCVV--MYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDW-ITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFL-TYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQ 1001          

HSP 3 Score: 92.4337 bits (228), Expect = 2.986e-18
Identity = 137/676 (20.27%), Postives = 229/676 (33.88%), Query Frame = -3
Query:  195 GYHYT---REKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEP------------------------MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEP--QGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSL----------------FYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLT-DANGLWDDAHCQSMNSVICEP-------------------INDTKNGFHITSVKMKFDTAVK----------YCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPN-GGKKENCIQGLYFSDGTWNDVKCDMKNKVICELK 1991
            G HY    +  +T+  A K CL Q   L++I        +  LS        W   N L     W  S  +   Y NW    P      NC+      +G W + EC+Q    IC+                         + +  N Y + K+   + +A++ C+K    L +  N      +    +       W+  ND      +  +D   +SY  W   EP  +  ++E+C+     +G W+D  C+   + IC+       P    +                +  S    +   A + C      +V +++  +     +         FW   TDS   G +     +++ + +W S  P  G+   C V  T +  GLWD   C+     +C+                      D K    I S    F    +          +C+    +LV I+  +       LS  +    +WI    +  E  +E    + LS++ W   EP   +  E C   +      WND  C S    IC+  K  P +   +KS              +++      +KDN F   +         W++G+               + Y+ W   +PN     ENC+  +Y + G WND+ C   N  ICE K
Sbjct:  211 GVHYQINNQAALTWFQARKSCLQQESELLSITEIHEQTFLTGLSNTMTTS-LWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCVAFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMP--GRRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETI---LSQLYYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSS---------VPEYELTSDGWIANKDNHFFIIM---------WMDGS--------------VMNYVAWASYEPNFANNDENCVV-MYKNMGFWNDINCGYPNPYICERK 847          

HSP 4 Score: 42.743 bits (99), Expect = 4.044e-8
Identity = 25/57 (43.86%), Postives = 32/57 (56.14%), Query Frame = -2
Query: 2653 WVDSKSNPMQYQNWKSGEPN-GKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKT 2820
            W+D   + M Y  W S EPN     ENCV  +Y   G WNDI+C  PN  IC++K +
Sbjct:  796 WMDG--SVMNYVAWASYEPNFANNDENCVV-MYKNMGFWNDINCGYPNPYICERKNS 849          

HSP 5 Score: 36.1946 bits (82), Expect = 4.044e-8
Identity = 41/153 (26.80%), Postives = 58/153 (37.91%), Query Frame = -3
Query: 2211 EIMTYDEAVKFCGEKNLRLLTIKNEKI------NKRVFNIAVYYNLGTYWITGNDYSKEGS--WVDSRNVSLQFKKWYQGEPNGGR------KENCI---HGLRYDNEFWNDVNCFHKNMVICEPMEKS--PADPEICKSFLELCYNSKIRKI 2612
            E   +D A   C   N  L T++NE +      N +  NI V       WI  ND ++E    W D R V   +  W +G P G R        +C+    G   D   W +  C      IC+  +    PA P I  S     + ++  KI
Sbjct:  887 EATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-------WIGMNDKNEEHRFLWTDQRGV--YYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKNPALPASPTIAPSVRFFKFGNETFKI 1030          

HSP 6 Score: 40.817 bits (94), Expect = 2.394e-6
Identity = 38/125 (30.40%), Postives = 56/125 (44.80%), Query Frame = -3
Query: 2250 EEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWI--TGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEF-WNDVNCFHKNMVICEPMEKSPADPEICKS 2615
            EE  T+ E+  FC      L++I N K  + + +  +YYN   +WI    +D  +   WVD    +L ++ W  GEPN  +       L       WND +C      ICE  + +P  PE  KS
Sbjct:  652 EEKRTWFESRSFCKAIGGDLVSI-NSKEEETILS-QLYYNQ-IFWIGLQTSDPEEGFEWVDGS--ALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKS 771          

HSP 7 Score: 31.9574 bits (71), Expect = 2.394e-6
Identity = 22/115 (19.13%), Postives = 48/115 (41.74%), Query Frame = -2
Query: 2662 YGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3006
            Y Y+++    ++T A   C      L+T+++      + ++        +W    D+   G +  +    + + +W S  P G+R+   V       GLW+ I+C      +C++
Sbjct:  498 YCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMP-GRRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQ 611          

HSP 8 Score: 37.7354 bits (86), Expect = 4.043e-6
Identity = 31/125 (24.80%), Postives = 49/125 (39.20%), Query Frame = -2
Query: 2656 QKMAYTTAVSFCKEQNMELLTIKNGII------NKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKR------QENCV---HGLYYPAGLWNDISCNTPNSVICQKKK 2985
            +   + +A + C   N  L T++N ++      N +  N+ +       WI  ND   E  ++ +    + Y NW  G P G R        +CV    G    AG W +  C+     ICQ  K
Sbjct:  887 EATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-------WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDK 1004          

HSP 9 Score: 34.6538 bits (78), Expect = 4.043e-6
Identity = 36/136 (26.47%), Postives = 60/136 (44.12%), Query Frame = -3
Query: 2265 FVEYG---YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWI------TGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEK-SPADP 2642
            F ++G   + I    M++DEA + C  ++  L++I +E  N  +      Y    +WI      TGN Y     W D  N  L++ KW   EP   +   C++ +  D + W   +C      IC+  +  +P DP
Sbjct: 1020 FFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYK----WTD--NWKLRYTKWAAEEPK--KTTACVY-MDIDGQ-WKTSSCTENYFSICKQSDAIAPTDP 1144          
BLAST of SMED30004599 vs. Ensembl Xenopus
Match: orc3 (origin recognition complex subunit 3 [Source:Xenbase;Acc:XB-GENE-984200])

HSP 1 Score: 115.546 bits (288), Expect = 1.983e-25
Identity = 165/694 (23.78%), Postives = 268/694 (38.62%), Query Frame = -3
Query:  195 HYTR---EKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYN-IDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKR-ENCIQSLVYADGFWNDVECDQPNSVICE-----PMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGV-WLNTDNEEISYKNWHPKEPQ-GYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSST---------------------------EKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQK-LSYKNWYSTEPDGGK-------TENCAV---SLTDANGLWDDAHCQSMNSVICE-------PINDT-----------KNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ----------PIKYG------------PSKYH-----ISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLA--LKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELK 1985
            H++R   EK T+  +  +C A   +LV+I+++    ++  L   YN I W  +  +D  +   WVD   + LSY NW Y EP+  +  E C +  V     WND  C+     ICE     P++    K  + +  +T                                     D W+   DN    + W+  D   ++Y  W   EP      ENC+   +  G WND+ C      IC+    +K  S N+ F  +                            E  +  +AR  C   N  +  ++N       +TY +K      WI G +  NE +   + DQ+ + Y NW    P G +       T+  ++   S  DA G W +  C      IC+       P + T              F I + KM +D A + C+++  ELV I  D+  N    +  +     +WI  N N+   Q++ +    L + KW   EPK  +   C+  +   D  W    C      IC+          P K G            P + H     +S +K  Y+  ++ C     SL    D  ++ FV+     L+ ++ +FWI G     E  W+  DN  + ++NWNI +P+    E+C++ +Y S GTWN++ C      IC+++
Sbjct:  647 HFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETILSQL--YYNQIFWIGLQTSDPEEGFEWVD--GSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTS------------------------------------DGWIANKDNHFFIIMWM--DGSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDINCGYPNPYICE----RKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAF-LTYNLKDLNIDVWI-GMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDA-GSWFEEECSLSRGYICQTDKNPALPASPTIAPSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSIT-DEYTNSFLRVYTSKYREPFWIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPK--KTTACVYMD--IDGQWKTSSCTENYFSICKQSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKNWYQASLE-CLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWI-GMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDEHCVE-MYSSHGTWNNLYCSSYRGYICKIQ 1283          

HSP 2 Score: 98.2117 bits (243), Expect = 4.559e-20
Identity = 153/696 (21.98%), Postives = 237/696 (34.05%), Query Frame = -3
Query:  201 YHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPD--GGKRENCIQSLVYADGFWNDVECDQPNSVIC-------EP--------------MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRIN--GLWNDVTCDSLGEVICQ--------------------PIQNKKRPSSNSLF----YSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSY---FWID-GTDSANEG-NWVDYQDQKLSYKNWYSTEPDGGK-TENCAVSLTDANGLWDDAHCQSMNSVICE-----PINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNYQD-ALWNDEKCGSLNSVICQ----------------PIKYGPSKYHISKSKRNYK-------------DGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGK------KENCI---QGLYFSDGTWNDVKCDMKNKVICE 1988
            Y   +E   +K A+  C  +  +L +  N      +            WI  ND      +  S+   +SYT W   EP     K+E+C+ +     G W+D  C+     IC       EP               RH    Y I     +F +A   C      L+ +E+      +  L+    +  +W    D+ E GV+  T+ E + + +W+ + P   R+  C+     N  GLW+ +TC+   + +C+                    P   K  P   S +        EK     +R FC      +V I++  +        I S L Y   FWI   T    EG  WVD     LSY+NW   EP+  +  E C          W+D HC+S    ICE     P+        +   ++  D  +    N    ++ +DG  MN                                     +  W   EP    N ENC+    Y++   WND  CG  N  IC+                P    PS + I+  KR YK                  C     +L  + ++    F+    LK      WI  ND   E  ++ TD   + Y NW    P G +        +C+   +G     G+W + +C +    IC+
Sbjct:  359 YTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCV-AFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPG--RRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEE------TILSQLYYNQIFWIGLQTSDPEEGFEWVD--GSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSSVPEYELTSDGWIANKDNHFFIIMWMDGSVMN-------------------------------------YVAWASYEPNFANNDENCVV--MYKNMGFWNDINCGYPNPYICERKNSSINATFAPTPASPQGGCPSDW-ITFGKRCYKIFGNGKGEATDWDSARTACMRFNGNLATVENELVQAFL-TYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQ 1002          

HSP 3 Score: 92.4337 bits (228), Expect = 2.457e-18
Identity = 137/676 (20.27%), Postives = 229/676 (33.88%), Query Frame = -3
Query:  195 GYHYT---REKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEP------------------------MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEP--QGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSL----------------FYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLT-DANGLWDDAHCQSMNSVICEP-------------------INDTKNGFHITSVKMKFDTAVK----------YCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPN-GGKKENCIQGLYFSDGTWNDVKCDMKNKVICELK 1991
            G HY    +  +T+  A K CL Q   L++I        +  LS        W   N L     W  S  +   Y NW    P      NC+      +G W + EC+Q    IC+                         + +  N Y + K+   + +A++ C+K    L +  N      +    +       W+  ND      +  +D   +SY  W   EP  +  ++E+C+     +G W+D  C+   + IC+       P    +                +  S    +   A + C      +V +++  +     +         FW   TDS   G +     +++ + +W S  P  G+   C V  T +  GLWD   C+     +C+                      D K    I S    F    +          +C+    +LV I+  +       LS  +    +WI    +  E  +E    + LS++ W   EP   +  E C   +      WND  C S    IC+  K  P +   +KS              +++      +KDN F   +         W++G+               + Y+ W   +PN     ENC+  +Y + G WND+ C   N  ICE K
Sbjct:  212 GVHYQINNQAALTWFQARKSCLQQESELLSITEIHEQTFLTGLSNTMTTS-LWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGINCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYFEWSDGTPVSYTVWLRGEPSHRDNKQEDCVAFDPKSGHWSDDMCEMKFQYICKRKPLPFEPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMP--GRRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRTWFESRSFCKAIGGDLVSINSKEEETI---LSQLYYNQIFWIGLQTSDPEEGFEWVDGSALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKSS---------VPEYELTSDGWIANKDNHFFIIM---------WMDGS--------------VMNYVAWASYEPNFANNDENCVV-MYKNMGFWNDINCGYPNPYICERK 848          

HSP 4 Score: 43.1282 bits (100), Expect = 4.420e-8
Identity = 25/57 (43.86%), Postives = 32/57 (56.14%), Query Frame = -2
Query: 2653 WVDSKSNPMQYQNWKSGEPN-GKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKT 2820
            W+D   + M Y  W S EPN     ENCV  +Y   G WNDI+C  PN  IC++K +
Sbjct:  797 WMDG--SVMNYVAWASYEPNFANNDENCVV-MYKNMGFWNDINCGYPNPYICERKNS 850          

HSP 5 Score: 35.8094 bits (81), Expect = 4.420e-8
Identity = 41/153 (26.80%), Postives = 58/153 (37.91%), Query Frame = -3
Query: 2211 EIMTYDEAVKFCGEKNLRLLTIKNEKI------NKRVFNIAVYYNLGTYWITGNDYSKEGS--WVDSRNVSLQFKKWYQGEPNGGR------KENCI---HGLRYDNEFWNDVNCFHKNMVICEPMEKS--PADPEICKSFLELCYNSKIRKI 2612
            E   +D A   C   N  L T++NE +      N +  NI V       WI  ND ++E    W D R V   +  W +G P G R        +C+    G   D   W +  C      IC+  +    PA P I  S     + ++  KI
Sbjct:  888 EATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-------WIGMNDKNEEHRFLWTDQRGV--YYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKNPALPASPTIAPSVRFFKFGNETFKI 1031          

HSP 6 Score: 40.817 bits (94), Expect = 2.356e-6
Identity = 38/125 (30.40%), Postives = 56/125 (44.80%), Query Frame = -3
Query: 2250 EEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWI--TGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEF-WNDVNCFHKNMVICEPMEKSPADPEICKS 2615
            EE  T+ E+  FC      L++I N K  + + +  +YYN   +WI    +D  +   WVD    +L ++ W  GEPN  +       L       WND +C      ICE  + +P  PE  KS
Sbjct:  653 EEKRTWFESRSFCKAIGGDLVSI-NSKEEETILS-QLYYNQ-IFWIGLQTSDPEEGFEWVDGS--ALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKS 772          

HSP 7 Score: 31.9574 bits (71), Expect = 2.356e-6
Identity = 22/115 (19.13%), Postives = 48/115 (41.74%), Query Frame = -2
Query: 2662 YGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3006
            Y Y+++    ++T A   C      L+T+++      + ++        +W    D+   G +  +    + + +W S  P G+R+   V       GLW+ I+C      +C++
Sbjct:  499 YCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLTSLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMP-GRRRGCVVMRTGNKGGLWDVITCEEKAKFVCKQ 612          

HSP 8 Score: 37.7354 bits (86), Expect = 4.347e-6
Identity = 31/125 (24.80%), Postives = 49/125 (39.20%), Query Frame = -2
Query: 2656 QKMAYTTAVSFCKEQNMELLTIKNGII------NKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKR------QENCV---HGLYYPAGLWNDISCNTPNSVICQKKK 2985
            +   + +A + C   N  L T++N ++      N +  N+ +       WI  ND   E  ++ +    + Y NW  G P G R        +CV    G    AG W +  C+     ICQ  K
Sbjct:  888 EATDWDSARTACMRFNGNLATVENELVQAFLTYNLKDLNIDV-------WIGMNDKNEEHRFLWTDQRGVYYTNWAKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDK 1005          

HSP 9 Score: 34.6538 bits (78), Expect = 4.347e-6
Identity = 36/136 (26.47%), Postives = 60/136 (44.12%), Query Frame = -3
Query: 2265 FVEYG---YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWI------TGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEK-SPADP 2642
            F ++G   + I    M++DEA + C  ++  L++I +E  N  +      Y    +WI      TGN Y     W D  N  L++ KW   EP   +   C++ +  D + W   +C      IC+  +  +P DP
Sbjct: 1021 FFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYR-EPFWIGLNSNKTGNQYK----WTD--NWKLRYTKWAAEEPK--KTTACVY-MDIDGQ-WKTSSCTENYFSICKQSDAIAPTDP 1145          
BLAST of SMED30004599 vs. Ensembl Mouse
Match: Mrc1 (mannose receptor, C type 1 [Source:MGI Symbol;Acc:MGI:97142])

HSP 1 Score: 120.168 bits (300), Expect = 6.032e-27
Identity = 165/719 (22.95%), Postives = 282/719 (39.22%), Query Frame = -3
Query:  189 YTREKMTYKSAVKYCLAQSMNLVTIDN-EATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEP--DGGKRENCIQSLVYADGFWNDVECDQPNSVICEPM--------------------RHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCI--QGLRINGLWNDVTCDSLGEVICQP-------------------IQNKKRPSSNSLFY-----SSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSY---FWIDGT-DSANEG-NWVDYQDQKLSYKNWYSTEPDGGK-TENCAVSLTDANGLWDDAHCQSMNSVIC----------EPINDTKNG---------------FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGR--YWINGNDNR-KEGQWEDSKQNLLSFKKWHKSEPK-GGRNENCITGNNYQDALWNDEKCGSLNSVICQ--------------PIKYGPSK--YHISK------------SKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKE------NC---IQGLYFSDGTWNDVKCDMKNKVICELKVE 1982
            +  EK   K A++ C  +  +L +I + E  + +   L  + N D  WI  ND+  +  +  S+   +++T W   EP  +  ++E+C+  +   DG+W D  C+QP   IC+ +                    RH    Y IG    TF DA + C      L  +E+      +  LV    +  +W   +D   +G +  T +E++ + +W+   P   RK  C+  +     GLW+ ++C+   + +C+                     +N    S  S+ +        EK     +R+FC      +  I +  +  + +   I S+ SY   FW+  T  S +EG  W D     +SY+NW   EP+  +  E C     D    W+D +C+ +N+ IC          EP    ++                ++ +  K   D A  +C+    +L  I  +     ++   +  N G+  Y+I    +  K+  W D  +  + F  W   EP     +ENC+T        WND  CG  N+ ICQ              P   G  K  +H+ K             K++++D  + CK  K +LV I + ++  FV    ++      W   ND+  E  ++ T  + + Y NW    P G +        +C   I G     GTW D  CD K   IC+ + +
Sbjct:  377 HREEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQLGYEPN-DELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCV-VMKGKDGYWADRACEQPLGYICKMVSQSHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPG--RKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKGKHEKKTWFESRDFCKAIGGELASIKSKDEQQV-IWRLITSSGSYHELFWLGLTYGSPSEGFTWSD--GSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKY-INKNGGQSPYFIGMLISMDKKFIWMDGSK--VDFVAWATGEPNFANDDENCVTMYT-NSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFV-TYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTD 1083          

HSP 2 Score: 107.842 bits (268), Expect = 4.206e-23
Identity = 155/703 (22.05%), Postives = 265/703 (37.70%), Query Frame = -3
Query:  201 TYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLV-YADGFWNDVECDQPNSVICEPMRH---------------------TTNK-------YHIGK-DRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFD--YWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRK-ENCIQGLRINGL-WNDVTCDSLGEVICQPIQNKK--------RPSSNSL-------------FYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDT----------------KNGFHI------------TSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQV-YNL-SVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGR------NENC---ITGNNYQDALWNDEKCGSLNSVICQP------------------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWI--NGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFS-DGTWNDVKCDMKNKVICE 1964
            T+  A   C  +   L T+++      +  L       ++W   +D+  +G +  + + ++ +T+W+   P  G++  C+      A G W+ + C++    +C+                         TT+K       Y  GK ++ T+ ++ ++CK     L +I+++   +++ +L+  S  +   +W+     S    +  +D   +SY+NW   EP  Y+  E C +     G+ WND+ C+ L   ICQ IQ  K         P  N               +Y S EK     AR FC      +  I + S+      Y  K+     +  G   + +  ++     K+ +  W + EP+    +   V++   +G W+D +C   N+ IC+  N +                K G+H+               K  +  A + C+  K  LV I+  Q    V Y++   TFN    W   ND   E  +  +    + +  W K  P G R      + +C   I GN+ +   W D+ C S    ICQ                   + YG S Y + K K  + +   YCK     L  I D   N F + + +       WI  N N   NE  W  TD   + Y NW   +P    K  C+   Y   DG W    C+     +C+
Sbjct:  524 TFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMP--GRKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKGKHEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLITSSGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQ-IQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEPNFANDDENCVTMYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFVTYHMRDSTFNA---WTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAW-MKMHPFNVPIWIALNSNLTNNEYTW--TDRWRVRYTNWGADEPK--LKSACV---YMDVDGYWRTSYCNESFYFLCK 1212          

HSP 3 Score: 103.99 bits (258), Expect = 6.793e-22
Identity = 131/588 (22.28%), Postives = 223/588 (37.93%), Query Frame = -3
Query:  513 EFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGN------------DLIKEGNWVDSNNNKLSYTNWHYQEPD-GGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNK----------------YHIGK------------DRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQG------YRKENCIQGL----RINGLWNDVTCDSLGEVICQ-------PIQNKKRPSSNSLFYSSTE------KMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWI--DGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNG-------------------------FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQV-YNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ-PIKYGPSKYHISKSKR 1997
            ++ Y++++EK T  +A  +C     +L TI +E+  K +          W +IN N             + K+  W+D   +K+ +  W   EP+     ENC+ ++    GFWND+ C  PN+ IC+    + N                 +H+ K            ++ ++ DA   CK     L++IEN +  +       +   F+ W   ND + E ++L T  + + Y NW    P G      Y   +C+  +    R  G W D TCDS    ICQ       P+     P    + Y  +       K+    A  +C +    +  I +   N  A       N+   WI  +   + NE  W D    ++ Y NW + EP   K ++  V + D +G W  ++C      +C+  ++                             +  +S    +  A   C      LV I+    ++ + Y +    +   +WI G     EG+W     N +SF  W   +P G RN+  +  ++    LWN+  C S    IC+ P    P   H S + +
Sbjct:  809 DYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFL----------WKYINKNGGQSPYFIGMLISMDKKFIWMD--GSKVDFVAWATGEPNFANDDENCV-TMYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIEN-AQEQAFVTYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAWMKMHPFNVP-IWIALNSNLTNNEYTWTD--RWRVRYTNWGADEP---KLKSACVYM-DVDGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASLECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWI-GMFRNVEGKWLWLNDNPVSFVNWKTGDPSGERNDCVVLASS--SGLWNNIHCSSYKGFICKMPKIIDPVTTHSSITTK 1372          

HSP 4 Score: 83.1889 bits (204), Expect = 1.325e-15
Identity = 83/394 (21.07%), Postives = 142/394 (36.04%), Query Frame = -3
Query:  183 AREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSV-------------------------KMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEP--KGGRNENCITGNNYQDALWNDEKCGSLNSVICQPI--------------------KYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCI-QGLYFSDGTWNDVKCDMKNKVICELKVEKL 1220
            AR  C  +N  ++ +    +  + +T    S  S  WI     +    W         Y NW    P     ++C       N  W++  C      IC+  N+T N F I S                          K     A++ CR +  +L  I   +  + +++          WI  ND + +  +E S    ++F KW   EP  +  R E+C+     +D  W D  C      IC+ +                    ++G   Y I  +   + D    C ++K  L  + D  +  F+  L        FW   +DV N+G +  T +E + + +WN   P  G+K  C+      + G W+ + C+ K K +C+   E +
Sbjct:  243 ARASCKQQNADLLSVTEIHEQ-MYLTGLTSSLSSGLWIGLNSLSVRSGWQWAGGSPFRYLNWLPGSPSSEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNNTLNPFIIPSASDVPTGCPNQWWPYAGHCYRIHREEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCVVMKG-KDGYWADRACEQPLGYICKMVSQSHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMP--GRKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKHWAEGV 632          

HSP 5 Score: 48.1358 bits (113), Expect = 5.440e-12
Identity = 38/120 (31.67%), Postives = 57/120 (47.50%), Query Frame = -3
Query: 2292 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYS--KEGSWVDSRNVSLQFKKWYQGEPN-GGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2642
            + +Y Y  ++E  T D A  FC +    L TIK+E   K ++         + +  G   S  K+  W+D   V   F  W  GEPN     ENC+  +  ++ FWND+NC + N  IC+
Sbjct:  807 YKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKV--DFVAWATGEPNFANDDENCVT-MYTNSGFWNDINCGYPNNFICQ 923          

HSP 6 Score: 43.5134 bits (101), Expect = 5.440e-12
Identity = 36/117 (30.77%), Postives = 55/117 (47.01%), Query Frame = -2
Query: 2650 QKMAYTTAVSFCKEQNMELLTIKNGIINK---RVFNMAIKYKIGYYWIDGNDNGMEGY-WVDSKSNPMQYQNWKSGEPNGKRQ-ENCVHGLYYPAGLWNDISCNTPNSVICQKKKTK 2985
            +K  +  +  FCK    EL +IK+    +   R+   +  Y   ++      +  EG+ W D   +P+ Y+NW  GEPN  +  E C      P   WNDI+C   N+ ICQ +K K
Sbjct:  669 EKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLITSSGSYHELFWLGLTYGSPSEGFTWSDG--SPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGK 783          

HSP 7 Score: 58.5362 bits (140), Expect = 5.712e-8
Identity = 41/135 (30.37%), Postives = 59/135 (43.70%), Query Frame = -2
Query: 2662 IIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIK--------------NGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPN-GKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3021
            +I  DY Y  + +K     A +FCK+   +L TIK              NG  +     M I     + W+DG+               + +  W +GEPN     ENCV  +Y  +G WNDI+C  PN+ ICQ+
Sbjct:  805 VIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSK--------------VDFVAWATGEPNFANDDENCVT-MYTNSGFWNDINCGYPNNFICQR 924          

HSP 8 Score: 40.4318 bits (93), Expect = 6.363e-7
Identity = 25/107 (23.36%), Postives = 50/107 (46.73%), Query Frame = -2
Query: 2662 MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGY-YWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 2979
            + +  A + CK+QN +LL++    I+++++   +   +    WI  N   +   W  +  +P +Y NW  G P+ +  ++CV         W ++ C      IC+K
Sbjct:  238 LTWHQARASCKQQNADLLSVTE--IHEQMYLTGLTSSLSSGLWIGLNSLSVRSGWQWAGGSPFRYLNWLPGSPSSEPGKSCVSLNPGKNAKWENLECVQKLGYICKK 342          

HSP 9 Score: 33.8834 bits (76), Expect = 6.363e-7
Identity = 29/117 (24.79%), Postives = 52/117 (44.44%), Query Frame = -3
Query: 2271 EEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPN--GGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPA 2615
            EE      A++ C ++   L +I + +    +F+   Y      WI  ND   +  +  S    + F KW  GEP+    R+E+C+  ++  + +W D  C      IC+ + +S A
Sbjct:  379 EEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCVV-MKGKDGYWADRACEQPLGYICKMVSQSHA 494          
BLAST of SMED30004599 vs. Ensembl Mouse
Match: Mrc2 (mannose receptor, C type 2 [Source:MGI Symbol;Acc:MGI:107818])

HSP 1 Score: 92.8189 bits (229), Expect = 1.451e-18
Identity = 130/699 (18.60%), Postives = 257/699 (36.77%), Query Frame = -3
Query:  201 MTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECD---------QPNSVI--CEPMRHTTNK--------------YHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRK--ENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPS--------------SNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNS-VICE-----PINDTKNGFHITSV-----------------------------KMKFDTAVKYCRNKKMELVKIDG-------DQMNNQVYNLSVTFNLGRYW----INGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC---------QP----------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALK---SKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNG-GKKENCIQGLYFSDGTWNDVKCDMKNKVICE 1967
            ++++ A   C  Q  +L++I        ++ L   Y+    WI  NDL   G W  S+N+ L Y NW   +PD    ENC      + G W + +C          +PN+ +   +P R T  K              Y +  ++ ++ ++   C +    L++I + +  + + K +K+ ++ + W+  ND   +  +  +D   +S+ +WHP EP  +R   E+C+      G WND  C+     IC+      + +              S S ++   +++    AR  C +   ++V I N  +     +        YFW    D  + G++      ++ Y +W   +P   +    A++   A GLW+  +C S  +  IC      P+     G   T                               K  +  A+  CR    +L+ +           M N+++  S   +  ++W    +N  D R+   W  S     S+  + +S         C    +     W   +C +    IC         +P          +++  ++Y   +   ++    + C   +  L  +    +  F+     K    +   +WI  + + ++G +  TD   + +++W   +P   GK + C+  +      W D +C      IC+
Sbjct:  256 LSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSST-LWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITKQIKQEVE-ELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQPGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIQALGVCRELGAQLLSLASYEEEHFVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSRHDDDDIRGCAV-LDLASLQWVPMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLSSDQEQHWWIGLHTLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVY-MTARQEDWGDQRCHTALPYICK 950          

HSP 2 Score: 55.8398 bits (133), Expect = 1.173e-9
Identity = 35/119 (29.41%), Postives = 58/119 (48.74%), Query Frame = -2
Query: 2659 TDYGYVVNLQK-MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKK 3012
            TD  Y  N Q  +++  A + C++Q  +LL+I   I  +   N  +       WI  ND    G W  S ++P++Y NW+S +P+   +ENC       +G W +  C+     +C+KK
Sbjct:  244 TDSCYQFNFQSTLSWREAWASCEQQGADLLSITE-IHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKK 361          

HSP 3 Score: 28.1054 bits (61), Expect = 1.173e-9
Identity = 30/123 (24.39%), Postives = 50/123 (40.65%), Query Frame = -3
Query: 2292 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKN----EKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRK--ENCIHGLRYDNEFWNDVNCFHKNMVICE 2642
            F  + Y +  E  ++ E+ + C      LL+I +    E I K++        +   WI  ND   + ++  S    + F  W+  EPN  R   E+C+     +   WND  C      IC+
Sbjct:  388 FQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITKQIKQ-----EVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGR-WNDSPCNQSLPSICK 504          

HSP 4 Score: 63.1586 bits (152), Expect = 1.742e-9
Identity = 65/310 (20.97%), Postives = 120/310 (38.71%), Query Frame = -3
Query:  201 WYSTEPDGGKTEN---CAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVY-NLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC-----------QPIKYGPSK--------------YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKK--ENCIQGLYFSDGTWNDVKCDMKNKVICE 1037
            W +T  D GK E    C +   D    WD            + + D+   F+  S  + +  A   C  +  +L+ I   +++ Q Y N  +T      WI  ND    G W+ S  + L +  W   +P     ENC          W +  C      +C           QP ++   K              Y +   KR++++  + C      L+ I    + +F+    +K ++   WI  ND+  + ++  +D   +++ +W+  +PN  +   E+C+  ++  +G WND  C+     IC+
Sbjct:  211 WCATTQDYGKDERWGFCPIKSNDCETFWDK-----------DQLTDSCYQFNFQST-LSWREAWASCEQQGADLLSIT--EIHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICK 504          

HSP 5 Score: 57.3806 bits (137), Expect = 1.117e-7
Identity = 32/110 (29.09%), Postives = 52/110 (47.27%), Query Frame = -3
Query:  195 KSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELK 524
            +S  ++++    C+ +   L+ IT+  +  ++  L L     T WI  ND+   G W  +DN  L YLNW   QP+   +ENC      S G W +  C +    +C+ K
Sbjct:  253 QSTLSWREAWASCEQQGADLLSITEIHEQTYINGL-LTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKK 361          
BLAST of SMED30004599 vs. Ensembl Mouse
Match: Mrc2 (mannose receptor, C type 2 [Source:MGI Symbol;Acc:MGI:107818])

HSP 1 Score: 92.0485 bits (227), Expect = 2.621e-18
Identity = 130/699 (18.60%), Postives = 257/699 (36.77%), Query Frame = -3
Query:  201 MTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECD---------QPNSVI--CEPMRHTTNK--------------YHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRK--ENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPS--------------SNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNS-VICE-----PINDTKNGFHITSV-----------------------------KMKFDTAVKYCRNKKMELVKIDG-------DQMNNQVYNLSVTFNLGRYW----INGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC---------QP----------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALK---SKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNG-GKKENCIQGLYFSDGTWNDVKCDMKNKVICE 1967
            ++++ A   C  Q  +L++I        ++ L   Y+    WI  NDL   G W  S+N+ L Y NW   +PD    ENC      + G W + +C          +PN+ +   +P R T  K              Y +  ++ ++ ++   C +    L++I + +  + + K +K+ ++ + W+  ND   +  +  +D   +S+ +WHP EP  +R   E+C+      G WND  C+     IC+      + +              S S ++   +++    AR  C +   ++V I N  +     +        YFW    D  + G++      ++ Y +W   +P   +    A++   A GLW+  +C S  +  IC      P+     G   T                               K  +  A+  CR    +L+ +           M N+++  S   +  ++W    +N  D R+   W  S     S+  + +S         C    +     W   +C +    IC         +P          +++  ++Y   +   ++    + C   +  L  +    +  F+     K    +   +WI  + + ++G +  TD   + +++W   +P   GK + C+  +      W D +C      IC+
Sbjct:  256 LSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSST-LWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITKQIKQEVE-ELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQPGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIQALGVCRELGAQLLSLASYEEEHFVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSRHDDDDIRGCAV-LDLASLQWVPMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLSSDQEQHWWIGLHTLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVY-MTARQEDWGDQRCHTALPYICK 950          

HSP 2 Score: 56.225 bits (134), Expect = 6.581e-10
Identity = 35/119 (29.41%), Postives = 58/119 (48.74%), Query Frame = -2
Query: 2659 TDYGYVVNLQK-MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKK 3012
            TD  Y  N Q  +++  A + C++Q  +LL+I   I  +   N  +       WI  ND    G W  S ++P++Y NW+S +P+   +ENC       +G W +  C+     +C+KK
Sbjct:  244 TDSCYQFNFQSTLSWREAWASCEQQGADLLSITE-IHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKK 361          

HSP 3 Score: 28.1054 bits (61), Expect = 6.581e-10
Identity = 33/125 (26.40%), Postives = 50/125 (40.00%), Query Frame = -3
Query: 2292 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKN----EKINKRVFNIAVYYNLGTYWITGNDYSKEG--SWVDSRNVSLQFKKWYQGEPNGGRK--ENCIHGLRYDNEFWNDVNCFHKNMVICE 2642
            F  + Y +  E  ++ E+ + C      LL+I +    E I K++        +   WI  ND   +    W D   VS  F  W+  EPN  R   E+C+     +   WND  C      IC+
Sbjct:  388 FQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITKQIKQ-----EVEELWIGLNDLKLQMNFEWSDGSLVS--FTHWHPFEPNNFRDSLEDCVTIWGPEGR-WNDSPCNQSLPSICK 504          

HSP 4 Score: 63.1586 bits (152), Expect = 1.967e-9
Identity = 65/310 (20.97%), Postives = 122/310 (39.35%), Query Frame = -3
Query:  201 WYSTEPDGGKTEN---CAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVY-NLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC--------QPIK--------------YGPSK---YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKK--ENCIQGLYFSDGTWNDVKCDMKNKVICE 1037
            W +T  D GK E    C +   D    WD            + + D+   F+  S  + +  A   C  +  +L+ I   +++ Q Y N  +T      WI  ND    G W+ S  + L +  W   +P     ENC          W +  C      +C        +PI+              + P +   Y +   KR++++  + C      L+ I    + +F+    +K ++   WI  ND+  + ++  +D   +++ +W+  +PN  +   E+C+  ++  +G WND  C+     IC+
Sbjct:  211 WCATTQDYGKDERWGFCPIKSNDCETFWDK-----------DQLTDSCYQFNFQST-LSWREAWASCEQQGADLLSIT--EIHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICK 504          

HSP 5 Score: 57.7658 bits (138), Expect = 9.508e-8
Identity = 32/110 (29.09%), Postives = 52/110 (47.27%), Query Frame = -3
Query:  195 KSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELK 524
            +S  ++++    C+ +   L+ IT+  +  ++  L L     T WI  ND+   G W  +DN  L YLNW   QP+   +ENC      S G W +  C +    +C+ K
Sbjct:  253 QSTLSWREAWASCEQQGADLLSITEIHEQTYINGL-LTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKK 361          
BLAST of SMED30004599 vs. Ensembl Mouse
Match: Clec3a (C-type lectin domain family 3, member a [Source:MGI Symbol;Acc:MGI:2685642])

HSP 1 Score: 70.4774 bits (171), Expect = 3.638e-13
Identity = 39/133 (29.32%), Postives = 68/133 (51.13%), Query Frame = -3
Query:  192 SLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGT--FWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKV 584
            +L +V  +  K     Y  S+  ++Y +  + C SK  +LV   +  +   + D   +S  G   FW+  ND+  EG ++D    ++++LNW+  QP+GGK+ENC+     + G W+D  C    + ICE  +
Sbjct:   63 ALQTVCLRGTKVHKKCYLASEGLKHYHEANEDCISKGGTLVVPRNSDEINALRDYGKRSLPGVNDFWLGINDMVTEGKFLDVHGFAVSFLNWDRAQPSGGKRENCVLFSQSAQGKWSDEACRSSKRYICEFII 195          

HSP 2 Score: 63.1586 bits (152), Expect = 1.073e-10
Identity = 37/134 (27.61%), Postives = 61/134 (45.52%), Query Frame = -3
Query: 1653 KEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQY--NIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE 2048
            KEM  +  V  +     +  Y  +     Y  A + C+++   LV   N      + D   +    ++ +W+  ND++ EG ++D +   +S+ NW   +P GGKRENC+     A G W+D  C      ICE
Sbjct:   59 KEMQALQTVCLRGTKVHKKCYLASEGLKHYHEANEDCISKGGTLVVPRNSDEINALRDYGKRSLPGVNDFWLGINDMVTEGKFLDVHGFAVSFLNWDRAQPSGGKRENCVLFSQSAQGKWSDEACRSSKRYICE 192          

HSP 3 Score: 59.3066 bits (142), Expect = 2.142e-9
Identity = 33/104 (31.73%), Postives = 50/104 (48.08%), Query Frame = -3
Query:  915 AREFCANRNMRIVKIDNASKNDLAMTYAIKS--NLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPI 1220
            A E C ++   +V   N+ + +    Y  +S   ++ FW+   D   EG ++D     +S+ NW   +P GGK ENC +    A G W D  C+S    ICE I
Sbjct:   91 ANEDCISKGGTLVVPRNSDEINALRDYGKRSLPGVNDFWLGINDMVTEGKFLDVHGFAVSFLNWDRAQPSGGKRENCVLFSQSAQGKWSDEACRSSKRYICEFI 194          

HSP 4 Score: 55.4546 bits (132), Expect = 5.063e-8
Identity = 33/114 (28.95%), Postives = 56/114 (49.12%), Query Frame = -3
Query: 2292 YLINEEIMTYDEAVKFCGEKNLRLLTIKN-EKINK-RVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2627
            YL +E +  Y EA + C  K   L+  +N ++IN  R +       +  +W+  ND   EG ++D    ++ F  W + +P+GG++ENC+   +     W+D  C      ICE
Sbjct:   79 YLASEGLKHYHEANEDCISKGGTLVVPRNSDEINALRDYGKRSLPGVNDFWLGINDMVTEGKFLDVHGFAVSFLNWDRAQPSGGKRENCVLFSQSAQGKWSDEACRSSKRYICE 192          

HSP 5 Score: 52.373 bits (124), Expect = 4.662e-7
Identity = 23/67 (34.33%), Postives = 36/67 (53.73%), Query Frame = -3
Query:  555 YWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPI 755
            +W+  ND   EG++ D     +SF  W +++P GG+ ENC+  +      W+DE C S    IC+ I
Sbjct:  128 FWLGINDMVTEGKFLDVHGFAVSFLNWDRAQPSGGKRENCVLFSQSAQGKWSDEACRSSKRYICEFI 194          

HSP 6 Score: 48.9062 bits (115), Expect = 7.758e-6
Identity = 20/65 (30.77%), Postives = 34/65 (52.31%), Query Frame = -2
Query: 2665 YWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQ 2859
            +W+  ND   EG ++D     + + NW   +P+G ++ENCV       G W+D +C +    IC+
Sbjct:  128 FWLGINDMVTEGKFLDVHGFAVSFLNWDRAQPSGGKRENCVLFSQSAQGKWSDEACRSSKRYICE 192          
BLAST of SMED30004599 vs. Ensembl Mouse
Match: Colec10 (collectin sub-family member 10 [Source:MGI Symbol;Acc:MGI:3606482])

HSP 1 Score: 68.9366 bits (167), Expect = 4.633e-12
Identity = 42/150 (28.00%), Postives = 73/150 (48.67%), Query Frame = -3
Query: 1653 YQKICGWME-------KEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLS-YTNWHYQEP-DGGKRENCIQSLVYADGFWNDVECDQPNSVICE 2075
            Y+K+ G ++         M  +  V+  ++ T E  Y+  +E+  Y+ ++ +C  +   L    +E  N L+ D   +      +I  NDL +EG +V ++N  L  Y+NW  +EP D    E+C++ L  + G WND EC      +CE
Sbjct:  124 YRKVVGQLDISVARLKTSMKFIKNVIAGIRETEEKFYYIVQEEKNYRESLTHCRIRGGMLAMPKDEVVNTLIADYVAKSGFFRVFIGVNDLEREGQYVFTDNTPLQNYSNWKEEEPSDPSGHEDCVEML--SSGRWNDTECHLTMYFVCE 271          

HSP 2 Score: 63.5438 bits (153), Expect = 2.328e-10
Identity = 36/115 (31.30%), Postives = 59/115 (51.30%), Query Frame = -3
Query:  198 YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLT-YLNWNIRQP-NGGKKENCIQGLYFSDGTWNDVKCDMKNKVICEL 536
            Y+I + ++NY++ + +C+ +   L    D+  N  + D   KS     +I  ND+  EG +V TDN  L  Y NW   +P +    E+C++ L  S G WND +C +    +CE 
Sbjct:  160 YYIVQEEKNYRESLTHCRIRGGMLAMPKDEVVNTLIADYVAKSGFFRVFIGVNDLEREGQYVFTDNTPLQNYSNWKEEEPSDPSGHEDCVEML--SSGRWNDTECHLTMYFVCEF 272          

HSP 3 Score: 51.6026 bits (122), Expect = 2.380e-6
Identity = 36/120 (30.00%), Postives = 59/120 (49.17%), Query Frame = -2
Query: 2647 YVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQ-YQNWKSGEPNGKR-QENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKK 3000
            Y+V  +K  Y  +++ C+ +   L   K+ ++N  + +   K      +I  ND   EG +V + + P+Q Y NWK  EP+     E+CV  L   +G WND  C+     +C+  K KK
Sbjct:  161 YIVQEEK-NYRESLTHCRIRGGMLAMPKDEVVNTLIADYVAKSGFFRVFIGVNDLEREGQYVFTDNTPLQNYSNWKEEEPSDPSGHEDCVEML--SSGRWNDTECHLTMYFVCEFVKKKK 277          

HSP 4 Score: 50.8322 bits (120), Expect = 4.347e-6
Identity = 38/129 (29.46%), Postives = 68/129 (52.71%), Query Frame = -3
Query: 1278 MRHTTNK-YHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEIS-YKNW---HPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKK 1649
            +R T  K Y+I ++   + +++ +C+ R  +L   ++E  N ++   V KS  F  ++  ND   EG ++ TDN  +  Y NW    P +P G+  E+C++ L  +G WND  C      +C+ ++ KK
Sbjct:  152 IRETEEKFYYIVQEEKNYRESLTHCRIRGGMLAMPKDEVVNTLIADYVAKSGFFRVFIGVNDLEREGQYVFTDNTPLQNYSNWKEEEPSDPSGH--EDCVEMLS-SGRWNDTECHLTMYFVCEFVKKKK 277          
BLAST of SMED30004599 vs. UniProt/SwissProt
Match: sp|P22897|MRC1_HUMAN (Macrophage mannose receptor 1 OS=Homo sapiens OX=9606 GN=MRC1 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.144e-26
Identity = 146/648 (22.53%), Postives = 247/648 (38.12%), Query Frame = -3
Query:  876 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYS--KEGSWVDSRNVSLQFKKWYQGEPN-GGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYAD--------------GFWNDVECDQPNSVICEP------------------MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVIC---------QPIQNKKR----------PSSNSLFYSSTEKMNNLAAREF-CANRNMRIVKIDNASKNDLAMTYAIKS--NLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE--PINDTKNGFHITSVK 2642
            + +Y Y  ++E  T D A  FC      L++I++E   K ++      +  + +  G   S  K+ +W+D   V   +  W  GEPN     ENC+  +  ++ FWND+NC + N               IC+      +NS I               T  +P   S          FY   C          KI G+ME+E                        +  ++ A K C+    NLV+I NE     +    ++ +    W   ND+  E  ++ ++   + YTNW    P GG+R     SL Y D              G W D  CD     IC+                   +++  + Y + + +  +++A  YCK  N ++ +I +  SN      ++ S +   W+  N N  +  +  TD   + Y NW   EP+   K  C+  L ++G W    C+     +C         +P Q   R          P     +Y  +    N       C      +V I++A+++   ++Y ++   + + FWI G     EG W+   +  +S+ NW + +P G +  N  V+L  ++G W + HC S    IC+   I D K    + + K
Sbjct:  807 YKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKV--DYVSWATGEPNFANEDENCVT-MYSNSGFWNDINCGYPNAF-------------ICQR-----HNSSI-------------NATTVMPTMPSVPSGCKEGWNFYSNKCF---------KIFGFMEEE------------------------RKNWQEARKACIGFGGNLVSIQNEKEQAFL-TYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYP-GGRR----SSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAWLQMETSNE-RVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPK--LKSACVY-LDLDGYWKTAHCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQASLECLRMGSSLVSIESAAESSF-LSYRVEPLKSKTNFWI-GLFRNVEGTWLWINNSPVSFVNWNTGDPSGER--NDCVALHASSGFWSNIHCSSYKGYICKRPKIIDAKPTHELLTTK 1373          

HSP 2 Score: 40.817 bits (94), Expect = 1.144e-26
Identity = 34/116 (29.31%), Postives = 55/116 (47.41%), Query Frame = -2
Query: 2656 QKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGY---YWIDGN-DNGMEGY-WVDSKSNPMQYQNWKSGEPNGKRQ-ENCVHGLYYPAGLWNDISCNTPNSVICQKKK 2985
            +K  +  +  FC+    +L +I N    + ++ + I     Y   +W+     +  EG+ W D   +P+ Y+NW  GEPN  +  E C      P   WNDI+C   N+ ICQ +K
Sbjct:  669 EKKTWFESRDFCRALGGDLASINNKEEQQTIWRL-ITASGSYHKLFWLGLTYGSPSEGFTWSDG--SPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQK 781          

HSP 3 Score: 119.013 bits (297), Expect = 1.024e-25
Identity = 163/724 (22.51%), Postives = 273/724 (37.71%), Query Frame = -3
Query:  195 EKMTYKSAVKYCLAQSMNLVTIDN-EATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEP--DGGKRENCIQSLVYADGFWNDVECDQPNSVICEPM--------------------RHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRIN---GLWNDVTCDSLGEVICQP-------------------IQNKKRPSSNSLFY-----SSTEKMNNLAAREFCANRNMRIVKIDNASKNDLA--MTYAIKSNLSYFWIDGT-DSANEG-NWVDYQDQKLSYKNWYSTEPDGGK-TENCAVSLTDANGLWDDAHCQSMNSVIC----------EPIND-------TKNG--------FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNR------------KEGQWEDSKQNLLSFKKWHKSEPK-GGRNENCITGNNYQDALWNDEKCGSLNSVICQ--------------------PIKYGPSKY---------HISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKE------NC---IQGLYFSDGTWNDVKCDMKNKVICELK 1973
            EK   + A+  C  +  +L +I   E  + ++  L  + N D  WI  ND+  +  +  S+   +++T W   EP  +  ++E+C+  +   DG+W D  C+ P   IC+                      +H    Y IG    TF +A   C   N  L  IE+      +   V    +  +W   +D   +G +  T  EE+ + +W+   P   RK  C+  +R     GLW+ + CD   + +C+                     ++    S  SL +        EK     +R+FC      +  I+N  +      +  A  S    FW+  T  S +EG  W D     +SY+NW   EP+  +  E C     D    W+D +C+ +N+ IC          EP          T++G        ++ +  K   D A  +C+    +LV I  +     ++           ++N ND +            K+  W D  +  + +  W   EP     +ENC+T  +     WND  CG  N+ ICQ                      K G + Y          + + ++N+++  K C     +LV I ++K+  F+    +K    + W   NDV +E  ++ TD   + Y NW    P G +        +C   I G     G W D  CD K   IC+ +
Sbjct:  380 EKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPN-DELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCV-VMKGKDGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPG--RKPGCV-AMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSD--GSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWK----------YVNRNDAQSAYFIGLLISLDKKFAWMDGSK--VDYVSWATGEPNFANEDENCVTMYS-NSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFL-TYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTR 1082          

HSP 4 Score: 106.301 bits (264), Expect = 7.827e-22
Identity = 136/694 (19.60%), Postives = 242/694 (34.87%), Query Frame = -3
Query:  201 TREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNK------------------------YHIGKDRMTFN-DAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEP--QGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPS--------------SNSLFYSSTEKMNNLA-AREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTD-ANGLWDDAHCQSMNSVICE------------------PINDTKNGFHITSVKMKFDTAVK-----------YCRNKKMELVKIDGDQMNNQVYNLSVTFNLGR--YWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNYQDALWNDEKCGSLNSVICQ-------------------PIK------YGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPN-GGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 1979
            ++  +T+  A K C  Q+  L++I        +  L+        WI  N L     W  S+ +   Y NW    P     ++C+      +  W ++EC Q    IC+    T N                         Y I +D      DA+  C+K    L +I        +   +      + W+  ND   +  +  +D   +++  W   EP  +  R+E+C+     +G W D  C+     IC+     + P                +   Y     ++  A A + C N N  +  I++  +     ++       YFW   +D   +G +    ++++ + +W S  P  G+   C    T  A GLWD   C      +C+                     +       TS+  K     K           +CR    +L  I+  +    ++ L          +W+          +  S  + +S++ W   EP   +N E C          WND  C  LN+ ICQ                   P+       Y   +Y+ SK K    +   +CK     LV I  + + KF++    ++   + +  G  ++ +  +   D   + Y++W   +PN   + ENC+  +Y + G WND+ C   N  IC+
Sbjct:  234 SKSALTWHQARKSCQQQNAELLSITEIHEQTYLTGLTSSLTSG-LWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVVMKGKDGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMP--GRKPGCVAMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVT-MYSNSGFWNDINCGYPNAFICQ 923          

HSP 5 Score: 102.449 bits (254), Expect = 1.131e-20
Identity = 140/702 (19.94%), Postives = 258/702 (36.75%), Query Frame = -3
Query:  201 TYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLV-YADGFWNDVECDQPNSVICEPMRHTTNK----------------------------YHIGK-DRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFD--YWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGL--WNDVTCDSLGEVICQPIQNKKRPSSNSL---------------------FYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPD-GGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVK----YCRNKKMELVKIDGDQ--------------------MNNQVYNLSVTFNLG----RYWINGNDNRKEGQ--WEDSKQNLLSFKKWHKSEPKGGR------NENC---ITGNNYQDALWNDEKCGSLNSVICQP------------------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFS-DGTWNDVKCDMKNKVICE 1964
            T+  A + C  ++  L TI++      +          ++W   +D+  +G +  +   ++ +T+W+   P  G++  C+      A G W+ ++CD+    +C+                                    Y  GK ++ T+ ++ ++C+     L +I N+   + + +L+  S  +   +W+     S    +  +D   +SY+NW   EP  Y+       L+ +    WND+ C+ L   ICQ IQ  + P                          +Y S EK     AR FC      +V I + S+      Y  +++    +  G   + +  +      K+ Y +W + EP+   + ENC V++   +G W+D +C   N+ IC+  N + N   +        +  K    +  NK  ++     ++                    + N+     +T+++       W   ND   E    W D +   + +  W K  P G R      + +C   I G + +   W D+ C S    ICQ                   +KYG S Y + + K  + +   YCK     +  I D   N F + L +++     WI  N    +  +  TD   + Y NW   +P    K  C+   Y   DG W    C+     +C+
Sbjct:  524 TFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMP--GRKPGCVAMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQ-IQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENC-VTMYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSNKCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFLTYHMKDSTFSAWTGLNDVNSEHTFLWTDGRG--VHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAW-LQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPK--LKSACV---YLDLDGYWKTAHCNESFYFLCK 1213          

HSP 6 Score: 57.7658 bits (138), Expect = 6.584e-7
Identity = 38/135 (28.15%), Postives = 59/135 (43.70%), Query Frame = -2
Query: 2662 IIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTI--------------KNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPN-GKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3021
            +I  DY Y  + +K     A +FCK    +L++I              +N   +     + I     + W+DG+               + Y +W +GEPN     ENCV  +Y  +G WNDI+C  PN+ ICQ+
Sbjct:  805 VIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSK--------------VDYVSWATGEPNFANEDENCVT-MYSNSGFWNDINCGYPNAFICQR 924          

HSP 7 Score: 56.9954 bits (136), Expect = 1.140e-6
Identity = 53/255 (20.78%), Postives = 102/255 (40.00%), Query Frame = -3
Query:  195 MKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNL-GRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ---------------------PIKYGPSKYHISKSKRNYK----DGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPN--GGKKENCIQGLYFSDGTWNDVKCDMKNKVICELK 875
            + +  A K C+ +  EL+ I   +++ Q Y   +T +L    WI  N       W+ S ++   +  W    P     ++C++ N  ++A W + +C      IC+                     P ++ P   H  K  R+ K    D +  C+ +   L  I   ++  F+            WI  ND+  + ++  +D   +T+  W   +P+    ++E+C+  +   DG W D  C+     IC++K
Sbjct:  238 LTWHQARKSCQQQNAELLSIT--EIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVV-MKGKDGYWADRGCEWPLGYICKMK 489          
BLAST of SMED30004599 vs. UniProt/SwissProt
Match: sp|Q61830|MRC1_MOUSE (Macrophage mannose receptor 1 OS=Mus musculus OX=10090 GN=Mrc1 PE=1 SV=2)

HSP 1 Score: 120.168 bits (300), Expect = 4.219e-26
Identity = 165/719 (22.95%), Postives = 282/719 (39.22%), Query Frame = -3
Query:  189 YTREKMTYKSAVKYCLAQSMNLVTIDN-EATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEP--DGGKRENCIQSLVYADGFWNDVECDQPNSVICEPM--------------------RHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCI--QGLRINGLWNDVTCDSLGEVICQP-------------------IQNKKRPSSNSLFY-----SSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSY---FWIDGT-DSANEG-NWVDYQDQKLSYKNWYSTEPDGGK-TENCAVSLTDANGLWDDAHCQSMNSVIC----------EPINDTKNG---------------FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGR--YWINGNDNR-KEGQWEDSKQNLLSFKKWHKSEPK-GGRNENCITGNNYQDALWNDEKCGSLNSVICQ--------------PIKYGPSK--YHISK------------SKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKE------NC---IQGLYFSDGTWNDVKCDMKNKVICELKVE 1982
            +  EK   K A++ C  +  +L +I + E  + +   L  + N D  WI  ND+  +  +  S+   +++T W   EP  +  ++E+C+  +   DG+W D  C+QP   IC+ +                    RH    Y IG    TF DA + C      L  +E+      +  LV    +  +W   +D   +G +  T +E++ + +W+   P   RK  C+  +     GLW+ ++C+   + +C+                     +N    S  S+ +        EK     +R+FC      +  I +  +  + +   I S+ SY   FW+  T  S +EG  W D     +SY+NW   EP+  +  E C     D    W+D +C+ +N+ IC          EP    ++                ++ +  K   D A  +C+    +L  I  +     ++   +  N G+  Y+I    +  K+  W D  +  + F  W   EP     +ENC+T        WND  CG  N+ ICQ              P   G  K  +H+ K             K++++D  + CK  K +LV I + ++  FV    ++      W   ND+  E  ++ T  + + Y NW    P G +        +C   I G     GTW D  CD K   IC+ + +
Sbjct:  377 HREEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQLGYEPN-DELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCV-VMKGKDGYWADRACEQPLGYICKMVSQSHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPG--RKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKGKHEKKTWFESRDFCKAIGGELASIKSKDEQQV-IWRLITSSGSYHELFWLGLTYGSPSEGFTWSD--GSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKY-INKNGGQSPYFIGMLISMDKKFIWMDGSK--VDFVAWATGEPNFANDDENCVTMYT-NSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFV-TYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTD 1083          

HSP 2 Score: 107.842 bits (268), Expect = 2.942e-22
Identity = 155/703 (22.05%), Postives = 265/703 (37.70%), Query Frame = -3
Query:  201 TYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLV-YADGFWNDVECDQPNSVICEPMRH---------------------TTNK-------YHIGK-DRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFD--YWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRK-ENCIQGLRINGL-WNDVTCDSLGEVICQPIQNKK--------RPSSNSL-------------FYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDT----------------KNGFHI------------TSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQV-YNL-SVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGR------NENC---ITGNNYQDALWNDEKCGSLNSVICQP------------------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWI--NGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFS-DGTWNDVKCDMKNKVICE 1964
            T+  A   C  +   L T+++      +  L       ++W   +D+  +G +  + + ++ +T+W+   P  G++  C+      A G W+ + C++    +C+                         TT+K       Y  GK ++ T+ ++ ++CK     L +I+++   +++ +L+  S  +   +W+     S    +  +D   +SY+NW   EP  Y+  E C +     G+ WND+ C+ L   ICQ IQ  K         P  N               +Y S EK     AR FC      +  I + S+      Y  K+     +  G   + +  ++     K+ +  W + EP+    +   V++   +G W+D +C   N+ IC+  N +                K G+H+               K  +  A + C+  K  LV I+  Q    V Y++   TFN    W   ND   E  +  +    + +  W K  P G R      + +C   I GN+ +   W D+ C S    ICQ                   + YG S Y + K K  + +   YCK     L  I D   N F + + +       WI  N N   NE  W  TD   + Y NW   +P    K  C+   Y   DG W    C+     +C+
Sbjct:  524 TFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMP--GRKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKGKHEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLITSSGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQ-IQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEPNFANDDENCVTMYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFVTYHMRDSTFNA---WTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAW-MKMHPFNVPIWIALNSNLTNNEYTW--TDRWRVRYTNWGADEPK--LKSACV---YMDVDGYWRTSYCNESFYFLCK 1212          

HSP 3 Score: 103.99 bits (258), Expect = 4.751e-21
Identity = 131/588 (22.28%), Postives = 223/588 (37.93%), Query Frame = -3
Query:  513 EFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGN------------DLIKEGNWVDSNNNKLSYTNWHYQEPD-GGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNK----------------YHIGK------------DRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQG------YRKENCIQGL----RINGLWNDVTCDSLGEVICQ-------PIQNKKRPSSNSLFYSSTE------KMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWI--DGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNG-------------------------FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQV-YNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ-PIKYGPSKYHISKSKR 1997
            ++ Y++++EK T  +A  +C     +L TI +E+  K +          W +IN N             + K+  W+D   +K+ +  W   EP+     ENC+ ++    GFWND+ C  PN+ IC+    + N                 +H+ K            ++ ++ DA   CK     L++IEN +  +       +   F+ W   ND + E ++L T  + + Y NW    P G      Y   +C+  +    R  G W D TCDS    ICQ       P+     P    + Y  +       K+    A  +C +    +  I +   N  A       N+   WI  +   + NE  W D    ++ Y NW + EP   K ++  V + D +G W  ++C      +C+  ++                             +  +S    +  A   C      LV I+    ++ + Y +    +   +WI G     EG+W     N +SF  W   +P G RN+  +  ++    LWN+  C S    IC+ P    P   H S + +
Sbjct:  809 DYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFL----------WKYINKNGGQSPYFIGMLISMDKKFIWMD--GSKVDFVAWATGEPNFANDDENCV-TMYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIEN-AQEQAFVTYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAWMKMHPFNVP-IWIALNSNLTNNEYTWTD--RWRVRYTNWGADEP---KLKSACVYM-DVDGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASLECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWI-GMFRNVEGKWLWLNDNPVSFVNWKTGDPSGERNDCVVLASS--SGLWNNIHCSSYKGFICKMPKIIDPVTTHSSITTK 1372          

HSP 4 Score: 83.1889 bits (204), Expect = 9.266e-15
Identity = 83/394 (21.07%), Postives = 142/394 (36.04%), Query Frame = -3
Query:  183 AREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSV-------------------------KMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEP--KGGRNENCITGNNYQDALWNDEKCGSLNSVICQPI--------------------KYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCI-QGLYFSDGTWNDVKCDMKNKVICELKVEKL 1220
            AR  C  +N  ++ +    +  + +T    S  S  WI     +    W         Y NW    P     ++C       N  W++  C      IC+  N+T N F I S                          K     A++ CR +  +L  I   +  + +++          WI  ND + +  +E S    ++F KW   EP  +  R E+C+     +D  W D  C      IC+ +                    ++G   Y I  +   + D    C ++K  L  + D  +  F+  L        FW   +DV N+G +  T +E + + +WN   P  G+K  C+      + G W+ + C+ K K +C+   E +
Sbjct:  243 ARASCKQQNADLLSVTEIHEQ-MYLTGLTSSLSSGLWIGLNSLSVRSGWQWAGGSPFRYLNWLPGSPSSEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNNTLNPFIIPSASDVPTGCPNQWWPYAGHCYRIHREEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCVVMKG-KDGYWADRACEQPLGYICKMVSQSHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMP--GRKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKHWAEGV 632          

HSP 5 Score: 48.1358 bits (113), Expect = 3.320e-11
Identity = 38/120 (31.67%), Postives = 57/120 (47.50%), Query Frame = -3
Query: 2292 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYS--KEGSWVDSRNVSLQFKKWYQGEPN-GGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2642
            + +Y Y  ++E  T D A  FC +    L TIK+E   K ++         + +  G   S  K+  W+D   V   F  W  GEPN     ENC+  +  ++ FWND+NC + N  IC+
Sbjct:  807 YKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKV--DFVAWATGEPNFANDDENCVT-MYTNSGFWNDINCGYPNNFICQ 923          

HSP 6 Score: 43.5134 bits (101), Expect = 3.320e-11
Identity = 36/117 (30.77%), Postives = 55/117 (47.01%), Query Frame = -2
Query: 2650 QKMAYTTAVSFCKEQNMELLTIKNGIINK---RVFNMAIKYKIGYYWIDGNDNGMEGY-WVDSKSNPMQYQNWKSGEPNGKRQ-ENCVHGLYYPAGLWNDISCNTPNSVICQKKKTK 2985
            +K  +  +  FCK    EL +IK+    +   R+   +  Y   ++      +  EG+ W D   +P+ Y+NW  GEPN  +  E C      P   WNDI+C   N+ ICQ +K K
Sbjct:  669 EKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLITSSGSYHELFWLGLTYGSPSEGFTWSDG--SPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGK 783          

HSP 7 Score: 58.5362 bits (140), Expect = 3.995e-7
Identity = 41/135 (30.37%), Postives = 59/135 (43.70%), Query Frame = -2
Query: 2662 IIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIK--------------NGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPN-GKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3021
            +I  DY Y  + +K     A +FCK+   +L TIK              NG  +     M I     + W+DG+               + +  W +GEPN     ENCV  +Y  +G WNDI+C  PN+ ICQ+
Sbjct:  805 VIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSK--------------VDFVAWATGEPNFANDDENCVT-MYTNSGFWNDINCGYPNNFICQR 924          

HSP 8 Score: 40.4318 bits (93), Expect = 3.884e-6
Identity = 25/107 (23.36%), Postives = 50/107 (46.73%), Query Frame = -2
Query: 2662 MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGY-YWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 2979
            + +  A + CK+QN +LL++    I+++++   +   +    WI  N   +   W  +  +P +Y NW  G P+ +  ++CV         W ++ C      IC+K
Sbjct:  238 LTWHQARASCKQQNADLLSVTE--IHEQMYLTGLTSSLSSGLWIGLNSLSVRSGWQWAGGSPFRYLNWLPGSPSSEPGKSCVSLNPGKNAKWENLECVQKLGYICKK 342          

HSP 9 Score: 33.8834 bits (76), Expect = 3.884e-6
Identity = 29/117 (24.79%), Postives = 52/117 (44.44%), Query Frame = -3
Query: 2271 EEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPN--GGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPA 2615
            EE      A++ C ++   L +I + +    +F+   Y      WI  ND   +  +  S    + F KW  GEP+    R+E+C+  ++  + +W D  C      IC+ + +S A
Sbjct:  379 EEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCVV-MKGKDGYWADRACEQPLGYICKMVSQSHA 494          
BLAST of SMED30004599 vs. UniProt/SwissProt
Match: sp|Q9UBG0|MRC2_HUMAN (C-type mannose receptor 2 OS=Homo sapiens OX=9606 GN=MRC2 PE=1 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 8.611e-18
Identity = 92/428 (21.50%), Postives = 170/428 (39.72%), Query Frame = -3
Query:  846 MTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECD---------QPNS--------------VICEP--MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRK--ENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPS--------------SNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNS-VICE-----PINDTKNGFHITSVKM-------KFDTAVKYC 1967
            ++++ A   C  Q  +L++I        ++ L   Y+    WI  NDL   G W  S+N+ L Y NW   +PD    ENC      + G W + +C          +PN+              V CEP       + Y +  ++ ++ ++   C +    L++I + +  + + K +K+ ++ + W+  ND   +  +  +D   +S+ +WHP EP  +R   E+C+      G WND  C+     IC+      + +              S S ++   +++    AR  C +   ++V I N  +     +        YFW    D  + G++      ++ Y +W   +P   +    A++   A GLW+  +C S  +  IC      P+     G   T             DT ++YC
Sbjct:  257 LSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSST-LWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITKQIKQEVE-ELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDTKLRYC 682          

HSP 2 Score: 65.4698 bits (158), Expect = 7.165e-16
Identity = 175/930 (18.82%), Postives = 308/930 (33.12%), Query Frame = -3
Query:  195 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFH-KNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEG--NWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVIC---------EP----------MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXX---XXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKE-NCIQGLRINGLWNDVTCDSLGEVIC------QPIQNKKRPSS-------------NSLFYSSTEKMNNLA----AREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSY-FWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGG-------KTENCAVSLTDAN----GLWDDAHC-QSMNSVICEPINDTK-------------------NG-FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWIN--GNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGS-LNSVICQPIKYGPSK-----YHISKSK----------------------RNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGT---FWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGK---KENCIQGLYFSDGTWNDVKC-DMKNKVICELK 2627
            Y + E+ +TY EA + C +   +L+TI N      V ++   +    +W    D +  GS+       + +  W + +P   R              W   NC   +   IC     +P  PE+               +  +  + W S T                      +YC   + +   Q    W++ +        Q+L   +     Y  E           +A  +N +  ++E      H         W+WI  N     G  +W  S+    SY N+     D      C   L  A   W  ++CD     IC         EP          +R    +Y   +   T+  A   C      L ++ +++         +   ++ +  +W+  + +  +G +  TD   I++ +W P +P+   K+  C+        W D  C +    IC      +  Q    P++             N  F    ++  +      A+  C  +  ++V I N  +   A   A   N+++  WI    S  +  WV+   + L Y NW   EP G        K  +CAV L   +    G WDD  C +  +  IC+   D                     NG F +    +++  A+  C ++   L  +  D         +        WI   G +  +   W    +  L++  W   EP+  +   C   +   D  W    C + L   +C  +  GP       YH S  +                        +K+  + C+    +++ I D+ +N FV++  L+S  G     W+  N     G  V  DN ++ Y NW    P  G      N    +  + G W    C ++   V+C+L 
Sbjct:  533 YWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGP-------DPTPSLTGSCPQGWASDTKL--------------------RYCYKVFSSERLQDKKSWVQAQG-----ACQELGAQLLSLASYEEEHF---------VANMLNKIFGESEPEIHEQH---------WFWIGLNRRDPRGGQSWRWSDGVGFSYHNFDRSRHDDDDIRGCA-VLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQ--AFITASLPNVTFDLWIGLHASQRDFQWVE--QEPLMYANWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAYVP-DPYTQAFLTQAARGLRTPLWIGLAGEEGSRRYSW--VSEEPLNYVGWQDGEPQ--QPGGCTYVD--VDGAWRTTSCDTKLQGAVCG-VSSGPPPPRRISYHGSCPQGLADSAWIPFREHCYSFHMELLLGHKEARQRCQRAGGAVLSILDEMENVFVWE-HLQSYEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWG--PPGLGPSMLSHNSCYWIQSNSGLWRPGACTNITMGVVCKLP 1396          

HSP 3 Score: 41.9726 bits (97), Expect = 7.165e-16
Identity = 30/115 (26.09%), Postives = 53/115 (46.09%), Query Frame = -2
Query: 2662 YVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQ--ENCVHGLYYPAGLWNDISCNTPNSVICQK 3000
            Y +  +K ++  +   C     +L++I + +         IK ++   WI  ND  ++  +  S  + + + +W   EPN  R   E+CV  ++ P G WND  CN     IC+K
Sbjct:  394 YRLQAEKRSWQESKKACLRGGGDLVSI-HSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCV-TIWGPEGRWNDSPCNQSLPSICKK 506          

HSP 4 Score: 83.1889 bits (204), Expect = 1.151e-14
Identity = 82/354 (23.16%), Postives = 129/354 (36.44%), Query Frame = -3
Query:  204 SYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVIC--------EPINDTK-----------------NGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN--ENCITGNNYQDALWNDEKCGSLNSVICQPIK-------------------YGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSD-GTWNDVKC-DMKNKVIC 1121
            S  WI   D    G W    +  L Y NW S +PD    ENC V  T+++G W +  C      +C        EP    +                 + + + + K  +  + K C     +LV I       +     +   +   WI  ND + +  +E S  +L+SF  WH  EP   R+  E+C+T     +  WND  C      IC+                      + PS Y + + +  Y +  + C      LV IT+  +  FV  L    +   FW    D+ + G +     + + Y +WN  QP G  +  C+     S  G W    C   + + IC
Sbjct:  294 STLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSIH-SMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWG-PEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFFWLSGDEVMYTHWNRDQP-GYSRGGCVALATGSAMGLWEVKNCTSFRARYIC 644          

HSP 5 Score: 56.6102 bits (135), Expect = 5.250e-9
Identity = 35/119 (29.41%), Postives = 58/119 (48.74%), Query Frame = -2
Query: 2659 TDYGYVVNLQK-MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKK 3012
            TD  Y  N Q  +++  A + C++Q  +LL+I   I  +   N  +       WI  ND    G W  S ++P++Y NW+S +P+   +ENC       +G W +  C+     +C+KK
Sbjct:  245 TDSCYQFNFQSTLSWREAWASCEQQGADLLSITE-IHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKK 362          

HSP 6 Score: 27.335 bits (59), Expect = 5.250e-9
Identity = 33/125 (26.40%), Postives = 50/125 (40.00%), Query Frame = -3
Query: 2292 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKN----EKINKRVFNIAVYYNLGTYWITGNDYSKEG--SWVDSRNVSLQFKKWYQGEPNGGRK--ENCIHGLRYDNEFWNDVNCFHKNMVICE 2642
            F  + Y +  E  ++ E+ K C      L++I +    E I K++        +   WI  ND   +    W D   VS  F  W+  EPN  R   E+C+     +   WND  C      IC+
Sbjct:  389 FQGHCYRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITKQIKQ-----EVEELWIGLNDLKLQMNFEWSDGSLVS--FTHWHPFEPNNFRDSLEDCVTIWGPEGR-WNDSPCNQSLPSICK 505          

HSP 7 Score: 63.929 bits (154), Expect = 7.803e-9
Identity = 66/310 (21.29%), Postives = 120/310 (38.71%), Query Frame = -3
Query:  201 WYSTEPDGGKTEN---CAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVY-NLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ-----------PIKYGPSK--------------YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKK--ENCIQGLYFSDGTWNDVKCDMKNKVICE 1037
            W +T  D GK E    C +   D    WD            + + D+   F+  S  + +  A   C  +  +L+ I   +++ Q Y N  +T      WI  ND    G W+ S  + L +  W   +P     ENC          W +  C      +C+           P ++   K              Y +   KR++++  K C      LV I    + +F+    +K ++   WI  ND+  + ++  +D   +++ +W+  +PN  +   E+C+  ++  +G WND  C+     IC+
Sbjct:  212 WCATTQDYGKDERWGFCPIKSNDCETFWDK-----------DQLTDSCYQFNFQST-LSWREAWASCEQQGADLLSIT--EIHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICK 505          
BLAST of SMED30004599 vs. UniProt/SwissProt
Match: sp|Q64449|MRC2_MOUSE (C-type mannose receptor 2 OS=Mus musculus OX=10090 GN=Mrc2 PE=1 SV=3)

HSP 1 Score: 92.0485 bits (227), Expect = 1.834e-17
Identity = 130/699 (18.60%), Postives = 257/699 (36.77%), Query Frame = -3
Query:  201 MTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECD---------QPNSVI--CEPMRHTTNK--------------YHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRK--ENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPS--------------SNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNS-VICE-----PINDTKNGFHITSV-----------------------------KMKFDTAVKYCRNKKMELVKIDG-------DQMNNQVYNLSVTFNLGRYW----INGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC---------QP----------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALK---SKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNG-GKKENCIQGLYFSDGTWNDVKCDMKNKVICE 1967
            ++++ A   C  Q  +L++I        ++ L   Y+    WI  NDL   G W  S+N+ L Y NW   +PD    ENC      + G W + +C          +PN+ +   +P R T  K              Y +  ++ ++ ++   C +    L++I + +  + + K +K+ ++ + W+  ND   +  +  +D   +S+ +WHP EP  +R   E+C+      G WND  C+     IC+      + +              S S ++   +++    AR  C +   ++V I N  +     +        YFW    D  + G++      ++ Y +W   +P   +    A++   A GLW+  +C S  +  IC      P+     G   T                               K  +  A+  CR    +L+ +           M N+++  S   +  ++W    +N  D R+   W  S     S+  + +S         C    +     W   +C +    IC         +P          +++  ++Y   +   ++    + C   +  L  +    +  F+     K    +   +WI  + + ++G +  TD   + +++W   +P   GK + C+  +      W D +C      IC+
Sbjct:  256 LSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSST-LWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITKQIKQEVE-ELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVIYTHWNRDQPGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIQALGVCRELGAQLLSLASYEEEHFVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSRHDDDDIRGCAV-LDLASLQWVPMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLSSDQEQHWWIGLHTLESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVY-MTARQEDWGDQRCHTALPYICK 950          

HSP 2 Score: 56.225 bits (134), Expect = 4.017e-9
Identity = 35/119 (29.41%), Postives = 58/119 (48.74%), Query Frame = -2
Query: 2659 TDYGYVVNLQK-MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKK 3012
            TD  Y  N Q  +++  A + C++Q  +LL+I   I  +   N  +       WI  ND    G W  S ++P++Y NW+S +P+   +ENC       +G W +  C+     +C+KK
Sbjct:  244 TDSCYQFNFQSTLSWREAWASCEQQGADLLSITE-IHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKK 361          

HSP 3 Score: 28.1054 bits (61), Expect = 4.017e-9
Identity = 33/125 (26.40%), Postives = 50/125 (40.00%), Query Frame = -3
Query: 2292 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKN----EKINKRVFNIAVYYNLGTYWITGNDYSKEG--SWVDSRNVSLQFKKWYQGEPNGGRK--ENCIHGLRYDNEFWNDVNCFHKNMVICE 2642
            F  + Y +  E  ++ E+ + C      LL+I +    E I K++        +   WI  ND   +    W D   VS  F  W+  EPN  R   E+C+     +   WND  C      IC+
Sbjct:  388 FQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITKQIKQ-----EVEELWIGLNDLKLQMNFEWSDGSLVS--FTHWHPFEPNNFRDSLEDCVTIWGPEGR-WNDSPCNQSLPSICK 504          

HSP 4 Score: 63.1586 bits (152), Expect = 1.376e-8
Identity = 65/310 (20.97%), Postives = 122/310 (39.35%), Query Frame = -3
Query:  201 WYSTEPDGGKTEN---CAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVY-NLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC--------QPIK--------------YGPSK---YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKK--ENCIQGLYFSDGTWNDVKCDMKNKVICE 1037
            W +T  D GK E    C +   D    WD            + + D+   F+  S  + +  A   C  +  +L+ I   +++ Q Y N  +T      WI  ND    G W+ S  + L +  W   +P     ENC          W +  C      +C        +PI+              + P +   Y +   KR++++  + C      L+ I    + +F+    +K ++   WI  ND+  + ++  +D   +++ +W+  +PN  +   E+C+  ++  +G WND  C+     IC+
Sbjct:  211 WCATTQDYGKDERWGFCPIKSNDCETFWDK-----------DQLTDSCYQFNFQST-LSWREAWASCEQQGADLLSIT--EIHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMAELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICK 504          

HSP 5 Score: 57.7658 bits (138), Expect = 6.651e-7
Identity = 32/110 (29.09%), Postives = 52/110 (47.27%), Query Frame = -3
Query:  195 KSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELK 524
            +S  ++++    C+ +   L+ IT+  +  ++  L L     T WI  ND+   G W  +DN  L YLNW   QP+   +ENC      S G W +  C +    +C+ K
Sbjct:  253 QSTLSWREAWASCEQQGADLLSITEIHEQTYINGL-LTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKK 361          
BLAST of SMED30004599 vs. UniProt/SwissProt
Match: sp|Q4TU93|MRC2_RAT (C-type mannose receptor 2 OS=Rattus norvegicus OX=10116 GN=Mrc2 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 8.528e-17
Identity = 129/699 (18.45%), Postives = 257/699 (36.77%), Query Frame = -3
Query:  201 MTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECD---------QPNS--------------VICEP--MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRK--ENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPS--------------SNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNS-VICE-----PINDTKNGFHITSV-----------------------------KMKFDTAVKYCRNKKMELVKIDGDQ-------MNNQVYNLSVTFNLGRYW----INGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC---------QP----------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALK---SKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNG-GKKENCIQGLYFSDGTWNDVKCDMKNKVICE 1967
            ++++ A   C  Q  +L++I        ++ L   Y+    WI  NDL   G W  S+N+ L Y NW   +PD    ENC      + G W + +C          +PN+              V C+P       + Y +  ++ ++ ++   C +    L++I + +  + + K +K+ ++ + W+  ND   +  +  +D   +S+ +WHP EP  +R   E+C+      G WND  C+     IC+      + +              S S ++   +++    AR  C +   ++V I N  +     +        YFW    D  + G++      ++ Y +W   +P   +    A++   A GLW+  +C S  +  IC      P+     G   T                               K  +  A+  CR    +L+ +   +       M N+++  S   N  ++W    +N  D R+   W  S     S+  + +S+        C    +     W   +C +    IC         +P          +++  ++Y   +   ++    + C   +  L  +    +  F+     K    +   +WI  +   ++G +  +D   + +++W   +P   GK + C+  +      W D +C      IC+
Sbjct:  256 LSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSST-LWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATAEPIQPDRWANVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMTELEFITKQIKQEVE-ELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGRLSQGTAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEVMYTHWNRDQPGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIEALGVCRELGAQLLSLASYEEEHFVANMLNKIFGESEPENHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSQHDDDNIRGCAV-LDLASLQWVAMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFEHHSSWAQAQRICTWFQAELTSVHSQAELDFLGQNMQKLSSDQEQHWWIGLHTSESDGRFRWSDGSVINFVSWAPGKPRPIGKDKKCVY-MTARQEDWGDQRCHTALPYICK 950          

HSP 2 Score: 56.225 bits (134), Expect = 5.833e-9
Identity = 35/119 (29.41%), Postives = 58/119 (48.74%), Query Frame = -2
Query: 2659 TDYGYVVNLQK-MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKK 3012
            TD  Y  N Q  +++  A + C++Q  +LL+I   I  +   N  +       WI  ND    G W  S ++P++Y NW+S +P+   +ENC       +G W +  C+     +C+KK
Sbjct:  244 TDSCYQFNFQSTLSWREAWASCEQQGADLLSITE-IHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKK 361          

HSP 3 Score: 28.1054 bits (61), Expect = 5.833e-9
Identity = 33/125 (26.40%), Postives = 50/125 (40.00%), Query Frame = -3
Query: 2292 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKN----EKINKRVFNIAVYYNLGTYWITGNDYSKEG--SWVDSRNVSLQFKKWYQGEPNGGRK--ENCIHGLRYDNEFWNDVNCFHKNMVICE 2642
            F  + Y +  E  ++ E+ + C      LL+I +    E I K++        +   WI  ND   +    W D   VS  F  W+  EPN  R   E+C+     +   WND  C      IC+
Sbjct:  388 FQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMTELEFITKQIKQ-----EVEELWIGLNDLKLQMNFEWSDGSLVS--FTHWHPFEPNNFRDSLEDCVTIWGPEGR-WNDSPCNQSLPSICK 504          

HSP 4 Score: 63.5438 bits (153), Expect = 9.892e-9
Identity = 65/310 (20.97%), Postives = 120/310 (38.71%), Query Frame = -3
Query:  201 WYSTEPDGGKTEN---CAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVY-NLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC-----------QPIKYGPSK--------------YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKK--ENCIQGLYFSDGTWNDVKCDMKNKVICE 1037
            W +T  D GK E    C +   D    WD            + + D+   F+  S  + +  A   C  +  +L+ I   +++ Q Y N  +T      WI  ND    G W+ S  + L +  W   +P     ENC          W +  C      +C           QP ++   K              Y +   KR++++  + C      L+ I    + +F+    +K ++   WI  ND+  + ++  +D   +++ +W+  +PN  +   E+C+  ++  +G WND  C+     IC+
Sbjct:  211 WCATTQDYGKDERWGFCPIKSNDCETFWDK-----------DQLTDSCYQFNFQST-LSWREAWASCEQQGADLLSIT--EIHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKKPNATAEPIQPDRWANVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIHSMTELEFITK-QIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICK 504          

HSP 5 Score: 57.7658 bits (138), Expect = 6.765e-7
Identity = 32/110 (29.09%), Postives = 52/110 (47.27%), Query Frame = -3
Query:  195 KSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELK 524
            +S  ++++    C+ +   L+ IT+  +  ++  L L     T WI  ND+   G W  +DN  L YLNW   QP+   +ENC      S G W +  C +    +C+ K
Sbjct:  253 QSTLSWREAWASCEQQGADLLSITEIHEQTYINGL-LTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKKK 361          
BLAST of SMED30004599 vs. TrEMBL
Match: Q8WSX2 (Lectin 1 (Fragment) OS=Girardia tigrina OX=6162 GN=lec1 PE=2 SV=1)

HSP 1 Score: 466.077 bits (1198), Expect = 7.423e-144
Identity = 270/688 (39.24%), Postives = 379/688 (55.09%), Query Frame = -3
Query:  198 TTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDG-GKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNK----YHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGY-RKENCIQGLRI-NGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAR---------------EFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEP-DGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPI-NDT-----------------KNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEP-KGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPS-------------------------------KYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQP-NGGKKENCIQGLYFSDGTWNDVKCDMKNKVICEL 2039
            + +  V +   N    GYH    KMT   A KYC  + M+LV I N+  N +V +L+ + N+  YWINGND  KEG WV +NN +L+Y NW   EP+  G  ++CI    + +GFW+D  CD  NSVICE  + T N     YH+G  +MTF+DAV YCK R M L+ I N S N IV  L  K+    YW+NGND  +EG W+ T+N E++YKNW   EP  +   ++CI G+   NG W+D  CD+   VIC+  +     ++    Y  T+    +  R               ++C ++ M +V+I NA  N+     A+K  +  +WI+G D   EG WV   +++L+YKNW S EP + G +++C V     NG WDD +C + N V+CE +  DT                 K  + + + KM FD AVKYC++ +M+LVKI     N  VYNL+V + +GRYWINGND  KEG W D+    L++K W   EP   G +++CI G  Y +  W+D  C + N+VIC+ +K G                                  Y +S +K  + D VKYCK K+M LV+IT+  +NKFVY+LA+K K+G +WINGND   EG WVDT+N+ LTY NW   +P N G  ++CI G Y+ +G W+D  CD KN+VICEL
Sbjct:    5 SVICEVPKDTDNDNNEGYHMGNTKMTSNDAAKYCKDRKMDLVRIPNKDVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGAYFPNGFWDDFNCDTKNSVICEVPKDTDNDNNEGYHMGNTKMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGVYFPNGFWDDFNCDTKNAVICEIAKGDTDDANEE--YEETDSTGKVVKRNYRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDDSNEEYEETDSTGKVVKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVICELVKGGSGTDEDNGDNGKVTEDSNEEYEEKDNNGKVVKRNYRVSNAKT-FDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVICEL 689          

HSP 2 Score: 444.506 bits (1142), Expect = 1.219e-135
Identity = 262/711 (36.85%), Postives = 380/711 (53.45%), Query Frame = -3
Query:  186 TTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDG-GKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTN------------------KYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGY-RKENCIQGLRI-NGLWNDVTCDSLGEVICQPIQNKKRPSSNSL-------------FYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEP-DGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPI-----NDTKNG--------------------------FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEP-KGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPS-------------------------KYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQP-NGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEK 2039
            + +  V +   N    GYH    KMT+  AVKYC  + M+LV I N + N +V +L+ + N+  YWINGND  KEG WV +NN +L+Y NW   EP+  G  ++CI  + + +GFW+D  CD  N+VICE  +  T+                   Y +   + TF+DAV YCK + M L+ I N  +N+ V  L  K     YW+NGND  +EG W+ T+N+E++YKNW   EP      ++CI G    NG W+D  CD+   V+C+ ++     S+                +  +  KM    A ++C +  M +VKI NA+ N      A+K  +  +WI+G D A EG WVD  +++L+YKNW S EP + G +++C V     NG WDD +C + N+VICE +      D  NG                          + +++ K  FD AVKYC++K+M+LV+I     N  VYNL+V + +GRYWINGND  KEG W D+    L++K W   EP   G +++CI G  Y +  W+D  C + N VIC+ ++                              Y I+ +K N+ D VKYCK K+M +V+I++ + N FV+ L+ K  LG +WINGND A +G WVDT+N+ L Y NW   +P NGG  ++CIQG Y+SDG W+D+ CD+K  VICE +  K
Sbjct:  130 SVICEVPKDTDNDNNEGYHMGNTKMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGVYFPNGFWDDFNCDTKNAVICEIAKGDTDDANEEYEETDSTGKVVKRNYRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDDSNEEYEETDSTGKVVKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVICELVKGGSGTDEDNGDNGKVTEDSNEEYEEKDNNGKVVKRNYRVSNAKT-FDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVICELVRGDTGTASGKGTDDSNNVIFKDNEGKVISINYQINNAKMNFDDAVKYCKDKQMDVVRISNAEINTFVFKLSEKYGLGKYWINGNDRAVDGTWVDTNNKELPYKNWQKGEPNNGGGVQHCIQGGYYSDGFWDDINCDVKISVICESRKSK 839          

HSP 3 Score: 320.087 bits (819), Expect = 8.990e-111
Identity = 235/737 (31.89%), Postives = 341/737 (46.27%), Query Frame = -3
Query:  555 VEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEP-NGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQS------TTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEP-DGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTN-------------------------KYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEP-QGYRKENCIQ-GLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWID-GTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMN--SVICEPINDTK---NGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEP-KGGRNENCITGNNYQDALWNDEKCGSLNSVICQPI 2639
            V+  Y +N   MT+D+AVK+C +  + L+ I N   N  V+N+AV Y +G YWI GND +KEG+WVD+ N  L +K W  GEP N G  ++CI G  Y N FW+D NC  KN VICE ++      E          N    K+ +++ + ++          R   VS +K+ D+        KYC                +K+M  V     ++ N           K  Y  AVKY + +                           YWINGND  KEG WVD+NN +L+Y NW   EP + G  ++CI    Y +GFW+D  CD  N VICE +R  T                           Y I   +M F+DAV YCK + M ++ I N   N  V KL +K     YW+NGND + +G W++T+N+E+ YKNW   EP  G   ++CIQ G   +G W+D+ CD    VIC+      R S +S     T+           AN  + ++  DN  K    +            ID GT+ +  G  +  +D+                               DD   +++N    +    ++TK     +H+T+ KM FD AVKYC++K+M+LVKI  +++N  V+  +  +NL  YW+NGND  KEG W D+  N+L++K W   EP   G N++C+ G+N  +  W    C  LNSV+C  I
Sbjct:  421 VKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVICELVKGGSGTDED---------NGDNGKVTEDSNEEYEEKDNNGKVVKRNYRVSNAKTFDDAV------KYCK---------------DKQMDLV-----RITNA-------DNNKFVYNLAVKYKIGR---------------------------YWINGNDREKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVICELVRGDTGTASGKGTDDSNNVIFKDNEGKVISINYQINNAKMNFDDAVKYCKDKQMDVVRISNAEINTFVFKLSEKYGLGKYWINGNDRAVDGTWVDTNNKELPYKNWQKGEPNNGGGVQHCIQGGYYSDGFWDDINCDVKISVICES-----RKSKDSSGKGDTD-----------ANNGLYVIIKDNEGKGTGKLV-----------IDKGTEDSTNGQILIIRDK-------------------------------DDKGSEALNYGKYVITKESETKVVSTSYHLTNAKMNFDDAVKYCKDKQMDLVKIPNEEVNAVVFKKAAKYNLETYWLNGNDRSKEGTWVDTDNNVLTYKNWSTGEPNNNGGNKHCLQGSNNLNGYWEASDCNGLNSVVCVRI 1030          

HSP 4 Score: 112.849 bits (281), Expect = 8.990e-111
Identity = 52/113 (46.02%), Postives = 75/113 (66.37%), Query Frame = -2
Query: 2665 YVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGK-RQENCVHGLYYPAGLWNDISCNTPNSVICQ 3000
            Y V+  K  +  AV +CK Q M+L+ I N   N+ V+N+A+KYKIG YWI+GND   EG WV + +  + Y+NW+SGEPN     ++C+ G YYP G W+D +C+T N V+C+
Sbjct:  286 YRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVCE 398          

HSP 5 Score: 374.785 bits (961), Expect = 1.070e-109
Identity = 216/539 (40.07%), Postives = 304/539 (56.40%), Query Frame = -3
Query:  198 DQPNSVICEPMRHTTNK----YHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYR-KENCIQGLRI-NGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDG-GKTENCAVSLTDANGLWDDAHCQSMNSVICE-PINDT-----------------KNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPK-GGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSK------------------YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQP-NGGKKENCIQGLYFSDGTWNDVKCDMKNKVICEL 1679
            D  NSVICE  + T N     YH+G  +MT NDA  YCK R M L+ I N+  N IV  L  K+    YW+NGND  +EG W+ T+N E++YKNW   EP  +   ++CI G    NG W+D  CD+   VIC+ +       +N  ++    KM    A ++C +R M +V+I N S N +    A K+NL  +WI+G D   EG WV   +++L+YKNW + EP+  G +++C + +   NG WDD +C + N+VICE    DT                 K  + +++ K  FD AVKYC+++ M+LV+I     N  VYNL+V + +GRYWINGND  KEG W  +    L++K W   EP   G +++CI G  Y +  W+D  C + N V+C+ +K                       Y ++ +K  + D VKYCK  +M LVKIT+  +N FVY+LA+K K+G +WINGND A EG WVDT+N+ LTY NW   +P N G  ++CI G Y+ +G W+D  CD KN VICEL
Sbjct:    1 DTKNSVICEVPKDTDNDNNEGYHMGNTKMTSNDAAKYCKDRKMDLVRIPNKDVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGAYFPNGFWDDFNCDTKNSVICE-VPKDTDNDNNEGYHMGNTKMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGVYFPNGFWDDFNCDTKNAVICEIAKGDTDDANEEYEETDSTGKVVKRNYRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDDSNEEYEETDSTGKVVKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVICEL 538          

HSP 6 Score: 113.235 bits (282), Expect = 1.011e-47
Identity = 56/123 (45.53%), Postives = 75/123 (60.98%), Query Frame = -3
Query: 2265 GYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNG-GRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADP 2630
            GY +    MT+D+AVK+C ++ + L+ I N  +N  VFN+A   NLG YWI GND  KEG+WV + N  L +K W  GEPN  G  ++CI G+ + N FW+D NC  KN VICE  +    D 
Sbjct:  146 GYHMGNTKMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGVYFPNGFWDDFNCDTKNAVICEIAKGDTDDA 268          

HSP 7 Score: 109.383 bits (272), Expect = 1.011e-47
Identity = 54/131 (41.22%), Postives = 80/131 (61.07%), Query Frame = -2
Query: 2665 NAVICM--KSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNG-KRQENCVHGLYYPAGLWNDISCNTPNSVICQ 3048
            N+VIC   K      + GY +   KM    A  +CK++ M+L+ I N  +N  VFN+A K  +G YWI+GND   EG WV + +  + Y+NW++GEPN     ++C+ G Y+P G W+D +C+T NSVIC+
Sbjct:    4 NSVICEVPKDTDNDNNEGYHMGNTKMTSNDAAKYCKDRKMDLVRIPNKDVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGAYFPNGFWDDFNCDTKNSVICE 134          

HSP 8 Score: 112.849 bits (281), Expect = 5.214e-47
Identity = 54/131 (41.22%), Postives = 83/131 (63.36%), Query Frame = -2
Query: 2665 NAVICM--KSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNG-KRQENCVHGLYYPAGLWNDISCNTPNSVICQ 3048
            N+VIC   K      + GY +   KM +  AV +CK++ M+L+ I N  +N  VFN+A K  +G YWI+GND   EG WV + +  + Y+NW++GEPN     ++C+ G+Y+P G W+D +C+T N+VIC+
Sbjct:  129 NSVICEVPKDTDNDNNEGYHMGNTKMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGVYFPNGFWDDFNCDTKNAVICE 259          

HSP 9 Score: 107.457 bits (267), Expect = 5.214e-47
Identity = 54/125 (43.20%), Postives = 76/125 (60.80%), Query Frame = -3
Query: 2268 VEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEP-NGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPAD 2639
            V+  Y ++    T+D+AVK+C  + + L+ I N   N+ V+N+AV Y +G YWI GND  KEG+WV + N  L +K W  GEP N G  ++CI G  Y N FW+D NC  KN V+CE ++    D
Sbjct:  282 VKRNYRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDD 406          

HSP 10 Score: 121.709 bits (304), Expect = 3.174e-24
Identity = 55/113 (48.67%), Postives = 77/113 (68.14%), Query Frame = -2
Query: 2665 YVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGK-RQENCVHGLYYPAGLWNDISCNTPNSVICQ 3000
            Y VN  KM +  AV +CK+  M+L+ I N   N  V+N+A+KYKIG YWI+GND   EG WVD+ +  + Y+NW+SGEPN     ++C+ G YYP G W+D +C+T N+VIC+
Sbjct:  425 YRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVICE 537          

HSP 11 Score: 115.931 bits (289), Expect = 2.285e-22
Identity = 51/105 (48.57%), Postives = 73/105 (69.52%), Query Frame = -2
Query: 2665 AYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGK-RQENCVHGLYYPAGLWNDISCNTPNSVICQ 2976
             +  AV +CK++ M+L+ I N   NK V+N+A+KYKIG YWI+GND   EG WVD+ +  + Y+NW+SGEPN     ++C+ G YYP G W+D +C+T N VIC+
Sbjct:  584 TFDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVICE 688          

HSP 12 Score: 115.161 bits (287), Expect = 3.628e-22
Identity = 52/120 (43.33%), Postives = 80/120 (66.67%), Query Frame = -2
Query: 2644 YVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEP-NGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKS 3000
            Y +N  KM +  AV +CK++ M+++ I N  IN  VF ++ KY +G YWI+GND  ++G WVD+ +  + Y+NW+ GEP NG   ++C+ G YY  G W+DI+C+   SVIC+ +K+K S
Sbjct:  722 YQINNAKMNFDDAVKYCKDKQMDVVRISNAEINTFVFKLSEKYGLGKYWINGNDRAVDGTWVDTNNKELPYKNWQKGEPNNGGGVQHCIQGGYYSDGFWDDINCDVKISVICESRKSKDS 841          

HSP 13 Score: 107.071 bits (266), Expect = 1.177e-19
Identity = 54/122 (44.26%), Postives = 74/122 (60.66%), Query Frame = -3
Query: 2268 GYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNG-GRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPAD 2630
            GY +    MT ++A K+C ++ + L+ I N+ +N  VFN+A   NLG YWI GND  KEG+WV + N  L +K W  GEPN  G  ++CI G  + N FW+D NC  KN VICE  + +  D
Sbjct:   21 GYHMGNTKMTSNDAAKYCKDRKMDLVRIPNKDVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGAYFPNGFWDDFNCDTKNSVICEVPKDTDND 142          

HSP 14 Score: 103.605 bits (257), Expect = 1.311e-18
Identity = 52/114 (45.61%), Postives = 73/114 (64.04%), Query Frame = -3
Query:  204 SKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQP-NGGKKENCIQGLYFSDGTWNDVKCDMKNKVIC 542
            + YH++ +K N+ D VKYCK K+M LVKI +++ N  V+  A K  L T+W+NGND + EG WVDTDN  LTY NW+  +P N G  ++C+QG    +G W    C+  N V+C
Sbjct:  914 TSYHLTNAKMNFDDAVKYCKDKQMDLVKIPNEEVNAVVFKKAAKYNLETYWLNGNDRSKEGTWVDTDNNVLTYKNWSTGEPNNNGGNKHCLQGSNNLNGYWEASDCNGLNSVVC 1027          

HSP 15 Score: 92.8189 bits (229), Expect = 3.157e-15
Identity = 48/126 (38.10%), Postives = 69/126 (54.76%), Query Frame = -2
Query: 2668 VICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGK-RQENCVHGLYYPAGLWNDISCNTPNSVIC 3042
            VI  +S        Y +   KM +  AV +CK++ M+L+ I N  +N  VF  A KY +  YW++GND   EG WVD+ +N + Y+NW +GEPN     ++C+ G     G W    CN  NSV+C
Sbjct:  902 VITKESETKVVSTSYHLTNAKMNFDDAVKYCKDKQMDLVKIPNEEVNAVVFKKAAKYNLETYWLNGNDRSKEGTWVDTDNNVLTYKNWSTGEPNNNGGNKHCLQGSNNLNGYWEASDCNGLNSVVC 1027          
BLAST of SMED30004599 vs. TrEMBL
Match: Q8WSX1 (Lectin 2a OS=Girardia tigrina OX=6162 GN=lec2a PE=4 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 8.683e-105
Identity = 207/627 (33.01%), Postives = 328/627 (52.31%), Query Frame = -3
Query:  186 TREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVY-ADGFWNDVECDQPNSVICEPMRHTTNKYH------------IGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQG-LRINGLWNDVTCDSLGEVIC-QPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMN-SVIC----------EPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSK---YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEK 1979
            T+  +TY  A++ C A+ M LV + +   N +V+  + +   D YW++GND   EG WVD+  N+L Y N+   EP+G K ENC+  +VY  +G WND+ C      IC+  R  +  Y             I + +MTF DA  +C  R M ++ I +   N +V    +++    YW++ ND   E  W++ D +E+ +KN+HP EP G R ENC  G L ++GLWN   C+     IC +  +    P  N++  +S E++    A+++C    +++ K DNA++N +   ++ +  L  +W+DG D+  EG WVD  D  L +K +Y  EP+G   ENC       +GLW+D  C   N   +C          E I    N   I++ +  ++ A++YCR +  +LV++      + +   +       YWI+GND+  EG W D+   ++++K W  +EP GGR ENCI  +N  +  W D  C +    +C     G  +   YH S++K  +   VKYC S  ++++ I DD +N  +   A K  LGT WI+GND A EG WV+  N  L++ N+   +P+GG++ +C+Q L    G W D KCD  N VIC   V++
Sbjct:   29 TKVVVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWLDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCL--MVYRVNGMWNDLNCVARIWAICQ--RDPSQLYLGNQIEIEGSGLIISRGKMTFADAQEFCTNRGMRMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEVKWVDADGKELVHKNFHPGEPNGGRGENCGHGYLTVDGLWNHFPCNYQLWAICYREGETNNGPDPNTII-ASHERLTFSEAQDYCKGLGLKMAKADNAAENGMIHGFSRRIYLDLYWLDGNDAKEEGKWVDSDDVDLKHKGFYPGEPNGRINENCINGYLLHDGLWNDFPCTYKNLFALCYKDGLTMPYPEDIEYDVNSLMISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIACTNKYIAVCITDPSGGERTVDYHFSRTKLTWDAAVKYCNSMGLNIIHIKDDNENSLILGSAKKLNLGTHWIDGNDNAEEGKWVNRKNGELSFKNFISGEPSGGRERSCLQSL--PSGYWIDSKCDSLNSVICYGSVKR 648          

HSP 2 Score: 306.605 bits (784), Expect = 3.766e-88
Identity = 174/509 (34.18%), Postives = 265/509 (52.06%), Query Frame = -3
Query:  564 PVVQKLKNTVEF---GYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHT-----TNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQG-LRINGLWNDVTCD-------SLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNG-----FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC 2027
            P    L N +E    G   +R KMT+  A ++C  + M +V I +   N +VH  + +   D+YWI+ ND++ E  WVD++  +L + N+H  EP+GG+ ENC    +  DG WN   C+     IC     T      N      +R+TF++A +YCK   + +   +N + N ++    ++     YW++GND  EEG W+++D+ ++ +K ++P EP G   ENCI G L  +GLWND  C           + +  P         NSL  S TE+     A ++C  R  ++V++ +A+  D+   Y  K    Y+WIDG D   EG WVD   Q ++YKNW + EP+GG+ ENC +S  +  G W D  C +    +C  I D   G     +H +  K+ +D AVKYC +  + ++ I  D  N+ +   +   NLG +WI+GNDN +EG+W + K   LSFK +   EP GGR  +C+   +     W D KC SLNSVIC
Sbjct:  139 PSQLYLGNQIEIEGSGLIISRGKMTFADAQEFCTNRGMRMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEVKWVDADGKELVHKNFHPGEPNGGRGENCGHGYLTVDGLWNHFPCNYQLWAICYREGETNNGPDPNTIIASHERLTFSEAQDYCKGLGLKMAKADNAAENGMIHGFSRRIYLDLYWLDGNDAKEEGKWVDSDDVDLKHKGFYPGEPNGRINENCINGYLLHDGLWNDFPCTYKNLFALCYKDGLTMPYPEDIEYDVNSLMIS-TERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIACTNKYIAVC--ITDPSGGERTVDYHFSRTKLTWDAAVKYCNSMGLNIIHIKDDNENSLILGSAKKLNLGTHWIDGNDNAEEGKWVNRKNGELSFKNFISGEPSGGRERSCL--QSLPSGYWIDSKCDSLNSVIC 642          

HSP 3 Score: 292.352 bits (747), Expect = 7.214e-83
Identity = 170/500 (34.00%), Postives = 255/500 (51.00%), Query Frame = -3
Query:  204 TNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQ--PIQ----NKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSV-----KMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLN-SVIC----------QPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVIC 1637
             N   + K  +T+N+A+  CK R MVL+ + +   N IV     K L   YW++GND++ EG W++    ++ YKN+ P EP G + ENC+   R+NG+WND+ C +    ICQ  P Q    N+     + L  S   KM    A+EFC NR MR+VKI +A  N +  ++A ++   Y+WID  D  NE  WVD   ++L +KN++  EP+GG+ ENC       +GLW+   C      IC    +T NG    ++     ++ F  A  YC+   +++ K D    N  ++  S    L  YW++GND ++EG+W DS    L  K ++  EP G  NENCI G    D LWND  C   N   +C          + I+Y  +   IS  +  Y + ++YC+++   LV++        +     K     +WI+GND   EG WVD + + +TY NW   +PNGG+ ENCI      +G W D+ C  K   +C
Sbjct:   23 ANTLFVTKVVVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWLDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLMVYRVNGMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIISRG-KMTFADAQEFCTNRGMRMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEVKWVDADGKELVHKNFHPGEPNGGRGENCGHGYLTVDGLWNHFPCNYQLWAICYREGETNNGPDPNTIIASHERLTFSEAQDYCKGLGLKMAKADNAAENGMIHGFSRRIYLDLYWLDGNDAKEEGKWVDSDDVDLKHKGFYPGEPNGRINENCINGYLLHDGLWNDFPCTYKNLFALCYKDGLTMPYPEDIEYDVNSLMISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIACTNKYIAVC 521          

HSP 4 Score: 88.1965 bits (217), Expect = 1.303e-31
Identity = 44/111 (39.64%), Postives = 65/111 (58.56%), Query Frame = -3
Query: 2295 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVIC 2627
            Y  +   +T+D AVK+C    L ++ IK++  N  +   A   NLGT+WI GND ++EG WV+ +N  L FK +  GEP+GGR+ +C+  L   + +W D  C   N VIC
Sbjct:  534 YHFSRTKLTWDAAVKYCNSMGLNIIHIKDDNENSLILGSAKKLNLGTHWIDGNDNAEEGKWVNRKNGELSFKNFISGEPSGGRERSCLQSL--PSGYWIDSKCDSLNSVIC 642          

HSP 5 Score: 80.4925 bits (197), Expect = 1.303e-31
Identity = 37/110 (33.64%), Postives = 58/110 (52.73%), Query Frame = -2
Query: 2668 VVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVIC 2997
            +++ ++  Y  A+ +C+ +  +L+ +K+      +     K    YYWIDGND+  EG WVD+    M Y+NW + EPNG R ENC+       G W DI+C      +C
Sbjct:  412 MISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIACTNKYIAVC 521          

HSP 6 Score: 84.7297 bits (208), Expect = 5.263e-31
Identity = 46/136 (33.82%), Postives = 65/136 (47.79%), Query Frame = -2
Query: 2659 VICMKSP--------IIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKK 3042
             IC + P        I     G +++  KM +  A  FC  + M ++ I + + N  V + A +    YYWID ND   E  WVD+    + ++N+  GEPNG R ENC HG     GLWN   CN     IC ++
Sbjct:  133 AICQRDPSQLYLGNQIEIEGSGLIISRGKMTFADAQEFCTNRGMRMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEVKWVDADGKELVHKNFHPGEPNGGRGENCGHGYLTVDGLWNHFPCNYQLWAICYRE 268          

HSP 7 Score: 82.0333 bits (201), Expect = 5.263e-31
Identity = 40/107 (37.38%), Postives = 58/107 (54.21%), Query Frame = -3
Query: 2304 LINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNM 2624
            + + E +T+ EA  +C    L++    N   N  +   +    L  YW+ GND  +EG WVDS +V L+ K +Y GEPNG   ENCI+G    +  WND  C +KN+
Sbjct:  281 IASHERLTFSEAQDYCKGLGLKMAKADNAAENGMIHGFSRRIYLDLYWLDGNDAKEEGKWVDSDDVDLKHKGFYPGEPNGRINENCINGYLLHDGLWNDFPCTYKNL 387          

HSP 8 Score: 79.337 bits (194), Expect = 8.621e-28
Identity = 40/110 (36.36%), Postives = 62/110 (56.36%), Query Frame = -2
Query: 2650 MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTK 2979
            + Y  A+  CK + M L+ + +   N  V   A K     YW+DGND+  EG WVD++ N + Y+N+   EPNG + ENC+  +Y   G+WND++C      ICQ+  ++
Sbjct:   33 VTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWLDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLM-VYRVNGMWNDLNCVARIWAICQRDPSQ 141          

HSP 9 Score: 76.2554 bits (186), Expect = 8.621e-28
Identity = 46/144 (31.94%), Postives = 68/144 (47.22%), Query Frame = -3
Query: 2205 GYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVIC--EPMEKSPADPEICKSFLELCYNSKIRKICQ 2630
            G +I+   MT+ +A +FC  + +R++ I +   N  V + A       YWI  ND   E  WVD+    L  K ++ GEPNGGR ENC HG    +  WN   C ++   IC  E    +  DP    +  E    S+ +  C+
Sbjct:  154 GLIISRGKMTFADAQEFCTNRGMRMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEVKWVDADGKELVHKNFHPGEPNGGRGENCGHGYLTVDGLWNHFPCNYQLWAICYREGETNNGPDPNTIIASHERLTFSEAQDYCK 297          

HSP 10 Score: 77.0258 bits (188), Expect = 1.206e-26
Identity = 33/106 (31.13%), Postives = 57/106 (53.77%), Query Frame = -2
Query: 2680 VVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPN 2997
            + + +++ ++ A  +CK   +++    N   N  +   + +  +  YW+DGND   EG WVDS    ++++ +  GEPNG+  ENC++G     GLWND  C   N
Sbjct:  281 IASHERLTFSEAQDYCKGLGLKMAKADNAAENGMIHGFSRRIYLDLYWLDGNDAKEEGKWVDSDDVDLKHKGFYPGEPNGRINENCINGYLLHDGLWNDFPCTYKN 386          

HSP 11 Score: 74.7146 bits (182), Expect = 1.206e-26
Identity = 37/110 (33.64%), Postives = 59/110 (53.64%), Query Frame = -3
Query: 2295 LINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVIC 2624
            +I+ E  TY+EA+++C  +  +L+ +K+      +           YWI GND++ EG+WVD+    + +K W   EPNGGR ENCI         W D+ C +K + +C
Sbjct:  412 MISTERYTYNEALQYCRTRGSQLVRVKSAASKDILAAYTKKIVADYYWIDGNDHTTEGTWVDANGQVMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIACTNKYIAVC 521          

HSP 12 Score: 90.1225 bits (222), Expect = 1.371e-14
Identity = 45/134 (33.58%), Postives = 73/134 (54.48%), Query Frame = -2
Query: 2644 VICMKSPII-KTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKS 3042
             +C+  P   +    Y  +  K+ +  AV +C    + ++ IK+   N  +   A K  +G +WIDGNDN  EG WV+ K+  + ++N+ SGEP+G R+ +C+  L  P+G W D  C++ NSVIC     + S
Sbjct:  519 AVCITDPSGGERTVDYHFSRTKLTWDAAVKYCNSMGLNIIHIKDDNENSLILGSAKKLNLGTHWIDGNDNAEEGKWVNRKNGELSFKNFISGEPSGGRERSCLQSL--PSGYWIDSKCDSLNSVICYGSVKRAS 650          

HSP 13 Score: 80.1073 bits (196), Expect = 1.887e-11
Identity = 39/111 (35.14%), Postives = 64/111 (57.66%), Query Frame = -3
Query: 2292 LINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2624
             + + ++TY+EA++ C  + + L+ + + + N  V   A      TYW+ GND++ EG+WVD+R   L +K +   EPNG + ENC+   R  N  WND+NC  +   IC+
Sbjct:   27 FVTKVVVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWLDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLMVYRV-NGMWNDLNCVARIWAICQ 136          
BLAST of SMED30004599 vs. TrEMBL
Match: Q8WSX0 (Lectin 2b OS=Girardia tigrina OX=6162 GN=lec2b PE=4 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 2.707e-100
Identity = 201/629 (31.96%), Postives = 324/629 (51.51%), Query Frame = -3
Query:  183 TREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVY-ADGFWNDVECDQPNSVICE---PMRHTTNKYHI-------GKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQG-LRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMN-SVIC----------EPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKY---GPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCI----QGLYFSDGTWNDVKCDMKNKVICELKVEKL 1979
            T+  +TY  A++ C A+ M LV I +   N +V+  + +   D YWI+GND   EG WVD+  N+L Y N+    P+G + ENC  +LVY  +G W D  C      IC+      +  N+  I        + +MTF DA  YC  R M ++ I +   N +V    +++    YW++ ND   EG W++ D +E+ +KN+HP EP G R ENC  G L I+GLWND  C      IC    N+   +  +   +S E+     A+++C    +++ K ++A++N L   +  ++ L  +W+DG D+  EG WVD  D +L +K ++  EP+GG  ENC       +GLW+D  C   N   +C          E      +   I++ +  ++ A++YCR +  +LV+I  +     +   +       YWI+GND+  EG W D+   LL++K W  +EP GGR ENCI  +N  +  W D  C +    IC    Y        H +K+K  +   + YCKS  + +++I D + ++ +   +LK KL T+WI+GND   E  WVD D   L+Y N+   +P+GG+++NC+     G +F++G      C   N+V+C   ++++
Sbjct:   29 TKVLVTYNEAIQSCKARGMVLVRITSAEDNTIVNGYANKVLADKYWIDGNDHANEGTWVDARGNQLPYKNFAPNGPNGNQNENC--ALVYRVNGLWYDYNCVYRLWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVTEGKWVDPDGKELVHKNFHPGEPNGGRGENCGHGYLTIDGLWNDFPCSYQLWAICYREDNRNTNADTNTIIASHERFTFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGEPNGGINENCLNGYLLLDGLWNDFPCTYKNLFALCYKDGLTMPYMEDYEVDADNLMISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPNGGRAENCIISHNNLEGAWWDIPCTNKYFAICSRNPYEDDTALDVHYTKTKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKLSTYWIDGNDNDQEDRWVDADKTELSYKNFTSGEPSGGREKNCLTVNKTGQWFAEG------CTRLNRVVCYGNLKRI 649          

HSP 2 Score: 303.523 bits (776), Expect = 5.618e-87
Identity = 174/507 (34.32%), Postives = 267/507 (52.66%), Query Frame = -3
Query:  564 PVVQKLKNTVEF---GYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVIC--EPMRHT---TNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQG-LRINGLWNDVTCD-------SLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE--PI-NDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC 2027
            P    L N +E    G   +R KMT+  A +YC  + M +V I +   N +VH  + +   D+YWI+ ND++ EG WVD +  +L + N+H  EP+GG+ ENC    +  DG WND  C      IC  E  R+T   TN      +R TF +A +YCK   + +    + + N ++    +++    YW++GND   EG W+++D+ E+ +K +HP EP G   ENC+ G L ++GLWND  C           + +  P        +++L   STE+     A ++C  R  ++V+I N +   L   +A K    Y+WIDG D   EG W+D   + L+YKNW + EP+GG+ ENC +S  +  G W D  C +    IC   P  +DT    H T  KM FD A+ YC++  +++++I   + +  +   S+   L  YWI+GNDN +E +W D+ +  LS+K +   EP GGR +NC+T N  +   W  E C  LN V+C
Sbjct:  139 PSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVTEGKWVDPDGKELVHKNFHPGEPNGGRGENCGHGYLTIDGLWNDFPCSYQLWAICYREDNRNTNADTNTIIASHERFTFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGEPNGGINENCLNGYLLLDGLWNDFPCTYKNLFALCYKDGLTMPYMEDYEVDADNLMI-STERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPNGGRAENCIISHNNLEGAWWDIPCTNKYFAICSRNPYEDDTALDVHYTKTKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKLSTYWIDGNDNDQEDRWVDADKTELSYKNFTSGEPSGGREKNCLTVN--KTGQWFAEGCTRLNRVVC 642          

HSP 3 Score: 279.641 bits (714), Expect = 2.924e-78
Identity = 166/499 (33.27%), Postives = 243/499 (48.70%), Query Frame = -3
Query:  204 TNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQ--PIQ---NKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVIC-----EPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKC-----------GSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVIC 1637
             N   + K  +T+N+A+  CK R MVL+ I +   N IV     K L   YW++GND++ EG W++    ++ YKN+ P  P G + ENC    R+NGLW D  C      ICQ  P Q     +     S    S  KM    A+E+C+NR M++VKI +A  N +  ++A ++   Y+WID  D   EG WVD   ++L +KN++  EP+GG+ ENC       +GLW+D  C      IC        N   N    +  +  F  A  YC+   +++ K +    N  ++  +    L  YW++GND + EG+W DS    L  K +H  EP GG NENC+ G    D LWND  C             L     +  +       IS  +  Y + ++YC+++   LV+I ++     +   A K     +WI+GND   EG W+D +   LTY NW   +PNGG+ ENCI      +G W D+ C  K   IC
Sbjct:   23 ANTLFVTKVLVTYNEAIQSCKARGMVLVRITSAEDNTIVNGYANKVLADKYWIDGNDHANEGTWVDARGNQLPYKNFAPNGPNGNQNENCALVYRVNGLWYDYNCVYRLWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVTEGKWVDPDGKELVHKNFHPGEPNGGRGENCGHGYLTIDGLWNDFPCSYQLWAICYREDNRNTNADTNTIIASHERFTFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGEPNGGINENCLNGYLLLDGLWNDFPCTYKNLFALCYKDGLTMPYMEDYEVDADNLMISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPNGGRAENCIISHNNLEGAWWDIPCTNKYFAIC 521          

HSP 4 Score: 89.3521 bits (220), Expect = 6.416e-31
Identity = 47/141 (33.33%), Postives = 69/141 (48.94%), Query Frame = -2
Query: 2644 VICMKSP--------IIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKS 3042
             IC + P        I     G +V+  KM +  A  +C  + M+++ I + + N  V + A +    YYWID ND   EG WVD     + ++N+  GEPNG R ENC HG     GLWND  C+     IC ++  + +
Sbjct:  133 AICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVTEGKWVDPDGKELVHKNFHPGEPNGGRGENCGHGYLTIDGLWNDFPCSYQLWAICYREDNRNT 273          

HSP 5 Score: 77.0258 bits (188), Expect = 6.416e-31
Identity = 38/107 (35.51%), Postives = 56/107 (52.34%), Query Frame = -3
Query: 2304 LINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNM 2624
            + + E  T+ EA  +C    L++    +   N  +        L  YW+ GND   EG WVDS +V L+ K ++ GEPNGG  ENC++G    +  WND  C +KN+
Sbjct:  281 IASHERFTFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGEPNGGINENCLNGYLLLDGLWNDFPCTYKNL 387          

HSP 6 Score: 83.9593 bits (206), Expect = 5.851e-28
Identity = 39/112 (34.82%), Postives = 59/112 (52.68%), Query Frame = -2
Query: 2662 VVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 2997
            +++ ++  Y  A+ +C+ +  +L+ IKN      +   A K    YYWIDGND+  EG W+D+    + Y+NW + EPNG R ENC+       G W DI C      IC +
Sbjct:  412 MISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPNGGRAENCIISHNNLEGAWWDIPCTNKYFAICSR 523          

HSP 7 Score: 72.4034 bits (176), Expect = 5.851e-28
Identity = 35/104 (33.65%), Postives = 59/104 (56.73%), Query Frame = -3
Query: 2295 MTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVIC 2606
            MT+D A+ +C    L+++ IK+ + ++ +   ++ + L TYWI GND  +E  WVD+    L +K +  GEP+GGR++NC+   +     W    C   N V+C
Sbjct:  541 MTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKLSTYWIDGNDNDQEDRWVDADKTELSYKNFTSGEPSGGREKNCLTVNKTGQ--WFAEGCTRLNRVVC 642          

HSP 8 Score: 83.1889 bits (204), Expect = 9.989e-28
Identity = 45/120 (37.50%), Postives = 63/120 (52.50%), Query Frame = -3
Query: 2271 LINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICE--PMEKSPA 2624
            +I+ E  TY+EA+++C  +  +L+ IKNE     +   A       YWI GND++ EG+W+D+    L +K W   EPNGGR ENCI         W D+ C +K   IC   P E   A
Sbjct:  412 MISTERYTYNEALQYCRTRGTQLVRIKNEAAKGLLAAFAKKIVADYYWIDGNDHTTEGTWMDANGRLLTYKNWANNEPNGGRAENCIISHNNLEGAWWDIPCTNKYFAICSRNPYEDDTA 531          

HSP 9 Score: 72.4034 bits (176), Expect = 9.989e-28
Identity = 34/113 (30.09%), Postives = 57/113 (50.44%), Query Frame = -2
Query: 2662 VVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPN-SVICQK 2997
            + + ++  +  A  +CK   +++    +   N  +     +  +  YW+DGND  +EG WVDS    ++++ +  GEPNG   ENC++G     GLWND  C   N   +C K
Sbjct:  281 IASHERFTFPEAQDYCKGLGLKMAKANSAAENGLIHGFTRRAFLDLYWLDGNDAKVEGKWVDSDDVELKHKGFHPGEPNGGINENCLNGYLLLDGLWNDFPCTYKNLFALCYK 393          

HSP 10 Score: 78.1814 bits (191), Expect = 1.319e-26
Identity = 39/112 (34.82%), Postives = 58/112 (51.79%), Query Frame = -3
Query: 2295 GYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVIC 2630
            G +++   MT+ +A ++C  + ++++ I +   N  V + A       YWI  ND   EG WVD     L  K ++ GEPNGGR ENC HG    +  WND  C ++   IC
Sbjct:  154 GLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVTEGKWVDPDGKELVHKNFHPGEPNGGRGENCGHGYLTIDGLWNDFPCSYQLWAIC 265          

HSP 11 Score: 73.559 bits (179), Expect = 1.319e-26
Identity = 41/110 (37.27%), Postives = 58/110 (52.73%), Query Frame = -2
Query: 2650 MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTK 2979
            + Y  A+  CK + M L+ I +   N  V   A K     YWIDGND+  EG WVD++ N + Y+N+    PNG + ENC   +Y   GLW D +C      ICQ+  ++
Sbjct:   33 VTYNEAIQSCKARGMVLVRITSAEDNTIVNGYANKVLADKYWIDGNDHANEGTWVDARGNQLPYKNFAPNGPNGNQNENCAL-VYRVNGLWYDYNCVYRLWAICQRDPSQ 141          

HSP 12 Score: 81.2629 bits (199), Expect = 8.057e-12
Identity = 42/127 (33.07%), Postives = 71/127 (55.91%), Query Frame = -2
Query: 2668 VICMKSPIIKTDYGYVVNLQK--MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVIC 3042
             IC ++P  + D    V+  K  M +  A+++CK   ++++ IK+   ++ +   ++K+K+  YWIDGNDN  E  WVD+    + Y+N+ SGEP+G R++NC+       G W    C   N V+C
Sbjct:  519 AICSRNPY-EDDTALDVHYTKTKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKLSTYWIDGNDNDQEDRWVDADKTELSYKNFTSGEPSGGREKNCL--TVNKTGQWFAEGCTRLNRVVC 642          

HSP 13 Score: 72.4034 bits (176), Expect = 4.710e-9
Identity = 38/111 (34.23%), Postives = 60/111 (54.05%), Query Frame = -3
Query: 2292 LINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2624
             + + ++TY+EA++ C  + + L+ I + + N  V   A       YWI GND++ EG+WVD+R   L +K +    PNG + ENC    R  N  W D NC ++   IC+
Sbjct:   27 FVTKVLVTYNEAIQSCKARGMVLVRITSAEDNTIVNGYANKVLADKYWIDGNDHANEGTWVDARGNQLPYKNFAPNGPNGNQNENCALVYRV-NGLWYDYNCVYRLWAICQ 136          
BLAST of SMED30004599 vs. TrEMBL
Match: Q8WSW9 (Lectin 2c OS=Girardia tigrina OX=6162 GN=lec2c PE=4 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 2.851e-100
Identity = 195/625 (31.20%), Postives = 326/625 (52.16%), Query Frame = -3
Query:  183 TREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVY-ADGFWNDVECDQPNSVICE---PMRHTTNKYHI-------GKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQG-LRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSV-------ICEPIND----TKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKY-GPSKY--HISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 1979
            T+  +TY  A++ C A+ M LV + +   N +V+  + +   D YWI+GND   EG WVD+  N+L Y N+   EP+G K ENC+  +VY  +  WND+ C      IC+      +  N+  I        + +MTF DA  YC  R M ++ I +   N +V    +++    YW++ ND   EG W++ D +E+ +KN+HP EP+G R ENC  G L ++GLWND  C      IC    N+   +  +   +S E++    A+++C    +++ K ++A+++ +   +  +  L  +W+DG D+  EG WVD  D +L +K +Y  EP+GG+ ENC       + LW+D  C   N         +  P  D      +   I++ +  ++ A++YCR +  +LV+I  +     +   +       YWI+GND+  EG W D+   L+++K W  +EP GGR ENCI  +N  +  W D  C +    +C    Y G S    H +K+K  +   + YCKS  + +++I D + ++ +   +LK K+ ++WI+GND   E  WVD D   L+Y N+   +P+GG+++NC+  +    G W    C   N+V+C   ++++
Sbjct:   29 TKVLVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWIDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCL--MVYRVNRMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEGKWVDADGKELVHKNFHPGEPKGGRGENCGHGYLTVDGLWNDFPCSYQLWAICYKEDNRNTNADPNTIIASHERLTFYEAQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLYWLDGNDAKVEGKWVDSDDVELKHKGFYPGEPNGGRNENCINGYLLHDALWNDLPCTYKNLFALCYKDGLTMPYMDDYEVNVDNLMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIPCSNKYFAVCSRNPYEGDSSLDVHYTKAKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKVCSYWIDGNDNEQEDRWVDADKTELSYKNFASGEPSGGREKNCL--IVNKTGQWFAESCRKLNRVVCYGNLKRI 649          

HSP 2 Score: 294.278 bits (752), Expect = 1.341e-83
Identity = 167/507 (32.94%), Postives = 265/507 (52.27%), Query Frame = -3
Query:  564 PVVQKLKNTVEF---GYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVIC--EPMRHT---TNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQG-LRINGLWNDVTCD-------SLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE--PI-NDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC 2027
            P    L N +E    G   +R KMT+  A +YC  + M +V I +   N +VH  + +   D+YWI+ ND++ EG WVD++  +L + N+H  EP GG+ ENC    +  DG WND  C      IC  E  R+T    N      +R+TF +A +YCK   + +    + + + ++    ++     YW++GND   EG W+++D+ E+ +K ++P EP G R ENCI G L  + LWND+ C           + +  P  +    + ++L   STE+     A ++C  R  ++V+I N +       +A K    Y+WIDG D  +EG WVD   + ++YKNW + EP+GG+ ENC +S  +  G W D  C +    +C   P   D+    H T  KM FD A+ YC++  +++++I   + +  +   S+   +  YWI+GNDN +E +W D+ +  LS+K +   EP GGR +NC+  N  +   W  E C  LN V+C
Sbjct:  139 PSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEGKWVDADGKELVHKNFHPGEPKGGRGENCGHGYLTVDGLWNDFPCSYQLWAICYKEDNRNTNADPNTIIASHERLTFYEAQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLYWLDGNDAKVEGKWVDSDDVELKHKGFYPGEPNGGRNENCINGYLLHDALWNDLPCTYKNLFALCYKDGLTMPYMDDYEVNVDNLMI-STERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIPCSNKYFAVCSRNPYEGDSSLDVHYTKAKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKVCSYWIDGNDNEQEDRWVDADKTELSYKNFASGEPSGGREKNCLIVN--KTGQWFAESCRKLNRVVC 642          

HSP 3 Score: 291.967 bits (746), Expect = 9.388e-83
Identity = 168/500 (33.60%), Postives = 253/500 (50.60%), Query Frame = -3
Query:  204 TNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQ--PIQ----NKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVIC-----EPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKC-----------GSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVIC 1637
             N   + K  +T+N+A+  CK R MVL+ + +   N IV     K L   YW++GND++ EG W++    ++ YKN+ P EP G + ENC+   R+N +WND+ C +    ICQ  P Q    N+     + L  S   KM    A+E+C+NR M++VKI +A  N +  ++A ++   Y+WID  D  NEG WVD   ++L +KN++  EP GG+ ENC       +GLW+D  C      IC        N   N    +  ++ F  A  YC+   +++ K +    +  ++  +    L  YW++GND + EG+W DS    L  K ++  EP GGRNENCI G    DALWND  C             L        +       IS  +  Y + ++YC+++   LV+I ++    F+   A K     +WI+GND  +EG WVD +   +TY NW   +PNGG+ ENCI      +G W D+ C  K   +C
Sbjct:   23 ANTLFVTKVLVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWIDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLMVYRVNRMWNDLNCVARIWAICQRDPSQLYLGNQIEIEGSGLIVSRG-KMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEGKWVDADGKELVHKNFHPGEPKGGRGENCGHGYLTVDGLWNDFPCSYQLWAICYKEDNRNTNADPNTIIASHERLTFYEAQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLYWLDGNDAKVEGKWVDSDDVELKHKGFYPGEPNGGRNENCINGYLLHDALWNDLPCTYKNLFALCYKDGLTMPYMDDYEVNVDNLMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIPCSNKYFAVC 521          

HSP 4 Score: 179.874 bits (455), Expect = 4.214e-58
Identity = 138/500 (27.60%), Postives = 224/500 (44.80%), Query Frame = -3
Query: 1299 GYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVIC--EPMEKSPADP-EICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICG-WMEKEMTTV--------APVVQKLKNTVEFGY-----HYTREKMTYKSAVKYCLAQSMNL-------VTIDNE--ATNKLVHDLSLQY---------------------------NIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRH---TTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVIC 2630
            G +++   MT+ +A ++C  + ++++ I +   N  V + A       YWI  ND   EG WVD+    L  K ++ GEP GGR ENC HG    +  WND  C ++   IC  E    + ADP  I  S   L +        Q+ CK       +    + S  +   + + + D Y    +L     K+ G W++ +   +         P   + +N +  GY      +     TYK+    C    + +       V +DN   +T +  ++ +LQY                             D+YWI+GND   EG WVD+N   ++Y NW   EP+GG+ ENCI S    +G W D+ C      +C    +   ++   H  K +MTF+ A+ YCK   + +I I++  +++++     K     YW++GNDN +E  W++ D  E+SYKN+   EP G R++NC+  +   G W   +C  L  V+C
Sbjct:  154 GLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEGKWVDADGKELVHKNFHPGEPKGGRGENCGHGYLTVDGLWNDFPCSYQLWAICYKEDNRNTNADPNTIIASHERLTFYE-----AQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLY----WLDGNDAKVEGKWVDSDDVELKHKGFYPGEPNGGRNENCIN-GYLLHDALWNDLPCTYKNLFALCYKDGLTMPYMDDYEVNVDNLMISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIPCSNKYFAVCSRNPYEGDSSLDVHYTKAKMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKVCSYWIDGNDNEQEDRWVDADKTELSYKNFASGEPSGGREKNCLI-VNKTGQWFAESCRKLNRVVC 642          

HSP 5 Score: 77.0258 bits (188), Expect = 4.214e-58
Identity = 40/110 (36.36%), Postives = 61/110 (55.45%), Query Frame = -2
Query: 2650 MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTK 2979
            + Y  A+  CK + M L+ + +   N  V   A K     YWIDGND+  EG WVD++ N + Y+N+   EPNG + ENC+  +Y    +WND++C      ICQ+  ++
Sbjct:   33 VTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWIDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLM-VYRVNRMWNDLNCVARIWAICQRDPSQ 141          

HSP 6 Score: 87.8113 bits (216), Expect = 6.383e-14
Identity = 47/141 (33.33%), Postives = 69/141 (48.94%), Query Frame = -2
Query: 2644 VICMKSP--------IIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKS 3042
             IC + P        I     G +V+  KM +  A  +C  + M+++ I + + N  V + A +    YYWID ND   EG WVD+    + ++N+  GEP G R ENC HG     GLWND  C+     IC K+  + +
Sbjct:  133 AICQRDPSQLYLGNQIEIEGSGLIVSRGKMTFADAQEYCSNRGMKMVKIGHALDNAVVHSFARETYSDYYWIDANDIVNEGKWVDADGKELVHKNFHPGEPKGGRGENCGHGYLTVDGLWNDFPCSYQLWAICYKEDNRNT 273          

HSP 7 Score: 84.7297 bits (208), Expect = 6.561e-13
Identity = 40/112 (35.71%), Postives = 60/112 (53.57%), Query Frame = -2
Query: 2662 VVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 2997
            +++ ++  Y  A+ +C+ +  +L+ IKN      +   A K    YYWIDGND+  EG WVD+    M Y+NW + EPNG R ENC+       G W DI C+     +C +
Sbjct:  412 MISTERYTYNEALQYCRTRGTQLVRIKNEASKGFLAAFAKKIVADYYWIDGNDHTSEGTWVDANGRLMTYKNWANNEPNGGRGENCIISHNNLEGAWWDIPCSNKYFAVCSR 523          

HSP 8 Score: 82.8037 bits (203), Expect = 2.172e-12
Identity = 43/116 (37.07%), Postives = 64/116 (55.17%), Query Frame = -3
Query:  183 ISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 530
            ++K    Y + ++ CK++ M LV++T  +DN  V   A K    T+WI+GND  NEG WVD     L Y N+   +PNG K ENC+  +Y  +  WND+ C  +   IC+    +L
Sbjct:   28 VTKVLVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWIDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLM-VYRVNRMWNDLNCVARIWAICQRDPSQL 142          

HSP 9 Score: 82.4185 bits (202), Expect = 3.494e-12
Identity = 38/105 (36.19%), Postives = 64/105 (60.95%), Query Frame = -2
Query: 2668 KMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVIC 2982
            KM +  A+++CK   ++++ IK+   ++ +   ++K+K+  YWIDGNDN  E  WVD+    + Y+N+ SGEP+G R++NC+  +    G W   SC   N V+C
Sbjct:  540 KMTFDGAMAYCKSIGLKMIRIKDPETDRLINGGSLKHKVCSYWIDGNDNEQEDRWVDADKTELSYKNFASGEPSGGREKNCL--IVNKTGQWFAESCRKLNRVVC 642          

HSP 10 Score: 80.8777 bits (198), Expect = 8.845e-12
Identity = 40/111 (36.04%), Postives = 64/111 (57.66%), Query Frame = -3
Query: 2292 LINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2624
             + + ++TY+EA++ C  + + L+ + + + N  V   A      TYWI GND++ EG+WVD+R   L +K +   EPNG + ENC+   R  N  WND+NC  +   IC+
Sbjct:   27 FVTKVLVTYNEAIQSCKARGMVLVRVTSAEDNTIVNGYANKVLADTYWIDGNDHTNEGTWVDARGNQLPYKNFAPHEPNGNKNENCLMVYRV-NRMWNDLNCVARIWAICQ 136          

HSP 11 Score: 73.559 bits (179), Expect = 2.050e-9
Identity = 31/106 (29.25%), Postives = 56/106 (52.83%), Query Frame = -2
Query: 2680 VVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPN 2997
            + + +++ +  A  +CK   +++    +   +  +     +  +  YW+DGND  +EG WVDS    ++++ +  GEPNG R ENC++G      LWND+ C   N
Sbjct:  281 IASHERLTFYEAQDYCKGLGLKMAKANSAAESGMIHGFTRRVYLDLYWLDGNDAKVEGKWVDSDDVELKHKGFYPGEPNGGRNENCINGYLLHDALWNDLPCTYKN 386          
BLAST of SMED30004599 vs. TrEMBL
Match: Q8WSW8 (Scarf3a OS=Girardia tigrina OX=6162 GN=scarf3a PE=2 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 3.976e-82
Identity = 148/354 (41.81%), Postives = 213/354 (60.17%), Query Frame = -3
Query:  204 FYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDG-GKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKG-GRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNG-GKKENCIQGLYFSDGTWNDVKCDMKNKVIC 1256
            ++ +  KMN   A ++C ++ MR+VKI ++         A K+ +  +W++G D A EG WVD +++ L YKNWY  EP+  G  +NC V+    N +W D  C ++NSVICE + +    +H    KM ++ AVKYC ++ M+LVKI   ++N  VYNL++  NLG YW+NGND   +G W D++   L +K W+K EP   G N+NC+    + + +W D  C +LNSVIC+ +      YH +K+K  Y D VKYC  + M LVKI + + N  VY LALK  LGT+W+NGND+A EG WVDT+N+ L Y NW   +PN  G  +NC+   Y  +  W D+ CD  N VIC
Sbjct:   22 YHLNKNKMNYSDAVKYCNSKEMRLVKITDSQTGAAVFELASKNGMGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGDQNCLVAAYHPNEMWFDIGCNTLNSVICEIVIEN---YHTNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNLNVYNLALKHNLGTYWMNGNDIAIKGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVAAYHPNEMWFDIGCNTLNSVICEIV---IENYHTNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNLNVYYLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYTGEPNNWGGNQNCLVAAYHPNEMWFDIGCDTLNSVIC 369          

HSP 2 Score: 251.136 bits (640), Expect = 5.694e-71
Identity = 143/366 (39.07%), Postives = 208/366 (56.83%), Query Frame = -3
Query:  903 YHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDG-GKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGY-RKENC-IQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDG-GKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTK 1988
            YH  + KM Y  AVKYC ++ M LV I +  T   V +L+ +  +  YW+NGND+  EG WVD+ N  L Y NW+  EP+  G  +NC+ +  + +  W D+ C+  NSVICE +      YH  K++MT+NDAV YC  RNM L+ I N   N  V  L  K     YW+NGND + +G W++T+N+ + YKNW+  EP  +   +NC +     N +W D+ C++L  VIC+ +      + N + Y+         A ++C +RNM +VKI N+  N      A+K NL  +W++G D A EG WVD +++ L YKNWY+ EP+  G  +NC V+    N +W D  C ++NSVIC   ND K
Sbjct:   22 YHLNKNKMNYSDAVKYCNSKEMRLVKITDSQTGAAVFELASKNGMGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGDQNCLVAAYHPNEMWFDIGCNTLNSVICEIV---IENYHTNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNLNVYNLALKHNLGTYWMNGNDIAIKGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVAAYHPNEMWFDIGCNTLNSVICEIVIENYHTNKNKMTYND--------AVKYCNDRNMDLVKIPNSEVNLNVYYLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYTGEPNNWGGNQNCLVAAYHPNEMWFDIGCDTLNSVICYNANDKK 376          

HSP 3 Score: 198.749 bits (504), Expect = 2.999e-52
Identity = 102/238 (42.86%), Postives = 144/238 (60.50%), Query Frame = -3
Query:  189 FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKG-GRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNG-GKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVE 896
            +H+   KM +  AVKYC +K+M LVKI   Q    V+ L+    +G YW+NGND   EG W D++   L +K W+K EP   G ++NC+    + + +W D  C +LNSVIC+ +      YH +K+K  Y D VKYC  + M LVKI + + N  VY+LALK  LGT+W+NGND+A +G WVDT+N+ L Y NW   +PN  G  +NC+   Y  +  W D+ C+  N VICE+ +E
Sbjct:   22 YHLNKNKMNYSDAVKYCNSKEMRLVKITDSQTGAAVFELASKNGMGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGDQNCLVAAYHPNEMWFDIGCNTLNSVICEIV---IENYHTNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNLNVYNLALKHNLGTYWMNGNDIAIKGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVAAYHPNEMWFDIGCNTLNSVICEIVIE 256          

HSP 4 Score: 114.39 bits (285), Expect = 1.311e-47
Identity = 57/130 (43.85%), Postives = 85/130 (65.38%), Query Frame = -2
Query: 2665 LNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNG-KRQENCVHGLYYPAGLWNDISCNTPNSVICQ 3051
            LN+VIC    +I+    Y  N  KM Y  AV +C ++NM+L+ I N  +N  V+N+A+K+ +G YW++GND  ++G WVD+++ P+ Y+NW  GEPN     +NC+   Y+P  +W DI CNT NSVIC+
Sbjct:  128 LNSVIC--EIVIEN---YHTNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNLNVYNLALKHNLGTYWMNGNDIAIKGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVAAYHPNEMWFDIGCNTLNSVICE 252          

HSP 5 Score: 107.842 bits (268), Expect = 1.311e-47
Identity = 51/112 (45.54%), Postives = 74/112 (66.07%), Query Frame = -3
Query: 2295 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNG-GRKENCIHGLRYDNEFWNDVNCFHKNMVIC 2627
            Y  N+  MTY++AVK+C ++N+ L+ I N ++N  V+ +A+ +NLGTYW+ GND + EG+WVD+ N  L +K WY GEPN  G  +NC+    + NE W D+ C   N VIC
Sbjct:  258 YHTNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNLNVYYLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYTGEPNNWGGNQNCLVAAYHPNEMWFDIGCDTLNSVIC 369          

HSP 6 Score: 111.694 bits (278), Expect = 6.962e-45
Identity = 52/113 (46.02%), Postives = 77/113 (68.14%), Query Frame = -3
Query: 2292 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNG-GRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2627
            Y  N+  MTY++AVK+C ++N+ L+ I N ++N  V+N+A+ +NLGTYW+ GND + +G+WVD+ N  L +K WY+GEPN  G  +NC+    + NE W D+ C   N VICE
Sbjct:  140 YHTNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNLNVYNLALKHNLGTYWMNGNDIAIKGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVAAYHPNEMWFDIGCNTLNSVICE 252          

HSP 7 Score: 101.293 bits (251), Expect = 6.962e-45
Identity = 49/113 (43.36%), Postives = 70/113 (61.95%), Query Frame = -2
Query: 2665 YVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNG-KRQENCVHGLYYPAGLWNDISCNTPNSVICQ 3000
            Y +N  KM Y+ AV +C  + M L+ I +      VF +A K  +G YW++GND  +EG WVD+++ P+ Y+NW  GEPN     +NC+   Y+P  +W DI CNT NSVIC+
Sbjct:   22 YHLNKNKMNYSDAVKYCNSKEMRLVKITDSQTGAAVFELASKNGMGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGDQNCLVAAYHPNEMWFDIGCNTLNSVICE 134          

HSP 8 Score: 116.316 bits (290), Expect = 5.571e-24
Identity = 59/140 (42.14%), Postives = 88/140 (62.86%), Query Frame = -2
Query: 2635 LNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNG-KRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKSICR 3051
            LN+VIC    +I+    Y  N  KM Y  AV +C ++NM+L+ I N  +N  V+ +A+K+ +G YW++GND  +EG WVD+++ P+ Y+NW +GEPN     +NC+   Y+P  +W DI C+T NSVIC     KK  C+
Sbjct:  246 LNSVIC--EIVIEN---YHTNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNLNVYYLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYTGEPNNWGGNQNCLVAAYHPNEMWFDIGCDTLNSVICYNANDKKISCK 380          

HSP 9 Score: 102.064 bits (253), Expect = 3.771e-19
Identity = 49/113 (43.36%), Postives = 69/113 (61.06%), Query Frame = -3
Query: 2292 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNG-GRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2627
            Y +N+  M Y +AVK+C  K +RL+ I + +    VF +A    +GTYW+ GND + EG+WVD+ N  L +K WY+GEPN  G  +NC+    + NE W D+ C   N VICE
Sbjct:   22 YHLNKNKMNYSDAVKYCNSKEMRLVKITDSQTGAAVFELASKNGMGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGDQNCLVAAYHPNEMWFDIGCNTLNSVICE 134          
BLAST of SMED30004599 vs. Ensembl Cavefish
Match: ENSAMXT00000045912.1 (macrophage mannose receptor 1-like [Source:NCBI gene;Acc:103025801])

HSP 1 Score: 132.88 bits (333), Expect = 7.737e-31
Identity = 191/941 (20.30%), Postives = 332/941 (35.28%), Query Frame = -3
Query:  186 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNG--GRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMR--------------------------HTTNKYHIGKDRMT----FNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYR-KENCIQGLRI---NGLWNDVTCDSLGEVICQ----------PIQNKKRPSSNS-------------LFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGN---WVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHC-QSMNSVICEPINDT-----------------------------KNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQ--WEDSKQNLLSFKKWHKSEPKGGRN-ENCIT--GNNYQDALWNDEKCGSLNSVIC----------QPIKYGPSK----------YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWIN--GNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQ---GLYFSDGTWNDVKCDMKNKVICELKVEK 2642
            F E+ Y   +   T+ +A   C +    L++I +    +      +Y      WI  ND    G ++ S N  + F  W  GEPN   G  E+C+  +   N  WNDV C   N  IC+  +     P I K  +  C   +     + +C + + T   +   + +K+     DK+      S+ ++ +LY++                           H+T    +Y       L                          +D+YW NG+ ++              Y++W   +P+ G       +     GFW +  CDQ +  ICE  R                          H    Y +  +  T    +  A   C  R   L++I N      + +  K   +   W+  + N+ EG +L +D   +S+ NW P EP  +  +ENC++ +     +  WND+ CD+  + +C           P+     P+ +               +Y+ TE ++   A E C +    +  I +  +    ++      ++  WI        G    WVD     ++Y +W   EP+    E   V +    G W+DA+C ++    +C+ +                                K   +   +K  +  A  +CR+++ +L  ID    N+ V +  +   +   WI  +D   E +  W D    +L F  W + EP      E+C++   N+     WNDE C      +C           P    P            Y +    +N+ D    C  +   L  +    D  F+   A++ +    WI    N+  +   W  TD   + Y +W   +P   K E C+      +F  GTWND  CD+    IC++  EK
Sbjct: 1031 FGEFCYRPFDVKKTWYDARSECRKLGADLVSIMS-ITEQSWLESYLYLATSDVWIGLNDLEFSGYFLWSNNHEVTFTYWAPGEPNNHLGFNEDCVE-MYQGNGRWNDVTCTELNTFICKMTKGHYPLPSI-KPTVYGC--PQGWDAFEYSCYWLEETAMTR---AEAKTFCETKDKD-----SSLLHIGDLYEQA--------------------------HFTARLASYSGHWWIGLRAKGESA------------------GVDYYWDNGDFMV--------------YSHWDRNQPESGAGPCVTMTTKPTAGFWVNRNCDQSHPFICEIPRDGISPPTKAPTPPPATGCATGWTSLPHFRQCYRLYTEEYTNKKSWAGAHEDCVARGADLVSIHNAEEEIFMAEYTKGKTQ---WIGLSRNALEGDYLWSDGSALSHTNWGPGEPNDHAGRENCVELVTTQNGSSYWNDIFCDAHQDWVCMIAKGKTPTEPPVPPSAIPAPDCGSNPGWRKNNGICYYYNDTEAVDFFTALERCFHEKALLASILSPEEQTYIVSMVGTGQIAAAWIGMQMFGVAGGEYIWVDLS--PITYVHWAPGEPNNANGEEQCVQMNRYPGTWNDANCGRATAGYVCKKLPGEHHTPPPPTQPWEGNCPEGWMRFHNKCYLFKGNHYNNEIKANWSYARDWCRSQQGDLAVIDDINENDFVASY-LRDMIHPVWIGLSDVLHEDKFAWSDGVSPVL-FTNWAEKEPNNNDGKEHCVSINHNHLLTGRWNDENCNEERGWVCYRKKDSHLPAPPTTKSPCPSDYVSWYKNCYKLVSEHKNWADAEAACVKEGGHLASVDMSYDQAFISG-AIQQERTDAWIGLKRNEETSTYQW--TDGWPVFYTHWGPGEPTIHKGEGCVSMHGRSHFIQGTWNDTACDVAKPYICKITFEK 1890          

HSP 2 Score: 108.612 bits (270), Expect = 2.369e-23
Identity = 152/715 (21.26%), Postives = 267/715 (37.34%), Query Frame = -3
Query:  198 YTRE---KMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEP-DGGKRENCIQSLVYADG--FWNDVECDQPNSVICEPMRHTTNK----------------------------YHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEG---VWLNTDNEEISYKNWHPKEPQGYR-KENCIQGLRINGLWNDVTCD-SLGEVICQPIQNKKRPSSNS--------------------LF----YSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGN--WVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTD---ANGLWDDAHCQSMNSVICEPINDT--------------------KNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGR--YWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCIT---GNNYQDALWNDEKCGSLNSVICQ------PIKYGPSK--------------YHI--SKSKRNYKDGVKYCKS-KKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGG----KKENCIQGLYFSDGTWNDVKCDMKNKVICEL 1982
            YT E   K ++  A + C+A+  +LV+I N A  ++      +    W  ++ N L  EG+++ S+ + LS+TNW   EP D   RENC++ +   +G  +WND+ CD     +C   +  T                              Y+   + + F  A+  C     +L +I +      +  +V        W+        G   +W+  D   I+Y +W P EP     +E C+Q  R  G WND  C  +    +C+ +  +                           LF    Y++  K N   AR++C ++   +  ID+ ++ND   +Y ++  +   WI  +D  +E    W D     L + NW   EP+    +   VS+       G W+D +C      +C    D+                    KN + + S    +  A   C  +   L  +D   M+     +S      R   WI    N +   ++ +    + +  W   EP   + E C++    +++    WND  C      IC+      P+   P                Y +   K+  ++ +   YC+  K   L  +    + +F+ ++   +K    W+      + G W  TD  +L + NW   +PN        E+C++   + DGTWND  C  K    C +
Sbjct: 1329 YTEEYTNKKSWAGAHEDCVARGADLVSIHN-AEEEIFMAEYTKGKTQWIGLSRNAL--EGDYLWSDGSALSHTNWGPGEPNDHAGRENCVELVTTQNGSSYWNDIFCDAHQDWVCMIAKGKTPTEPPVPPSAIPAPDCGSNPGWRKNNGICYYYNDTEAVDFFTALERCFHEKALLASILSPEEQTYIVSMVGTGQIAAAWIGMQMFGVAGGEYIWV--DLSPITYVHWAPGEPNNANGEEQCVQMNRYPGTWNDANCGRATAGYVCKKLPGEHHTPPPPTQPWEGNCPEGWMRFHNKCYLFKGNHYNNEIKANWSYARDWCRSQQGDLAVIDDINENDFVASY-LRDMIHPVWIGLSDVLHEDKFAWSDGVSPVL-FTNWAEKEPNNNDGKEHCVSINHNHLLTGRWNDENCNEERGWVCYRKKDSHLPAPPTTKSPCPSDYVSWYKNCYKLVSEHKNWADAEAACVKEGGHLASVD---MSYDQAFISGAIQQERTDAWIGLKRNEETSTYQWTDGWPVFYTHWGPGEPTIHKGEGCVSMHGRSHFIQGTWNDTACDVAKPYICKITFEKPPVTPAPGDGECMPGFSHYGRYCYFVYNGKTGFSWPEARHYCQLIKGGDLASVHSRAEVEFIRNINY-TKYHNVWLGLTRDGSLG-WGWTDLTALAFTNWAPGEPNEAYHDLGMEDCVE--MYPDGTWNDNNCFQKRGFACRV 2029          

HSP 3 Score: 79.7221 bits (195), Expect = 1.562e-14
Identity = 144/671 (21.46%), Postives = 239/671 (35.62%), Query Frame = -3
Query:  195 LSLQYNIDWYWINGNDLIKEGNWVDSNNN----KLSYTNWHYQEPDGG-KRENCIQSLVYADGFWNDVECDQPNSVICE-------PMRHTTNKYHI---------GKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGND----------NSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRIN------GLWNDVTCDSLGEVICQPIQNKKRP------SSNSLFYSSTEKMNNLAAREF--CANRNMRIVKID--------NASKNDLAMTYAIKSNLSYFWIDGTDSANEG--NWVDYQDQKLSYKNWYSTEPDGGKTE-NCAVSLT-DANGLWDDAHCQSMNSVICE------------PINDTKNGFHI---------TSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRY-WINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGR-NENCI---TGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHI---------------------------SKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLG-TFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELK 1874
            +S Q     +WI  ND++ EGNW  S+ +     L+Y  W   +PD     E+C Q     +G WND  C      IC        P   T N +            + R ++  A   C      L++I++ ++ +            D W+  +             +   +  +D+   SY NW   +P    K+N +    I       G W    C      +C+   N   P        N     S   +     + F  C + N +++ I         NA   DL        ++   WI  +D A +G   WVD  D  + + NW S  P   +   +C    T +  G W+  +C    + IC+            P      G+ +           +   +  A  YC ++   L  I      NQ     +T ++ R  W+  ND  +EGQW+ +  + ++  +W   +P   + NE+C+      +++    ND  C S    ICQ  K                                   S S R + +    C ++   L+ IT+  +  F+         G + W+ G+D   EG W  TD     Y+NW    P+    E+C+  +Y + G WND  CD K   +C+ +
Sbjct:   12 VSTQIGTTIFWIGLNDIVSEGNWEWSDGSVYYPYLAY--WREGQPDNYLDNEDCGQVDGNNNGQWNDEHCTSKRPYICRRDNPNPTPQCDTANGWEQYGSNCYKLNSQLRKSWIAARTDCVMEGGDLVSIQS-AAEQQYVISRLDHSPLDMWIGYSTLKCTTLSCQIQVDGTTFSWSDSSSSSYTNWPNGQPDLTDKQNGVCASMIKDAGDEYGKWKTHVCRYERPYLCKRGLNTICPEGWLSFGGNCYLVVSNNYLLTSWHQAFSRCNSMNGKLLTITSEDEQFFINAQLPDLHQV-----DIPDVWIGISDMAQDGAFKWVDNTD--IQFSNWNSGFPKNTEVYWDCGQIFTGNYAGKWETTNCFKNMAYICKMTGGQNIQPTAAPDFHCDEGYLLYGNYCYHFEAEMSKTWQEAEAYCVSQSGHLASIP-----NQETTSFITAHMPRSSWVGLNDIDQEGQWKWTDGSAITILEWETGQPDNWQDNEDCVHIRGTEHWETGKLNDLPCTSTFPFICQKAKGQGPPPVPPTSGPGWNEKCGSWVADPFNDYCYLFNSLSLRKWAEARADCVNQGGDLLSITEPFEQGFIQAQIQSIPNGVSLWMGGHDSVTEGGWEWTDRAPFRYINWASGNPDDYYGEDCLT-IYINSGYWNDDNCDYKRGYVCKRR 666          

HSP 4 Score: 49.6766 bits (117), Expect = 8.508e-13
Identity = 39/151 (25.83%), Postives = 66/151 (43.71%), Query Frame = -3
Query: 2205 FVEYGYLINE-EIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFN--IAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLEL--CYNSKIRKICQ 2642
            F +Y YL N   +  + EA   C  +   LL+I  E   +      I    N  + W+ G+D   EG W  +     ++  W  G P+    E+C+  +  ++ +WND NC +K   +C+    +P  P     FL +  C +S +   C+
Sbjct:  547 FNDYCYLFNSLSLRKWAEARADCVNQGGDLLSI-TEPFEQGFIQAQIQSIPNGVSLWMGGHDSVTEGGWEWTDRAPFRYINWASGNPDDYYGEDCLT-IYINSGYWNDDNCDYKRGYVCKRRGNTPEPPPPHDGFLTVYTCQDSLLVLHCE 695          

HSP 5 Score: 44.669 bits (104), Expect = 8.508e-13
Identity = 31/121 (25.62%), Postives = 54/121 (44.63%), Query Frame = -2
Query: 2656 YGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEP-NGKRQENCVH---GLYYPAGLWNDISCNTPNSVICQKKK 3006
            Y +   + K  +  A ++C  Q+  L +I N    +   +    +     W+  ND   EG W  +  + +    W++G+P N +  E+CVH     ++  G  ND+ C +    ICQK K
Sbjct:  405 YHFEAEMSK-TWQEAEAYCVSQSGHLASIPN----QETTSFITAHMPRSSWVGLNDIDQEGQWKWTDGSAITILEWETGQPDNWQDNEDCVHIRGTEHWETGKLNDLPCTSTFPFICQKAK 520          

HSP 6 Score: 72.0182 bits (175), Expect = 3.693e-12
Identity = 99/413 (23.97%), Postives = 155/413 (37.53%), Query Frame = -3
Query:  924 GYHYTRE-KMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNN-NKLSYTNWHYQEP---DGGKRENCIQSLVYADGFWNDVECDQPNSVICE-------PMRHTT-------------NKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCI----QGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNS------------------LFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSY-----FWIDGTDSANEG-NWVDYQDQKLSYKNWYSTEPDGG----KTENCAVSLTDANGLWDDAHCQSMNSVIC 1991
            G HY  E K  +  A  +C +Q  +L  ID+   N  V    L+  I   WI  +D++ E  +  S+  + + +TNW  +EP   DG +    I       G WND  C++    +C        P   TT             N Y +  +   + DA   C K    L +++       +   +++    D W+    N E   +  TD   + Y +W P EP  ++ E C+    +   I G WND  CD     IC+ I  +K P + +                    Y+     +   AR +C      I   D AS +  A    I+ N++Y      W+  T   + G  W D     L++ NW   EP+        E+C     D  G W+D +C       C
Sbjct: 1627 GNHYNNEIKANWSYARDWCRSQQGDLAVIDDINENDFVASY-LRDMIHPVWIGLSDVLHEDKFAWSDGVSPVLFTNWAEKEPNNNDGKEHCVSINHNHLLTGRWNDENCNEERGWVCYRKKDSHLPAPPTTKSPCPSDYVSWYKNCYKLVSEHKNWADAEAACVKEGGHLASVDMSYDQAFISGAIQQERT-DAWIGLKRNEETSTYQWTDGWPVFYTHWGPGEPTIHKGEGCVSMHGRSHFIQGTWNDTACDVAKPYICK-ITFEKPPVTPAPGDGECMPGFSHYGRYCYFVYNGKTGFSWPEARHYC----QLIKGGDLASVHSRAEVEFIR-NINYTKYHNVWLGLTRDGSLGWGWTDL--TALAFTNWAPGEPNEAYHDLGMEDCVEMYPD--GTWNDNNCFQKRGFAC 2027          

HSP 7 Score: 71.633 bits (174), Expect = 4.449e-12
Identity = 110/497 (22.13%), Postives = 178/497 (35.81%), Query Frame = -3
Query: 1272 YLI---NEEIMTYDEAVKFCGEKNLRLLTIKNEK----INKRVFNIAVYYNLGTYWITGNDYSKEGS--WVDSRNVSLQFKKWYQGEP-NGGRKENCIHGLRYDNEF---WNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGK-RENCIQ---SLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTFNDAV---------NYCKKRNMV------------------LINI-ENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRP 2627
            YL+   N  + ++ +A   C   N +LLTI +E     IN ++ ++    ++   WI  +D +++G+  WVD  N  +QF  W  G P N     +C  G  +   +   W   NCF KNM                              IC+ T                     NI      D +C   YL  LY   C   E EM+                        T++ A  YC++QS +L +I N+ T   +     + +    W+  ND+ +EG W  ++ + ++   W   +PD  +  E+C+    +  +  G  ND+ C      IC+  +              +N+           +YC   N +                  L++I E      I  ++         W+ G+D+  EG W  TD     Y NW    P  Y  E+C+     +G WND  CD     +C+   N   P
Sbjct:  257 YLVVSNNYLLTSWHQAFSRCNSMNGKLLTITSEDEQFFINAQLPDLH-QVDIPDVWIGISDMAQDGAFKWVD--NTDIQFSNWNSGFPKNTEVYWDC--GQIFTGNYAGKWETTNCF-KNMAY----------------------------ICKMT------------------GGQNIQPTAAPDFHCDEGYL--LYGNYCYHFEAEMSK-----------------------TWQEAEAYCVSQSGHLASIPNQETTSFITAHMPRSS----WVGLNDIDQEGQWKWTDGSAITILEWETGQPDNWQDNEDCVHIRGTEHWETGKLNDLPCTSTFPFICQKAKGQGPPPVPPTSGPGWNEKCGSWVADPFNDYCYLFNSLSLRKWAEARADCVNQGGDLLSITEPFEQGFIQAQIQSIPNGVSLWMGGHDSVTEGGWEWTDRAPFRYINWASGNPDDYYGEDCLTIYINSGYWNDDNCDYKRGYVCKRRGNTPEP 672          

HSP 8 Score: 68.9366 bits (167), Expect = 2.606e-11
Identity = 95/408 (23.28%), Postives = 162/408 (39.71%), Query Frame = -3
Query:  921 TYKSAVKYCLAQSMNLVTIDNE----ATNKLVHDLSLQYNIDWYWINGNDLIKEG--NWVDSNNNKLSYTNWHYQEPDGGKRE-NCIQSLV--YADGFWNDVECDQPNSVICE------------PMRHTTNKYHI---------GKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRK-ENCIQGLRINGLW-----NDVTCDSLGEVICQPIQNKKR---------------------PSSNSLFYSSTEKMNNLA-AREFCANRNMRIVKIDNASKNDL--AMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE 1964
            ++  A   C + +  L+TI +E      N  + DL  Q +I   WI  +D+ ++G   WVD  N  + ++NW+   P   +   +C Q     YA G W    C +  + IC+            P  H    Y +          +   T+ +A  YC  ++  L +I N+ +   +   + +S     WV  ND  +EG W  TD   I+   W   +P  ++  E+C+  +R    W     ND+ C S    ICQ  + +                       P ++  +  ++  +   A AR  C N+   ++ I    +     A   +I + +S  W+ G DS  EG W         Y NW S  PD    E+C +++   +G W+D +C      +C+
Sbjct:  268 SWHQAFSRCNSMNGKLLTITSEDEQFFINAQLPDLH-QVDIPDVWIGISDMAQDGAFKWVD--NTDIQFSNWNSGFPKNTEVYWDCGQIFTGNYA-GKWETTNCFKNMAYICKMTGGQNIQPTAAPDFHCDEGYLLYGNYCYHFEAEMSKTWQEAEAYCVSQSGHLASIPNQETTSFITAHMPRSS----WVGLNDIDQEGQWKWTDGSAITILEWETGQPDNWQDNEDCVH-IRGTEHWETGKLNDLPCTSTFPFICQKAKGQGPPPVPPTSGPGWNEKCGSWVADPFNDYCYLFNSLSLRKWAEARADCVNQGGDLLSITEPFEQGFIQAQIQSIPNGVS-LWMGGHDSVTEGGWEWTDRAPFRYINWASGNPDDYYGEDC-LTIYINSGYWNDDNCDYKRGYVCK 664          

HSP 9 Score: 56.225 bits (134), Expect = 2.014e-7
Identity = 35/122 (28.69%), Postives = 62/122 (50.82%), Query Frame = -2
Query: 2659 DYGYVVN-LQKMAYTTAVSFCKEQNMELLTI----KNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKK 3009
            DY Y+ N L    +  A + C  Q  +LL+I    + G I  ++ ++     +   W+ G+D+  EG W  +   P +Y NW SG P+    E+C+  +Y  +G WND +C+     +C+++
Sbjct:  549 DYCYLFNSLSLRKWAEARADCVNQGGDLLSITEPFEQGFIQAQIQSIPNGVSL---WMGGHDSVTEGGWEWTDRAPFRYINWASGNPDDYYGEDCL-TIYINSGYWNDDNCDYKRGYVCKRR 666          
BLAST of SMED30004599 vs. Ensembl Cavefish
Match: mrc1a (mannose receptor C-type 1 [Source:NCBI gene;Acc:103028880])

HSP 1 Score: 118.627 bits (296), Expect = 1.546e-26
Identity = 148/696 (21.26%), Postives = 256/696 (36.78%), Query Frame = -3
Query:  201 TREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNI--DWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVEC-----------------------DQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYR--KENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLF----------YSSTEKMNNLAAREF------CANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWI--DGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENC-AVSLTDANGLWDDAHCQSMNSVICEPIND---------TKNGFHITSVKMKFDT-------------------AVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGN--DNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNYQDALWNDEKCGSLNSVICQ------P-------------------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPN-GGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 1979
            T+  +T+  A K C  Q  +L++I        +  L+   NI     WI  N L  E  W  SN N   Y NW    P      NC+         W  + C                       DQP+      + ++ + Y I +++M + DA++ C K    L +I N   +  +      +   + W+  ND   + ++  +D   +++  W   EP      +E+C+     +G W D  C+   + IC+   + K   S+ +           YSS      + A++F      C      +V++    +N   ++        YFWI    T+ A+   W +   + +++ ++    PD  + + C A+    + GLWD   C +    IC+ + +         T       S  +K D+                   A  YCR    +L     +   N    L    +    WI  +  D      W D   +  ++  W   EP    + E+C   + Y    WND  C S N  ICQ      P                   I++  S+Y+I+  + +  D   +CK     LV IT   + +F++    +     ++I G  V  +  +   D   + Y +W+  +PN     ENC+  +Y S G WND+ C +    IC+
Sbjct:  235 TQSVLTWHQARKSCQQQGADLLSIVELHEQTYISGLT---NILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTITPSGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVLMKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTN--KETVAFTHFNVGLPD--RRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNA---LPYGGSSDPAWIGFSSLDTNVGFVWSDETPS--NYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYI-GMTVGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVT-IYKSMGFWNDINCGVSLPSICK 916          

HSP 2 Score: 116.701 bits (291), Expect = 5.191e-26
Identity = 156/705 (22.13%), Postives = 262/705 (37.16%), Query Frame = -3
Query:  183 EKMTYKSAVKYCLAQSMNLVTIDNE-ATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDG-GKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNK-------------------------YHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVN---GNDNSEEGVWLNTDNEEISYKNWHPKEPQ-GYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSL--------------------FYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEP----DG----GKTENCAVSLTDAN---GLWDDAHCQSMNSVICEPINDTK------------------NGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC-------------------QPIKYG---PSKYH----ISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYD--LALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 1973
            +K T+  A  YC A   +L +  +E  TN L +  S     D  WI  + L     +V S+    +Y NW Y EP+     E+C ++  Y    WND  C+  N  IC+    TT K                         Y+I  DR++ +DA  +CKK +  L+ I  ++  + + K + +  +  Y++    G D S   V    D   + Y +W   EP      ENC+   +  G WND+ C      IC+   N    ++                       F     + +   AR++C ++   +V I + ++     T  + ++    WI   D   E  ++    + +++ NW    P    DG    G   +C + + D +   G+W    C      IC+   D++                  N + + + KM +D A + C+    +L  +  D +   +  L         WI  N N   G++      LL + KW   EPK  RN  C+  +   D  W    C +    +C                   +P ++    P + H    ++    N+      C     S+V + D  +  F+      L+    +FWI G    +EG W+  DN  + Y NW  R P      +C++ +    G W   +C      IC  K EK+
Sbjct:  668 DKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGS----SDPAWIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMTVGLDKSFSWV----DGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMMLSAS-DDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADFDCVIMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQIQVQPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASVL-DTVTEALAMLRFNRFKEPVWIGLNSNLTSGRYRWVDNWLLRYTKWAPGEPK--RNLACVYIDT--DGTWKTADCSNTYFSLCKRSSEIAPTEPPQLPGNCPEPKRHKTWIPFRGHCYAFLAARSENWAHATVECMRMGASMVSVEDGLEAAFIQRNLEILQDDSKSFWI-GMHRNHEGEWMWIDNMVVDYTNWAPRMPTA--YGDCVE-VRSDSGLWYTTRCSGYRAYIC--KTEKV 1352          

HSP 3 Score: 111.309 bits (277), Expect = 3.001e-24
Identity = 151/716 (21.09%), Postives = 271/716 (37.85%), Query Frame = -3
Query:  189 YHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGK--RENCIQSLVYADGFWNDVECDQPNSVICEP---------------------MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCI--QGLRINGLWNDVTCDSLGEVICQPIQ-----NKKRPSSNSLFYSST------------------EKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDG-GKTENCAVSLTDANGLWDDAHCQSMNSVICE----------PINDTKNGFHIT---------------SVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWIN---GNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNYQDALWNDEKCG-SLNSVICQPIKYGPS------------------------KYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWN----IRQPNG----GKKENCIQGLYFSD-----GTWNDVKCDMKNKVICELKVE 1988
            Y   R KM ++ A+  C      L +I N   +  +   S     D  WI  ND   +  +  S+   +++  W   EP      RE+C+  +   DG W D  C++ +  IC+                      +R++++ Y I  +   FNDA   C++    L+ +     N  +  L+    +  +W+  ++      +  T+ E +++ +++   P   R++ C+  Q     GLW+  +CD+  + IC+ +       K+ P++  L   S                   +K     AR++C      +    +  + + A+ Y   S+ ++      D+     W D  +   +Y NW   EP+     E+C  +       W+D  C+S N  IC+          P    +  F+IT               + ++  D A  +C+    +LV I G      ++         +Y+I    G D  K   W D     + +  W ++EP    N ENC+T        WND  CG SL S+  +   +  S                        K+    S++++ D  +YC S+  +LV I    +  F+  + L S     WI  NDV  E  ++ TD + +T+ NW     +  P+G    G   +C+  +   D     G W    C  K   IC+  ++
Sbjct:  374 YSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVL-MKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPD--RRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETN-ALPYGGSSDPAWIGFSSLDTNVGFVWSD--ETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMTVGLD--KSFSWVDGSP--VVYTSWDQNEPNFANNDENCVTIYKSM-GFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMML-SASDDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADFDCV--IMVKDPSRMTGMWKVEDCSEKRGFICKRNID 1075          

HSP 4 Score: 81.6481 bits (200), Expect = 3.579e-15
Identity = 141/710 (19.86%), Postives = 245/710 (34.51%), Query Frame = -3
Query:  189 YHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLV-YADGFWNDVECDQPNSVICEPM------------------------RHTTNKYHIGK----DRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRK-ENCIQGLRING-LWNDVTCDSLGEVICQ----------PIQNKKRPSS----------NSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEG-NWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE-----------PINDTKNG-------FHITSVKM-------KFDTAVKYCRNKKMELVKI--DGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQ--WEDSKQNLLSFKKWHKSEPKG--------GRNENCIT---GNNYQDALWNDEKCGSLNSVIC----------QP--------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVE 1988
            Y    E   +  A   C   + +LV +     N  +  L       ++WI  ++  +   +  +N   +++T+++   PD  +R+ C+      + G W+   CD     IC+ M                        + +T+   + K    D+ T+ +A +YC+     L +  +E     +            W+  +       ++ +D    +Y NW   EP  Y   E+C +     G  WND  C+S  + ICQ          P Q+ +   +           S +Y +T++++   AR FC   +  +V I   ++         +     ++I  T   ++  +WVD     + Y +W   EP+    +   V++  + G W+D +C      IC+           P    K G       FH    K         +  A +YC ++   LV I    +Q       LS + ++   WI  ND   E +  W D K   ++F  W K  P          G + +C+      +    +W  E C      IC          QP           G + Y +   K ++ +  + CK+    L  + D         L         WI  N     G +   DN  L Y  W   +P    K N       +DGTW    C      +C+   E
Sbjct:  516 YSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPD--RRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGSSDPA---WIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMTVGLDKSFSWVD--GSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMMLSASDDM---WIGLNDVNWEMRFLWTDGKG--VTFTNWAKGHPVSIPDGRRSYGADFDCVIMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQIQVQPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASVLDTVTEALAM-LRFNRFKEPVWIGLNSNLTSGRYRWVDNWLLRYTKWAPGEP----KRNLACVYIDTDGTWKTADCSNTYFSLCKRSSE 1208          

HSP 5 Score: 78.9518 bits (193), Expect = 2.436e-14
Identity = 77/362 (21.27%), Postives = 126/362 (34.81%), Query Frame = -3
Query:  177 SYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTK-----------------------NGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN--ENCITGNNYQDALWNDEKCGSLNSVICQP---------------------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCI-QGLYFSDGTWNDVKCDMKNKVICELKVEKL*T 1121
            S  WI       E  W         Y NW    P      NC          W+   C      IC   N T                        + + I   KM +  A+  C     EL  I   + ++ + + S        WI  ND + +  +E S +  ++F KW   EP    N  E+C+     +D  W D  C   +  IC+                      I+Y    Y I+   + + D    C+    SLV+++   +N F+  L        FWI  ++      +  T+ E++ + ++N+  P+  +++ C+      S G W+   CD K K IC+   E + T
Sbjct:  276 SALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTITPSGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVLMKG-KDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPD--RRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTT 634          

HSP 6 Score: 47.3654 bits (111), Expect = 5.141e-10
Identity = 34/122 (27.87%), Postives = 55/122 (45.08%), Query Frame = -2
Query: 2641 YVVNLQK-MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIG-YYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKSI 3000
            Y  N Q  + +  A   C++Q  +LL+I    ++++ +   +   +G   WI  N    E  W  S  NP +Y NW  G P+ +   NCV      A  W  ++CN     IC+K  +  +I
Sbjct:  231 YQRNTQSVLTWHQARKSCQQQGADLLSIVE--LHEQTYISGLTNILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTI 350          

HSP 7 Score: 37.3502 bits (85), Expect = 5.141e-10
Identity = 28/114 (24.56%), Postives = 49/114 (42.98%), Query Frame = -3
Query: 2292 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGR--KENCIHGLRYDNEFWNDVNCFHKNMVICE 2627
            Y I    M + +A+  C +    L +I N + +  + + + Y      WI  ND   +  +  S    + F KW  GEP+     +E+C+     D + W D  C  ++  IC+
Sbjct:  374 YSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVLMKGKDGK-WADHMCEKEHDFICK 486          

HSP 8 Score: 41.9726 bits (97), Expect = 2.088e-9
Identity = 35/116 (30.17%), Postives = 52/116 (44.83%), Query Frame = -3
Query: 2292 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWI---TGNDYSKEGSWVDSRNVSLQFKKWYQGEPN-GGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2627
            Y IN + ++ D+A  FC + +  L+ I  +   + ++          Y+I    G D  K  SWVD   V   +  W Q EPN     ENC+  +     FWND+NC      IC+
Sbjct:  806 YYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMTVGLD--KSFSWVDGSPVV--YTSWDQNEPNFANNDENCVT-IYKSMGFWNDINCGVSLPSICK 916          

HSP 9 Score: 40.4318 bits (93), Expect = 2.088e-9
Identity = 20/50 (40.00%), Postives = 24/50 (48.00%), Query Frame = -2
Query: 2665 SKSNPMQYQNWKSGEPNGKRQ-ENCVHGLYYPAGLWNDISCNTPNSVICQ 2811
            S   P  Y NW  GEPN     E+C    +Y    WND +C + N  ICQ
Sbjct:  723 SDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQ 772          

HSP 10 Score: 51.9878 bits (123), Expect = 3.843e-7
Identity = 34/116 (29.31%), Postives = 57/116 (49.14%), Query Frame = -2
Query: 2662 YVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGY--WVDSKSNPMQYQNWKSGEPN-GKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3000
            Y +N  +++   A +FCK+ + +L+ I      + ++    +     Y+I G   G++    WVD   +P+ Y +W   EPN     ENCV  +Y   G WNDI+C      IC++
Sbjct:  806 YYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYI-GMTVGLDKSFSWVDG--SPVVYTSWDQNEPNFANNDENCV-TIYKSMGFWNDINCGVSLPSICKR 917          

HSP 11 Score: 23.0978 bits (48), Expect = 3.843e-7
Identity = 25/127 (19.69%), Postives = 52/127 (40.94%), Query Frame = -3
Query: 2292 YGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGS--WVDSRNVSLQFKKWYQGEP---NGGRKE-----NCIHGLRYDNE---FWNDVNCFHKNMVICE 2633
            Y ++  +   ++ +A ++C  +   L++I++    +      +       WI  ND + E    W D + V+  F  W +G P     GR+      +C+  ++  +     W   +C  K   IC+
Sbjct:  948 YKFVGKDSEKSWHDARQYCISQGGNLVSIRSHA-EQAFLTTMMLSASDDMWIGLNDVNWEMRFLWTDGKGVT--FTNWAKGHPVSIPDGRRSYGADFDCVIMVKDPSRMTGMWKVEDCSEKRGFICK 1071          
BLAST of SMED30004599 vs. Ensembl Cavefish
Match: mrc1a (mannose receptor C-type 1 [Source:NCBI gene;Acc:103028880])

HSP 1 Score: 118.242 bits (295), Expect = 1.842e-26
Identity = 147/696 (21.12%), Postives = 255/696 (36.64%), Query Frame = -3
Query:  201 TREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNI--DWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVEC-----------------------DQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYR--KENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLF----------YSSTEKMNNLAAREF------CANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWI--DGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENC-AVSLTDANGLWDDAHCQSMNSVICEPIND---------TKNGFHITSVKMKFDT-------------------AVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGN--DNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNYQDALWNDEKCGSLNSVICQP-------------------------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPN-GGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 1979
            T+  +T+  A K C  Q  +L++I        +  L+   NI     WI  N L  E  W  SN N   Y NW    P      NC+         W  + C                       DQP+      + ++ + Y I +++M + DA++ C K    L +I N   +  +      +   + W+  ND   + ++  +D   +++  W   EP      +E+C+     +G W D  C+   + IC+   + K   S+ +           YSS      + A++F      C      +V++    +N   ++        YFWI    T+ A+   W +   + +++ ++    PD  + + C A+    + GLWD   C +    IC+ + +         T       S  +K D+                   A  YCR    +L     +   N    L    +    WI  +  D      W D   +  ++  W   EP    + E+C   + Y    WND  C S N  ICQ                          I++  S+Y+I+  + +  D   +CK     LV IT   + +F++    +     ++I G  V  +  +   D   + Y +W+  +PN     ENC+  +Y S G WND+ C +    IC+
Sbjct:  235 TQSVLTWHQARKSCQQQGADLLSIVELHEQTYISGLT---NILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTITPSGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVLMKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTN--KETVAFTHFNVGLPD--RRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNA---LPYGGSSDPAWIGFSSLDTNVGFVWSDETPS--NYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYI-GMTVGLDKSFSWVDGSPVVYTSWDQNEPNFANNDENCVT-IYKSMGFWNDINCGVSLPSICK 916          

HSP 2 Score: 109.768 bits (273), Expect = 9.082e-24
Identity = 141/666 (21.17%), Postives = 253/666 (37.99%), Query Frame = -3
Query:  300 YHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGK--RENCIQSLVYADGFWNDVECDQPNSVICEP---------------------MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCI--QGLRINGLWNDVTCDSLGEVICQPIQ-----NKKRPSSNSLFYSS------------------TEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDG-GKTENCAVSLTDANGLWDDAHCQSMNSVICE----------PINDTKNGFHIT---------------SVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWIN---GNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNYQDALWNDEKCG-SLNSVICQPIKYGPS------------------------KYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQP 1988
            Y   R KM ++ A+  C      L +I N   +  +   S     D  WI  ND   +  +  S+   +++  W   EP      RE+C+  +   DG W D  C++ +  IC+                      +R++++ Y I  +   FNDA   C++    L+ +     N  +  L+    +  +W+  ++      +  T+ E +++ +++   P   R++ C+  Q     GLW+  +CD+  + IC+ +       K+ P++  L   S                   +K     AR++C      +    +  + + A+ Y   S+ ++      D+     W D  +   +Y NW   EP+     E+C  +       W+D  C+S N  IC+          P    +  F+IT               + ++  D A  +C+    +LV I G      ++         +Y+I    G D  K   W D     + +  W ++EP    N ENC+T        WND  CG SL S+  +   +  S                        K+    S++++ D  +YC S+  +LV I    +  F+  + L S     WI  NDV  E  ++ TD + +T+ NW    P
Sbjct:  374 YSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVL-MKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPD--RRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETN-ALPYGGSSDPAWIGFSSLDTNVGFVWSD--ETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMTVGLD--KSFSWVDGSP--VVYTSWDQNEPNFANNDENCVTIYKSM-GFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMML-SASDDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHP 1027          

HSP 3 Score: 106.686 bits (265), Expect = 8.022e-23
Identity = 154/728 (21.15%), Postives = 265/728 (36.40%), Query Frame = -3
Query:  183 EKMTYKSAVKYCLAQSMNLVTIDNE-ATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDG-GKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNK-------------------------YHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVN---GNDNSEEGVWLNTDNEEISYKNWHPKEPQ-GYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSL--------------------FYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSN-------------LSYFWIDGTDSA----NEGNWVDYQDQKLSY----KNWYSTEPDGGKTE----------NCAVSLTDAN---GLWDDAHCQSMNSVICEPINDTK------------------NGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC-------------------QPIKYG---PSKYH----ISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYD--LALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 1973
            +K T+  A  YC A   +L +  +E  TN L +  S     D  WI  + L     +V S+    +Y NW Y EP+     E+C ++  Y    WND  C+  N  IC+    TT K                         Y+I  DR++ +DA  +CKK +  L+ I  ++  + + K + +  +  Y++    G D S   V    D   + Y +W   EP      ENC+   +  G WND+ C      IC+   N    ++                       F     + +   AR++C ++   +V I + ++     T  + ++             + + W DG         +G+ V   D + SY     +++    +  + +          +C + + D +   G+W    C      IC+   D++                  N + + + KM +D A + C+    +L  +  D +   +  L         WI  N N   G++      LL + KW   EPK  RN  C+  +   D  W    C +    +C                   +P ++    P + H    ++    N+      C     S+V + D  +  F+      L+    +FWI G    +EG W+  DN  + Y NW  R P      +C++ +    G W   +C      IC  K EK+
Sbjct:  668 DKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGS----SDPAWIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRLGTTPKAPPTQSPQAKFNITDDGWIQFNGSQYYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMTVGLDKSFSWV----DGSPVVYTSWDQNEPNFANNDENCVTIYKSMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMMLSASDDMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADSDDFFRPMWEHSRAKRSMWIEEIKFDCVIMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQIQVQPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASVL-DTVTEALAMLRFNRFKEPVWIGLNSNLTSGRYRWVDNWLLRYTKWAPGEPK--RNLACVYIDT--DGTWKTADCSNTYFSLCKRSSEIAPTEPPQLPGNCPEPKRHKTWIPFRGHCYAFLAARSENWAHATVECMRMGASMVSVEDGLEAAFIQRNLEILQDDSKSFWI-GMHRNHEGEWMWIDNMVVDYTNWAPRMPTA--YGDCVE-VRSDSGLWYTTRCSGYRAYIC--KTEKV 1376          

HSP 4 Score: 78.9518 bits (193), Expect = 2.172e-14
Identity = 77/362 (21.27%), Postives = 126/362 (34.81%), Query Frame = -3
Query:  177 SYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTK-----------------------NGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN--ENCITGNNYQDALWNDEKCGSLNSVICQP---------------------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCI-QGLYFSDGTWNDVKCDMKNKVICELKVEKL*T 1121
            S  WI       E  W         Y NW    P      NC          W+   C      IC   N T                        + + I   KM +  A+  C     EL  I   + ++ + + S        WI  ND + +  +E S +  ++F KW   EP    N  E+C+     +D  W D  C   +  IC+                      I+Y    Y I+   + + D    C+    SLV+++   +N F+  L        FWI  ++      +  T+ E++ + ++N+  P+  +++ C+      S G W+   CD K K IC+   E + T
Sbjct:  276 SALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTITPSGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVLMKG-KDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPD--RRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTT 634          

HSP 5 Score: 71.2478 bits (173), Expect = 5.020e-12
Identity = 103/542 (19.00%), Postives = 196/542 (36.16%), Query Frame = -3
Query:  192 MTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQ-GLRINGLWNDVTCDSLGEVICQ---------PIQNKKRPS---------SNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQ-KLSYKNWYSTEPDGGK--TENCAVSLTDANGLWDDAHCQSMNSVICE------------------PINDTKNGFHITSVKM---KFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDA-LWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKI----TDDKDNKFV---YDLALKSKLGTF------------------WINGNDVANEGHWVDTDNESLTYLNWNIRQPNG-GKKENCIQGLYFSDGTWNDVKCDMKNKVICELKV 1607
            +T++ A   C+++   L++I  E   +     +   L    W+  N    E  W  ++     Y NW P  P      NC+         W  + C+     IC+         P   K +PS         S   +     KM    A   C      +  I N  ++   ++ +  +     WI   D   + N  ++ D+  +++  W   EP       E+C V +   +G W D  C+  +  IC+                  P    +   H  S+ +   KF+ A   C+     LV++ G   N  + +L        +WI  ++  +  +++ + +  ++F  ++   P   R + C+       A LW+ + C +    IC+ +  G +      + +      K+ K    S +++     +DK   F    Y  A+   L +F                  WI  + +     +V +D     Y NW+  +PN     E+C +  ++    WND  C+  N  IC++++
Sbjct:  239 LTWHQARKSCQQQGADLLSIV-ELHEQTYISGLTNILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTITPSGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQ-NLFEWSDRTHVTFAKWLVGEPSHATNLREDC-VLMKGKDGKWADHMCEKEHDFICKKKASIKPAGSHEIISPGCPAGWIRYSSHCYSIAVEAKKFNDAKTTCQQSAASLVQVSGRYENAFLVSLIGLRPEKYFWIGLSNTERADRFQWTNKETVAFTHFNVGLPD--RRQGCVAMQTGTSAGLWDIQSCDTKQKYICKKMAEGVTTTKEPPTTQPLSCPSKWIKKDSTSCIRVYKSKNEDKKTWFEARDYCRAVGGDLASFHSEDETNALPYGGSSDPAWIGFSSLDTNVGFVWSDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQIRL 775          

HSP 6 Score: 68.5514 bits (166), Expect = 3.184e-11
Identity = 126/599 (21.04%), Postives = 216/599 (36.06%), Query Frame = -3
Query:  543 YHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGN-DLIKEGNWVDSNNNKLSYTNWHYQEPD-GGKRENCIQSLVYADGFWNDVECDQPNSVICE--------PMRHTT----------NKYH------IGKD-RMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNW---HPKE-PQGYR----------------------------KENCIQGL----RINGLWNDVTCDSLGEVICQ-----PIQNKKRPSSNSLFYS--------STEKMNNLAAREFCANRNMRIVKIDNASKNDLAMT----------YAIKSNLS---YFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE-------------PINDTKNGFHITSVKMK-------------FDTAVKYCRNKKMELVKI-DGDQMNNQVYNLSVTFNLGR-YWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGP 1988
            Y+   ++++   A  +C     +LV I  +   + +     +   D Y+I     L K  +WVD   + + YT+W   EP+     ENC+ ++  + GFWND+ C      IC+            TT            +H      +GKD   +++DA  YC  +   L++I + +    +  ++  +   D W+  ND + E  +L TD + +++ NW   HP   P G R                            K +C+  +    R+ G+W    C      IC+      IQ +    S+  +++         TEKM+   AR  C   +  +  + +     LAM             + SNL+   Y W+D        NW+      L Y  W   EP      N A    D +G W  A C +    +C+             P N  +   H T +  +             +  A   C      +V + DG +      NL +  +  + +WI  + N  EG+W      ++ +  W    P      +C+   +    LW   +C    + IC+  K  P
Sbjct:  806 YYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMTVGLDKSFSWVD--GSPVVYTSWDQNEPNFANNDENCV-TIYKSMGFWNDINCGVSLPSICKRSANFATSTAAPTTIPKGGCAPEWTSFHGKCYKFVGKDSEKSWHDARQYCISQGGNLVSIRSHAEQAFLTTMMLSASD-DMWIGLNDVNWEMRFLWTDGKGVTFTNWAKGHPVSIPDGRRSYGADSDDFFRPMWEHSRAKRSMWIEEIKFDCVIMVKDPSRMTGMWKVEDCSEKRGFICKRNIDSQIQVQPTTVSSKAYFAMGNNSYKLQTEKMSWDEARRQCKADDADLASVLDTVTEALAMLRFNRFKEPVWIGLNSNLTSGRYRWVD--------NWL------LRYTKWAPGEPK----RNLACVYIDTDGTWKTADCSNTYFSLCKRSSEIAPTEPPQLPGNCPEPKRHKTWIPFRGHCYAFLAARSENWAHATVECMRMGASMVSVEDGLEAAFIQRNLEILQDDSKSFWIGMHRNH-EGEWMWIDNMVVDYTNWAPRMPTA--YGDCVEVRS-DSGLWYTTRCSGYRAYICKTEKVIP 1378          

HSP 7 Score: 47.3654 bits (111), Expect = 5.257e-10
Identity = 34/122 (27.87%), Postives = 55/122 (45.08%), Query Frame = -2
Query: 2641 YVVNLQK-MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIG-YYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKSI 3000
            Y  N Q  + +  A   C++Q  +LL+I    ++++ +   +   +G   WI  N    E  W  S  NP +Y NW  G P+ +   NCV      A  W  ++CN     IC+K  +  +I
Sbjct:  231 YQRNTQSVLTWHQARKSCQQQGADLLSIVE--LHEQTYISGLTNILGSALWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLNCVALNAGKASKWESMACNKKLGYICRKGNSTSTI 350          

HSP 8 Score: 37.3502 bits (85), Expect = 5.257e-10
Identity = 28/114 (24.56%), Postives = 49/114 (42.98%), Query Frame = -3
Query: 2292 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGR--KENCIHGLRYDNEFWNDVNCFHKNMVICE 2627
            Y I    M + +A+  C +    L +I N + +  + + + Y      WI  ND   +  +  S    + F KW  GEP+     +E+C+     D + W D  C  ++  IC+
Sbjct:  374 YSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFIISQSGYTPTDEIWIGLNDQKTQNLFEWSDRTHVTFAKWLVGEPSHATNLREDCVLMKGKDGK-WADHMCEKEHDFICK 486          

HSP 9 Score: 41.9726 bits (97), Expect = 2.017e-9
Identity = 35/116 (30.17%), Postives = 52/116 (44.83%), Query Frame = -3
Query: 2292 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWI---TGNDYSKEGSWVDSRNVSLQFKKWYQGEPN-GGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2627
            Y IN + ++ D+A  FC + +  L+ I  +   + ++          Y+I    G D  K  SWVD   V   +  W Q EPN     ENC+  +     FWND+NC      IC+
Sbjct:  806 YYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYIGMTVGLD--KSFSWVDGSPVV--YTSWDQNEPNFANNDENCVT-IYKSMGFWNDINCGVSLPSICK 916          

HSP 10 Score: 40.4318 bits (93), Expect = 2.017e-9
Identity = 20/50 (40.00%), Postives = 24/50 (48.00%), Query Frame = -2
Query: 2665 SKSNPMQYQNWKSGEPNGKRQ-ENCVHGLYYPAGLWNDISCNTPNSVICQ 2811
            S   P  Y NW  GEPN     E+C    +Y    WND +C + N  ICQ
Sbjct:  723 SDETPSNYDNWSYGEPNNYNDIEHCTEASFYYGHRWNDRACESYNDWICQ 772          

HSP 11 Score: 51.9878 bits (123), Expect = 4.055e-7
Identity = 34/116 (29.31%), Postives = 57/116 (49.14%), Query Frame = -2
Query: 2662 YVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGY--WVDSKSNPMQYQNWKSGEPN-GKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3000
            Y +N  +++   A +FCK+ + +L+ I      + ++    +     Y+I G   G++    WVD   +P+ Y +W   EPN     ENCV  +Y   G WNDI+C      IC++
Sbjct:  806 YYINTDRLSMDDARAFCKKNHSDLVVITGQTERRFIWKQISRGTEDQYYI-GMTVGLDKSFSWVDG--SPVVYTSWDQNEPNFANNDENCV-TIYKSMGFWNDINCGVSLPSICKR 917          

HSP 12 Score: 23.0978 bits (48), Expect = 4.055e-7
Identity = 17/83 (20.48%), Postives = 36/83 (43.37%), Query Frame = -3
Query: 2391 YGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGS--WVDSRNVSLQFKKWYQGEP 2633
            Y ++  +   ++ +A ++C  +   L++I++    +      +       WI  ND + E    W D + V+  F  W +G P
Sbjct:  948 YKFVGKDSEKSWHDARQYCISQGGNLVSIRSHA-EQAFLTTMMLSASDDMWIGLNDVNWEMRFLWTDGKGVT--FTNWAKGHP 1027          
BLAST of SMED30004599 vs. Ensembl Cavefish
Match: mrc2 (mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GENE-090915-5])

HSP 1 Score: 116.701 bits (291), Expect = 5.896e-26
Identity = 139/708 (19.63%), Postives = 261/708 (36.86%), Query Frame = -3
Query:  201 LKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTT--------------------------NKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYR--KENCIQGLRINGLWNDVTCDSLGEVICQPIQNKK-------------RPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNS-VICE------------------------PINDTKNG--------FHITSV--KMKFDTAVKYCRNKKMELVKIDGDQMNNQVYN-LSVTF----NLGRYWI-NGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC---------QP----------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKS---KLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 2012
            + N  +F +  T   +++  A   C  Q  +L++I        ++ L   Y+    W+  NDL   G W  +++  L Y NW   +P+  + +NC      + G W + +C      IC+   + T                            Y +  D++ +N A   C+K +  L++I      + +   +KK +  + W+  +D + +  +  TD   + +  WHP EP  +   +E+C+      G WND  C+     IC+    K              +  S + F+   E +    AR  CA++N  +V I+N  +     +     +  +FW+   +  + G +     ++L+Y NW   +P   K    A++   A GLW+   C +  S  IC                         P +   +G        FH   +  K+ +  A  +CR    EL    G      ++  L   F    +  ++WI  G   R    W  S  + +S++ + +      R        N  D  W   +C +    IC         +P          + +  ++Y + + +  ++   + C     SL  I  +++ +F+     K    K   +WI       +G +  +D   L Y++W   QP    ++     +  S G W D KC +    +C+
Sbjct:  250 MDNCYQFNFQAT---LSWSEARTSCQQQGADLLSIIKVEEQSYINGLLTGYSAA-LWMGLNDLDLNGGWQWADSAPLKYLNWEADQPNHEEDQNCAVIRTESSGRWQNRDCSVALPYICKKRPNATLDPFTTESWADDGQYQCDLGWQNFQAGCYRLNSDKLDWNSAQKTCQKMDAHLVSIHTLPELEFITVHMKKDVD-ELWIGLHDTAMQMNFEWTDRTPVIFTFWHPFEPNNFHNTQEDCVTMWGPEGRWNDSPCNFSLPSICKKAAQKIDGRIQDHGCRKGWKWHSPACFWVGEEPITFNTARRACASKNSSLVVINNRFEQAFVNSLVFGRSEDHFWLGLHNENSTGPFHWLTGEELTYTNWNRDQPASIKGGCVAMATGHATGLWEVKECSTARSKYICRQDKGSTVPPTPPKPQPTPSLTGTCPSDWKTSGTLRHCYKVFHAGQLEKKLTWIQAHTFCRKHGAELASFSGPDEEAFIFQVLHGAFGEEDDHEQHWIWIGLSRRDSESWTWSDGSAVSYQNFGRDAYSTAR----CGAANPADMNWLKAECDTELDWICKIPKGKAEVEPEITEDSGQEWVDFQEAQYKLFEHRTTWEQAQRICSWFHASLASIHSNEEKQFLAGTVRKMSNIKSDLWWIGLYTYEKDGRYRWSDQSVLNYVSWGPGQPRPPTRDRKCVHISASKGEWADQKCHLDLPYVCK 948          

HSP 2 Score: 83.1889 bits (204), Expect = 1.081e-15
Identity = 135/714 (18.91%), Postives = 254/714 (35.57%), Query Frame = -3
Query:  186 EKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNS-VICE--------------------------------PMRHTTNKYHIGK--DRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFD-----YWV-NGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTE--------------KMNNLAAREFCANRNMRIVKI-DNASKNDLAMTYAIKSNL-SYFWIDGTDSANEGNWVDYQDQK-LSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPIN-------------------DTKNGF---------HITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGN---------NYQDALWNDEKC-GSLNSVIC--------------------QPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWIN-GNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMK-NKVICELKVEK 1973
            E +T+ +A + C +++ +LV I+N      V+ L    + D +W+  ++    G +      +L+YTNW+  +P   K      +  +A G W   EC    S  IC                                  +RH    +H G+   ++T+  A  +C+K    L +         + +++  +   +     +W+  G    +   W  +D   +SY+N+       Y    C      +  W    CD+  + IC+  + K          S  E              +     A+  C+  +  +  I  N  K  LA T    SN+ S  W  G  +  +     + DQ  L+Y +W   +P     +   V ++ + G W D  C      +C+ +N                   D  + F            + ++ +  A   C ++  +L  +       Q + +++  N   +   G     EGQ+  ++  LLS+  W   EP   R  +  +GN         +    +W+   C G  +  IC                     P+++   +Y + + K +++  ++ C+S   SL  + D + + ++  L L +     WI+  ND      W+    E +T+ +W     +G  K     G   + G W    CD K    ICE+  E+
Sbjct:  543 EPITFNTARRACASKNSSLVVINNRFEQAFVNSLVFGRSEDHFWLGLHNENSTGPFHWLTGEELTYTNWNRDQPASIKGGCVAMATGHATGLWEVKECSTARSKYICRQDKGSTVPPTPPKPQPTPSLTGTCPSDWKTSGTLRHCYKVFHAGQLEKKLTWIQAHTFCRKHGAELASFSGPDEEAFIFQVLHGAFGEEDDHEQHWIWIGLSRRDSESWTWSDGSAVSYQNF---GRDAYSTARCGAANPADMNWLKAECDTELDWICKIPKGKAEVEPEITEDSGQEWVDFQEAQYKLFEHRTTWEQAQRICSWFHASLASIHSNEEKQFLAGTVRKMSNIKSDLWWIGLYTYEKDGRYRWSDQSVLNYVSWGPGQPRPPTRDRKCVHISASKGEWADQKCHLDLPYVCKRVNVTGTPPPTPAPPPTPAGCPDGWSPFLHRCYKVFGQEEARRVTWSAARIMCESQSAKLATVPSHI--EQAFLVTLLPNSSFHLWVGLKADSEGQFRWAEPGLLSYTNWAPGEPVDNRGHSKNSGNCVVLLHSVPHRTTGMWSSRGCEGEKHGYICMKSKDPAIPPGVDLLPPALGSPLEFQGVQYRLLQKKLDWEGALQVCESVNGSLAAVRDPRQHAYL-KLLLSTLRKPAWISLHNDGGRSYRWL--GEEDVTFSDWQ----DGEPKPTTGCGHMTTGGQWTVSACDSKLEAAICEMNTER 1244          

HSP 3 Score: 58.9214 bits (141), Expect = 2.966e-8
Identity = 61/316 (19.30%), Postives = 115/316 (36.39%), Query Frame = -3
Query:  183 WYSTEPDGGKTEN---CAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ--------PIK------------------YGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNG--GKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 1037
            W +T  D  K E    C V  TD    WD              + D    F+  +  + +  A   C+ +  +L+ I   +  + +  L   ++    W+  ND    G W+ +    L +  W   +P    ++NC          W +  C      IC+        P                    +    Y ++  K ++    K C+     LV I    + +F+  + +K  +   WI  +D A + ++  TD   + +  W+  +PN     +E+C+  ++  +G WND  C+     IC+   +K+
Sbjct:  217 WCATTHDYAKDERWGFCPVKSTDCETFWDT-----------HSLMDNCYQFNFQAT-LSWSEARTSCQQQGADLLSIIKVEEQSYINGLLTGYSAA-LWMGLNDLDLNGGWQWADSAPLKYLNWEADQPNHEEDQNCAVIRTESSGRWQNRDCSVALPYICKKRPNATLDPFTTESWADDGQYQCDLGWQNFQAGCYRLNSDKLDWNSAQKTCQKMDAHLVSIHTLPELEFI-TVHMKKDVDELWIGLHDTAMQMNFEWTDRTPVIFTFWHPFEPNNFHNTQEDCVT-MWGPEGRWNDSPCNFSLPSICKKAAQKI 517          

HSP 4 Score: 54.299 bits (129), Expect = 7.408e-7
Identity = 31/118 (26.27%), Postives = 58/118 (49.15%), Query Frame = -2
Query: 2659 DYGYVVNLQ-KMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKK 3009
            D  Y  N Q  ++++ A + C++Q  +LL+I   +  +   N  +       W+  ND  + G W  + S P++Y NW++ +PN +  +NC       +G W +  C+     IC+K+
Sbjct:  251 DNCYQFNFQATLSWSEARTSCQQQGADLLSIIK-VEEQSYINGLLTGYSAALWMGLNDLDLNGGWQWADSAPLKYLNWEADQPNHEEDQNCAVIRTESSGRWQNRDCSVALPYICKKR 367          
BLAST of SMED30004599 vs. Ensembl Cavefish
Match: si:dkey-11o15.5 (si:dkey-11o15.5 [Source:ZFIN;Acc:ZDB-GENE-091204-172])

HSP 1 Score: 115.546 bits (288), Expect = 6.168e-26
Identity = 149/639 (23.32%), Postives = 250/639 (39.12%), Query Frame = -3
Query:  204 YHYTREKMTYKSAVKYCLAQSMNLVTIDN-EATNKLVHDLSLQYNIDWYWINGNDLIKEGNW-VDSNN----NKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMR-HTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQ-GLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASK-NDLAMTYAIKSNLSYF---WIDGTDSANEGNWVD-----YQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKS------EPKGGRNENCITGNNYQDAL-------WNDEKCGSLNSVICQP-----IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESL------TYLNWNIRQP-NGGKKENCIQGLYFS--DGTWNDVKCDMKNKVIC 1988
            YH+  E  T+  A  YC     +L +IDN E   +LV  + ++ N +  WI   D +    W +D ++    N+ S+ NW+ + P     ++      + DG W++  C      +C   R + +  Y +    MT+ +A  YC++ +  L ++ NE+ N+ ++ L       D W+            N+ +    +K   P      + E+C       +G W D  C      IC  +            Y S        A+ FC      +  I+N  + N L  T+    N SY    WI   D  N   W       Y++ +  ++ WY  EP+    +   VS+  A+G+W D +CQS +S IC    +  N +   +  M ++ A +YCR    +L  +     N +++++         WI    +R    W D  Q+ L++K W         +P  G   N   GN +  A+       W DE C +    +C         Y   +YH     +++ +  +YC+     L  I + ++   + + A     G  WI   D      W   DNE L      ++ NW   +P N G    C    YFS  DG W++  C       C
Sbjct:    7 YHFVNESKTWAEAQSYCREHYFDLASIDNAEEALELVKLVDIR-NSNSTWIGLYDDLNSWRWSLDDDSFYKENERSFRNWYKENPKNWGGDSLCTHFQFYDGRWSETYCLSSLRFVCYDGRGNASESYVLVNQYMTWTEAQRYCREHHTDLASVRNEAENQKLRSLYYYDYS-DVWIGLYRTRSWSD--NSSSSFSFWKTGQPDNAG--QSEHCTAVSFSDSGKWTDKNCGQAFPFICYNMMESAFSRQYHFVYESKSWTE---AQRFCRENYTDLATIENMEEMNSLITTWNDTVNGSYVGLAWIGLYDDLNSWRWSYDNESFYKEGERDFRGWYH-EPNNWNGKEMCVSI-GADGMWFDQNCQSYSSFICYDGRNGNNDYIWINQYMFWEEAQRYCRKYYTDLASVRNWTDNQRIFSV---VGGSSAWIGLYRSRL---WSD--QHELTYKNWRPGIMYSPQQPDNGFYVNGEYGNQHCTAVSFSYSGQWTDENCLAKLPFVCYTRFWSWSPYVSHQYHFVGENKSWTEAQRYCRENYTDLATIGNMEEMSSLMNTAKGRYFGLAWIGLYDDLKSWRW-SLDNELLYKQKERSFRNWYTYKPMNWGGNSLCT---YFSSYDGAWHEYPCSYGLPFFC 622          

HSP 2 Score: 104.375 bits (259), Expect = 2.341e-22
Identity = 116/534 (21.72%), Postives = 202/534 (37.83%), Query Frame = -3
Query:  564 WMEKEMTTVAPVV--QKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDN-EATNKLVHDLSLQYN---IDWYWINGNDLIKEGNWVDSNNN-----KLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVW---LNTDNEEISYKNWHPK---EPQG----------YRKENCIQ-GLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNW-----VDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQV--YNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKG-GRNENCITGNNYQDALWNDEKCGSLNSVIC 2057
            W +K      P +    +++     YH+  E  ++  A ++C     +L TI+N E  N L+   +   N   +   WI   D +    W   N +     +  +  W+++  +   +E C+   + ADG W D  C   +S IC   R+  N Y      M + +A  YC+K    L ++ N + N+ +             V G  ++  G++   L +D  E++YKNW P     PQ           Y  ++C       +G W D  C +    +C        P  +  ++   E  +   A+ +C      +  I N  +    M  A        WI   D      W     + Y+ ++ S++NWY+ +P      +     +  +G W +  C       C   N  +    I  + M +  A +YCR    +L  +  +  N ++  +N    +  G  WI     R    W DS  +  S+  W   +P   G +ENC   + Y    W +E CG     +C
Sbjct:  225 WTDKNCGQAFPFICYNMMESAFSRQYHFVYESKSWTEAQRFCRENYTDLATIENMEEMNSLITTWNDTVNGSYVGLAWIGLYDDLNSWRWSYDNESFYKEGERDFRGWYHEPNNWNGKEMCVS--IGADGMWFDQNCQSYSSFICYDGRNGNNDYIWINQYMFWEEAQRYCRKYYTDLASVRNWTDNQRIFS-----------VVGGSSAWIGLYRSRLWSDQHELTYKNWRPGIMYSPQQPDNGFYVNGEYGNQHCTAVSFSYSGQWTDENCLAKLPFVCYTRFWSWSPYVSHQYHFVGENKSWTEAQRYCRENYTDLATIGNMEEMSSLMNTAKGRYFGLAWIGLYDDLKSWRWSLDNELLYKQKERSFRNWYTYKPMNWGGNSLCTYFSSYDGAWHEYPCSYGLPFFCYDENVNEQYIIILQL-MNWTEAQRYCREHHTDLASVRNEAENQKLRTFNYYFHYYYGSAWIGLYRTRA---WSDSSSSSFSY--WKTGQPDNIGVSENCTAVSFYDSGKWTNENCGQAFPFLC 739          

HSP 3 Score: 103.219 bits (256), Expect = 5.181e-22
Identity = 142/654 (21.71%), Postives = 247/654 (37.77%), Query Frame = -3
Query:  204 MTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHT--TNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDY----WVNGNDNSEEGVWLNTDNE------EISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNW-----YSTE-PDGG-------KTENCAVSLTDANGLWDDAHCQSMNSVIC-------EPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDS-----KQNLLSFKKWHKSEPKG-GRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFV--YDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQP-NGGKKENCIQGLYFSDGTWNDVKCDMKNKVIC 2042
            ++++  V    +      Y    + MT+  A +YC     +L ++ NEA N+ +  L   Y+    WI G    +  +   S++     T    Q  + G+ E+C        G W D  C Q    IC  M  +  + +YH   +  ++ +A  +C++    L  IEN      +      ++   Y    W+   D+     W + DNE      E  ++ W+ +      KE C+  +  +G+W D  C S    IC   +N      N+ +    + M    A+ +C      +  + N + N    +    S+    WI    S     W D    +L+YKNW     YS + PD G         ++C       +G W D +C +    +C        P     + +H       +  A +YCR    +L  I   +  + + N +     G  WI   D+ K  +W        KQ   SF+ W+  +P   G N  C   ++Y D  W++  C       C        +Y I     N+ +  +YC+     L  + ++ +N+ +  ++       G+ WI    +     W D+ + S +Y  W   QP N G  ENC    ++  G W +  C      +C
Sbjct:  115 LSSLRFVCYDGRGNASESYVLVNQYMTWTEAQRYCREHHTDLASVRNEAENQKLRSL-YYYDYSDVWI-GLYRTRSWSDNSSSSFSFWKTG---QPDNAGQSEHCTAVSFSDSGKWTDKNCGQAFPFICYNMMESAFSRQYHFVYESKSWTEAQRFCRENYTDLATIENMEEMNSLITTWNDTVNGSYVGLAWIGLYDDLNSWRW-SYDNESFYKEGERDFRGWYHEPNNWNGKEMCV-SIGADGMWFDQNCQSYSSFICYDGRN-----GNNDYIWINQYMFWEEAQRYCRKYYTDLASVRNWTDNQRIFSVVGGSSA---WIGLYRSRL---WSD--QHELTYKNWRPGIMYSPQQPDNGFYVNGEYGNQHCTAVSFSYSGQWTDENCLAKLPFVCYTRFWSWSPY--VSHQYHFVGENKSWTEAQRYCRENYTDLATIGNMEEMSSLMNTAKGRYFGLAWIGLYDDLKSWRWSLDNELLYKQKERSFRNWYTYKPMNWGGNSLCTYFSSY-DGAWHEYPCSYGLPFFCYDENVNE-QYIIILQLMNWTEAQRYCREHHTDLASVRNEAENQKLRTFNYYFHYYYGSAWIG---LYRTRAWSDSSSSSFSY--WKTGQPDNIGVSENCTAVSFYDSGKWTNENCGQAFPFLC 739          

HSP 4 Score: 88.9669 bits (219), Expect = 1.198e-17
Identity = 106/514 (20.62%), Postives = 207/514 (40.27%), Query Frame = -3
Query:  192 KYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNE-----EISYKNWHPKEPQGYRKEN-CIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKND--LAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPD-GGKTENC-AVSLTDANGLWDDAHCQSMNSVICEPINDT--KNGFHITSVKMKFDTAVKYCRNKKMELVKIDG-DQMNNQVYNLSVTFN---LGRYWINGNDNRKEGQWEDSKQNLL-----SFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNW------NIRQPNGG-------KKENCIQGLYFSDGTWNDVKCDMKNKVICELKV 1631
            +YH   +  T+ +A +YC++    L +I+N      + KLV        W+   D+     W   D+      E S++NW+ + P+ +  ++ C      +G W++  C S    +C       R +++  +    + M    A+ +C   +  +  + N ++N    ++ Y   S++   WI    + +  +               + +PD  G++E+C AVS +D+ G W D +C      IC  + ++     +H       +  A ++CR    +L  I+  ++MN+ +   + T N   +G  WI   D+    +W    ++        F+ W+         E C++     D +W D+ C S +S IC   + G + Y        +++  +YC+     L  + +  DN+ ++ +   S     WI    +     W  +D   LTY NW      + +QP+ G         ++C    +   G W D  C  K   +C  + 
Sbjct:    6 QYHFVNESKTWAEAQSYCREHYFDLASIDNAEEALELVKLVDIRNSNSTWIGLYDDLNSWRWSLDDDSFYKENERSFRNWYKENPKNWGGDSLCTHFQFYDGRWSETYCLSSLRFVCY----DGRGNASESYVLVNQYMTWTEAQRYCREHHTDLASVRNEAENQKLRSLYYYDYSDV---WIGLYRTRSWSDNSSSSFSFWK-----TGQPDNAGQSEHCTAVSFSDS-GKWTDKNCGQAFPFICYNMMESAFSRQYHFVYESKSWTEAQRFCRENYTDLATIENMEEMNSLITTWNDTVNGSYVGLAWIGLYDDLNSWRWSYDNESFYKEGERDFRGWYHEPNNWNGKEMCVSIG--ADGMWFDQNCQSYSSFICYDGRNGNNDYIWINQYMFWEEAQRYCRKYYTDLASVRNWTDNQRIFSVVGGSSA---WIG---LYRSRLW--SDQHELTYKNWRPGIMYSPQQPDNGFYVNGEYGNQHCTAVSFSYSGQWTDENCLAKLPFVCYTRF 496          

HSP 5 Score: 48.521 bits (114), Expect = 3.109e-8
Identity = 37/118 (31.36%), Postives = 58/118 (49.15%), Query Frame = -3
Query: 2283 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINK--RVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEP-NGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPME 2627
            Y+I  ++M + EA ++C E +  L +++NE  N+  R FN   +Y  G+ WI      +  +W DS + S  +  W  G+P N G  ENC     YD+  W + NC      +C   E
Sbjct:  631 YIIILQLMNWTEAQRYCREHHTDLASVRNEAENQKLRTFNYYFHYYYGSAWI---GLYRTRAWSDSSSSSFSY--WKTGQPDNIGVSENCTAVSFYDSGKWTNENCGQAFPFLCYSSE 743          

HSP 6 Score: 30.0314 bits (66), Expect = 3.109e-8
Identity = 31/126 (24.60%), Postives = 51/126 (40.48%), Query Frame = -2
Query: 2668 SPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYW-VDS----KSNPMQYQNWKSGEP-NGKRQENCVHGLYYPAGLWNDISCNTPNSVIC 3027
            SP +   Y +V   +  ++T A  +C+E   +L TI N      + N A     G  WI   D+     W +D+    K     ++NW + +P N      C +   Y  G W++  C+      C
Sbjct:  500 SPYVSHQYHFVG--ENKSWTEAQRYCRENYTDLATIGNMEEMSSLMNTAKGRYFGLAWIGLYDDLKSWRWSLDNELLYKQKERSFRNWYTYKPMNWGGNSLCTYFSSYD-GAWHEYPCSYGLPFFC 622          

HSP 7 Score: 41.9726 bits (97), Expect = 6.372e-6
Identity = 38/146 (26.03%), Postives = 64/146 (43.84%), Query Frame = -3
Query: 2193 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEP-NGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCK 2627
            Y++  + MT+ EA ++C E +  L +++NE  N+++ ++  YY+    WI    Y       +S +    +K    G+P N G+ E+C      D+  W D NC      IC  M +S    +         Y SK     Q  C+
Sbjct:  133 YVLVNQYMTWTEAQRYCREHHTDLASVRNEAENQKLRSL-YYYDYSDVWI--GLYRTRSWSDNSSSSFSFWKT---GQPDNAGQSEHCTAVSFSDSGKWTDKNCGQAFPFICYNMMESAFSRQ-----YHFVYESKSWTEAQRFCR 267          

HSP 8 Score: 28.4906 bits (62), Expect = 6.372e-6
Identity = 30/125 (24.00%), Postives = 47/125 (37.60%), Query Frame = -2
Query: 2644 YVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWV---DS--KSNPMQYQNWKSGEP-NGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKS 3000
            + VN  K  +  A S+C+E   +L +I N      +  +         WI   D+     W    DS  K N   ++NW    P N      C H  +Y  G W++  C +    +C   +   S
Sbjct:    8 HFVNESK-TWAEAQSYCREHYFDLASIDNAEEALELVKLVDIRNSNSTWIGLYDDLNSWRWSLDDDSFYKENERSFRNWYKENPKNWGGDSLCTHFQFYD-GRWSETYCLSSLRFVCYDGRGNAS 130          
BLAST of SMED30004599 vs. Ensembl Sea Lamprey
Match: mrc2 (mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GENE-090915-5])

HSP 1 Score: 71.633 bits (174), Expect = 7.233e-13
Identity = 69/316 (21.84%), Postives = 117/316 (37.03%), Query Frame = -3
Query:  201 DQKLSYKNWYSTEPDGGKTE---NCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGR-YWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ----------------------PIKYGP---SKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 1061
            D +  +  W +T  D G  E    C V L D +  WD            +P+      F++ +V + +  A   C  +  +L+ I   +M+ Q Y        G   WI  ND   +G W+ S  + L    W +  P     +NC        + W  ++C +    +C+                      P  + P   S +     KR ++D +  C+     L+ +    D  F+    L S     W+  ND+  +  +  +D   +T+  W+ R PN    E C+  L+  +G W D  CD K   +C 
Sbjct:  160 DGRDDWHLWCATSADYGTDELWGFCPVKLPDCSVFWDT-----------DPVTRNCYQFNVHAV-LSWHEARTSCLQQGSDLLSIT--EMHEQTYIAGFLSGFGAIMWIGLNDLDSDGGWQWSDGSPLKLLNWDQGHPSETDGQNCALLRAEFFSKWQTKECAAALPYVCKKRLNITSIQIPNESWENRPTVCPRGWVPFNGSCFWRDAEKRTWQDALARCRLGGGDLLSLHGLADVDFLVQHVL-SDGEEVWLGLNDLKTKMVFEWSDFTPVTFTFWHPRHPNSRPGEGCVS-LWGKEGRWKDGPCDAKKASVCR 459          

HSP 2 Score: 49.6766 bits (117), Expect = 4.209e-6
Identity = 40/182 (21.98%), Postives = 71/182 (39.01%), Query Frame = -3
Query:  315 NLGRYWINGN--DNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ--------------PIKYG----PSKYHISKSK-----------RNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNW 767
            +L ++WI  +  D   E QW D   +LL+F  W +S P   R        +     W D +CG     +C+              P   G    P  +H+   K           R +    +YC+S+  +L  I +  +  F+  L L     ++W+  +  A+ G +   +  ++T+ NW
Sbjct:  841 SLQQWWIGLSMLDGDSELQWSDG--SLLTFMAWAESRPNAARKFQTCVYMSANKGTWGDMRCGMKLPAVCKRWNVTMPVPITPLHPATSGWGNCPDGWHVFGDKCLGFVDGPGQARTWMGAKEYCESQDATLATIANHLEQAFII-LKLAPGQDSYWVGLHVRASVGAFTWLEEHNVTFTNW 1019          
BLAST of SMED30004599 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003237.1 (pep scaffold:Pmarinus_7.0:GL486820:4307:11265:1 gene:ENSPMAG00000002956.1 transcript:ENSPMAT00000003237.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 4.752e-10
Identity = 33/114 (28.95%), Postives = 56/114 (49.12%), Query Frame = -3
Query: 1653 YHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDG--GKRENCIQSLVYADGFWNDVECDQPNSVICE 1988
            Y Y  E++ +  A + C +   +L +I +   N  +    L    D+ WI  ND   EG++  S+ ++LS+ +W  Q+PD      E+C+  + + +G WNDV C       CE
Sbjct:   14 YRYVAERLPWAEAEEACRSVGGHLASIASRDENNFI----LALGSDYQWIGLNDRFSEGDFHWSDGSQLSFEHWRPQQPDSFFSSGEDCVVLIWHEEGEWNDVPCTYHLPFCCE 123          

HSP 2 Score: 50.8322 bits (120), Expect = 2.226e-7
Identity = 37/130 (28.46%), Postives = 59/130 (45.38%), Query Frame = -3
Query:  195 CQP--IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEG--HWVDTDNESLTYLNWNIRQPNG--GKKENCIQGLYFSDGTWNDVKCDMKNKVICELK 566
            C+P    +G   Y     +  + +  + C+S    L  I    +N F+  LAL S     WI  ND  +EG  HW  +D   L++ +W  +QP+      E+C+  ++  +G WNDV C       CE +
Sbjct:    2 CEPGWHGFGGRCYRYVAERLPWAEAEEACRSVGGHLASIASRDENNFI--LALGSDYQ--WIGLNDRFSEGDFHW--SDGSQLSFEHWRPQQPDSFFSSGEDCVVLIWHEEGEWNDVPCTYHLPFCCETQ 125          
BLAST of SMED30004599 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009130.1 (pep scaffold:Pmarinus_7.0:GL477920:28989:31537:1 gene:ENSPMAG00000008249.1 transcript:ENSPMAT00000009130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 3.106e-6
Identity = 39/157 (24.84%), Postives = 70/157 (44.59%), Query Frame = -3
Query: 1653 CS-VRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKL---SYTNWHYQEPD---GGKRENCIQSLVYADGFWNDVECDQPNSVICE 2102
            CS +R L      +   + +E++ +   V  ++ T    Y   RE+  Y  A  +C ++   L    +E TN L+        +   +I  +D ++EG +   +   L   ++T W   EP+   GG  E+C++  + + G WNDV C      +CE
Sbjct:  119 CSRMRVLIGEMDIVVARLREEVSFLKTAVAGVRETERKMYLLVREERAYSEAALHCRSRGGLLAMPRDETTNALLAAYVSHAGLARVFIGLHDGLREGAFTYEDGASLGPTAFTRWRPGEPNNAFGG--EDCVE--MESGGGWNDVSCTNTMYFVCE 271          

HSP 2 Score: 48.521 bits (114), Expect = 3.683e-6
Identity = 34/124 (27.42%), Postives = 54/124 (43.55%), Query Frame = -3
Query:  183 YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESL---TYLNWNIRQPN---GGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 536
            Y + + +R Y +   +C+S+   L    D+  N  +      + L   +I  +D   EG +   D  SL    +  W   +PN   GG  E+C++    S G WNDV C      +CE   E+L
Sbjct:  158 YLLVREERAYSEAALHCRSRGGLLAMPRDETTNALLAAYVSHAGLARVFIGLHDGLREGAFTYEDGASLGPTAFTRWRPGEPNNAFGG--EDCVE--MESGGGWNDVSCTNTMYFVCEFTKEEL 277          
BLAST of SMED30004599 vs. Ensembl Nematostella
Match: EDO49509 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGD7])

HSP 1 Score: 146.747 bits (369), Expect = 1.457e-35
Identity = 219/979 (22.37%), Postives = 374/979 (38.20%), Query Frame = -3
Query:  189 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTY-WITGNDYSKEGSWVDSRNVSLQFKKWYQGEP-NGGRKENCIHGLRYDNEF--WNDVNCFHKNMVIC----EPMEKSPADPEICKSFLELCYNSKIRKICQNTC-----KFWQSTTTRKI--PVSTSKSLDNISDKEFY----DKYCSVRYLANLYQK-ICGWMEKEM------------TTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSL-QYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEP-DGGKRENCIQSLVYADG----FWNDVEC-DQPNSVICEPMRHTTNK------------------------------YHIGKD----RMTFNDAVNYCKKRNMVLINIENEXX-XXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYR-KENCIQGLRINGLWNDVTCDSLGEVICQ------PIQNKKRPSSNSLF----------------YSSTEKMNNLAAREFC---ANRNMR--IVKIDN----ASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCA--VSLTDANGLWDDAHCQSMNSVICE----PINDTKNG------------------FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFN-LGRYW--INGNDNRKEGQWEDSKQNLLSFKKWHKSEP-KGGRNENCITGNNY--QDALWNDEKCGSLNSVICQPIKYGPSKYHIS-----KSKRNYKDGVKYCKSKKM------------------SLVKITDDKDNKFVYDLALKSKLGTF-WINGNDVANEGHWVDTDNESLTYLNWNIRQPNGG-KKENCIQGLYFSDGTWNDVKCDMKNKVICELKVE 2642
            + +Y Y  N +   +  A   C  +   L++I +      +     ++ L T+ WI  +D + E +W  S    ++F  W+  +P N    E+C H     +    WND++C+     IC    E    +P  P        +C  +     C ++      K     T R+   P+S +  + +++ K       + YCSV     L+ K  C  + K +            T   P   +        Y  T +K T+  A   C AQ   L +I     + LV  L +  ++    WI   D  + G +  ++ + + +TNW   EP D G   +C+++ +        +W D  C   P + +C+  R  T                                Y    D    R T+ DA   C++    LI+I++ +    +      K   +  W+  ND  +E V+  +D   +SY N++ KEP  ++ +E+C++ +R NG WND  C+     IC+      PI +   P+                     + +TE+ N   AR  C    N +M   +V IDN    A  + + ++Y  K     FWI   D   EG +    +  + Y NW + +P      +C      + A G W    C      ICE    PI  T                     + ++ +K+ +  A + C+ +  +LV I       Q + L    N +G  W  +    N  E  W D  Q++  F  W + +P + G  + C+   N    DA W+   CG  N  +C+  K  P   HI+     K    +K   K+C   +M                   LV I   ++  F+    +K+  G + W   ND + E  +  +D   +++ +W   QPN    ++NC+  +    G+WNDV C  +   IC+ K+E
Sbjct:  950 YGQYCYQFNSDKRNWQSARLMCQNRGGELVSILSPVEQAHITLEVGFFGLSTFAWIGFHDKTIESAWEWSDGSPVRFTNWWNYQPDNWINSEDCAHTYHQTSAMGRWNDISCYTNMAYICKRDKEYNPSAPVSPTTAPRQQNICEWTSDALSCPSSTVISVQKANYGRTDRQPCGPISVTGCVFDVTAKLQAMCDGNPYCSVNPTNQLFGKDPCPTVRKYLDVTFVCKRGAVVTQGCPAGWQRSPDGNACYGLTLDKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGIYRWTDGSPVDWTNWWNGEPNDRGVTGSCVRATLTVSSRDWMYWVDSNCTSTPYAFVCKKYRPATAMTTQPATPAPTTTGPPPGTCDKTWTYWRGMCYLFSGDDLVSRQTWQDARAACQQAGAELISIQSAAENAFVYSGFRAKYRSWTIWIGLNDLDDESVYEWSDGSPLSYTNYNWKEPNDWQGQEDCLEMVRWNGKWNDNQCNRKNPYICKKQNNSVPIISTPSPTPGPALGRCNSGWLHYDKSCYKFVATERQNWANARLRCDRGTNSSMYGDLVTIDNQYEQAFISSMMLSYTSKPR---FWIGMNDIHTEGAFYWADNSPVRYTNWNTRQPMNRANLDCVDIEPRSWAAGKWAVRPCSWRVGYICESAALPIGPTAVAPTSNPDCPRFYSKYGDSCYRMSYIKLPWSEAREVCKKEGGDLVSI--HSAFEQAFLLRNMINFVGNVWTGMTRMPNTVEFTWSD--QSVKEFSHWSRGQPGRPGTTQMCVQAINSANSDARWSAVDCGVQNGFMCKINKGEP---HITPTVDGKCLPGFKRFDKHCYLFRMFHRLTWPQARLRCQREGGDLVSILSQQEKDFLI-YQMKTVNGIWIWTGLNDRSVERGYEWSDGSPVSFTSWLYGQPNDHWGRDNCV-AVQTRMGSWNDVNCMQRRGYICKAKLE 1916          

HSP 2 Score: 98.5969 bits (244), Expect = 1.047e-20
Identity = 85/353 (24.08%), Postives = 144/353 (40.79%), Query Frame = -3
Query:  561 YWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSL-----------------FYSSTEKMNNL-----AAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQK-LSYKNWYSTEP-DGGKTENCAVSLTD-ANGLWDDAHCQSMNSVICE--------PINDTKNG---FHI---TSVKMKFDTAVKYCR-NKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGR---NENCIT-GNNYQDALWNDEKCGSLNSVICQ 1487
            +W+  ND   EG +   D    S+KNW   EP  ++ E+C + +   G WND  C +    IC+ + +   P+  ++                 F +S  K N        A+  C      +VK+D+A++ +  ++Y  ++     WI  TD A EG++V   D   ++Y NW+  EP D    E+C   +     G W+D  C+   + ICE        P+N    G   F      + K+ +  A   CR N   +L  +      N + +    F     WI  ND   EG +  S +  + +  W   EP  G    +++C+      Q+  W+   C    + +C+
Sbjct:   90 FWIGFNDRGSEGNFSWVDGSNSSFKNWRKGEPNNWQNEDCAEAVWNTGQWNDELCSNTYGYICKRLASAPWPTQGTMVPPTTQSPIVCDFGWEFFGTSCYKFNTARKTWSMAKADCHGAGGYLVKVDDATEQNF-LSYRSRTISQSMWIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHSGKEDCVEMMAGYFAGYWNDNFCEQFRNFICEKPFGENLCPVNWVTIGDSCFEFNTHPAQKLTWSQAQDSCRLNSGADLASVRTIDEQNAILSQLTDFGARNVWIGFNDIATEGVFVWSDRTKVDYTNWSPREPGSGTLADSKDCVVLEAGSQNGTWSSTPCALKTTYLCR 441          

HSP 3 Score: 90.8929 bits (224), Expect = 1.993e-18
Identity = 114/520 (21.92%), Postives = 203/520 (39.04%), Query Frame = -3
Query: 1254 GMIFLAI-----LPTXXXXXXXXXXXQFVEYGYLI-----NEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEG--SWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWV-DSNNNKLSYTNWHYQEP-DGGKRENCIQSLV-YADGFWNDVECDQPNSVICE-PMRH---TTNKYHIG----------KDRMTFNDAVNYCKKRNMV-LINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQG---YRKENCI--QGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLF 2708
            G++FL++      P  S    +     +  Y YL      ++  +++++A   C     RL +I +      +    + Y    +WI  ND   EG  SWVD  N S  FK W +GEPN  + E+C   + ++   WND  C +    IC+ +  +P                            W +  T   P + S  + +    EF+   C   Y  N  +K     + +       + K+ +  E  +      ++Y+S     ++QSM                          WI   D   EG++V + +   ++YTNW   EP D   +E+C++ +  Y  G+WND  C+Q  + ICE P        N   IG            ++T++ A + C+  +   L ++        +   +      + W+  ND + EGV++ +D  ++ Y NW P+EP        ++C+  +    NG W+   C      +C+  + + R   +S F
Sbjct:    6 GLVFLSLCVLILAPEVSHGACQAGWESYSSYCYLFVVRSQSQIGLSWEDADIDCQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVDGSNSS--FKNWRKGEPNNWQNEDCAEAV-WNTGQWNDELCSNTYGYICKRLASAP----------------------------WPTQGTMVPPTTQSPIVCDFG-WEFFGTSC---YKFNTARKTWSMAKADCHGAGGYLVKVDDATEQNF------LSYRSRT---ISQSM--------------------------WIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHSGKEDCVEMMAGYFAGYWNDNFCEQFRNFICEKPFGENLCPVNWVTIGDSCFEFNTHPAQKLTWSQAQDSCRLNSGADLASVRTIDEQNAILSQLTDFGARNVWIGFNDIATEGVFVWSDRTKVDYTNWSPREPGSGTLADSKDCVVLEAGSQNGTWSSTPCALKTTYLCR--RRRGRDQCDSPF 453          

HSP 4 Score: 87.8113 bits (216), Expect = 2.059e-17
Identity = 94/397 (23.68%), Postives = 153/397 (38.54%), Query Frame = -3
Query:  195 CANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGN--WVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVK--------------------MKFDTAVKY-------CRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQ--WEDSKQNLLSFKKWHKSEP--KGGRNENCITGNNYQDALWNDEKCGSLNSVICQ--------PIKY---GPSKYHISKSK------RNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTF-----WINGNDVANEGHWVDTDNESLTYLNWNIRQPNGG----KKENCIQGLYFSDGTWNDVKCDMKNKVICELK 1208
            C +   R+  I + ++        I+     FWI   D  +EGN  WVD  +   S+KNW   EP+  + E+CA ++ +  G W+D  C +    IC+ +         T V                      KF+TA K        C      LVK+D     N +   S T +    WI   D   EG   WE     ++++  W + EP    G+ +       Y    WND  C    + IC+        P+ +   G S +  +            +D  +      ++ V+  D+++       A+ S+L  F     WI  ND+A EG +V +D   + Y NW+ R+P  G     K+  +      +GTW+   C +K   +C  +
Sbjct:   59 CQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVDGSNS--SFKNWRKGEPNNWQNEDCAEAVWN-TGQWNDELCSNTYGYICKRLASAPWPTQGTMVPPTTQSPIVCDFGWEFFGTSCYKFNTARKTWSMAKADCHGAGGYLVKVDDATEQNFLSYRSRTISQS-MWIGATDEAAEGHFVWE-GDGTVVNYTNWFRGEPNDHSGKEDCVEMMAGYFAGYWNDNFCEQFRNFICEKPFGENLCPVNWVTIGDSCFEFNTHPAQKLTWSQAQDSCRLNSGADLASVRTIDEQN-------AILSQLTDFGARNVWIGFNDIATEGVFVWSDRTKVDYTNWSPREPGSGTLADSKDCVVLEAGSQNGTWSSTPCALKTTYLCRRR 443          

HSP 5 Score: 78.1814 bits (191), Expect = 1.772e-14
Identity = 70/264 (26.52%), Postives = 111/264 (42.05%), Query Frame = -3
Query:  201 TSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEG--QWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ--------------------PIK-------YGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKL--GTFWINGNDVANEGHWV-DTDNESLTYLNWNIRQPNG-GKKENCIQGL--YFSDGTWNDVKCDMKNKVICE 887
            + + + ++ A   C++    L  I      + +   ++ +   R+WI  ND   EG   W D   +  SFK W K EP   +NE+C     +    WNDE C +    IC+                    PI        +G S Y  + +++ +      C      LVK+ D  +  F   L+ +S+    + WI   D A EGH+V + D   + Y NW   +PN    KE+C++ +  YF+ G WND  C+     ICE
Sbjct:   46 SQIGLSWEDADIDCQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVDGSNS--SFKNWRKGEPNNWQNEDCAEA-VWNTGQWNDELCSNTYGYICKRLASAPWPTQGTMVPPTTQSPIVCDFGWEFFGTSCYKFNTARKTWSMAKADCHGAGGYLVKVDDATEQNF---LSYRSRTISQSMWIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHSGKEDCVEMMAGYFA-GYWNDNFCEQFRNFICE 302          

HSP 6 Score: 60.8474 bits (146), Expect = 3.464e-9
Identity = 80/399 (20.05%), Postives = 152/399 (38.10%), Query Frame = -3
Query:  867 NLVTIDNEATNKLVHDLSLQYNI-DWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENC--IQSLVYADGFWNDVECDQPNSVICE---------PMRHTTNK-------------YHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGN--DNSEEGVWLNTDNEEISYKNWHPKEP-QGYRKENCIQGL---RINGLWNDVTCDSLGEVIC-----QP----------IQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEP-DGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKF 1922
            +LVTIDN+     +  + L Y     +WI  ND+  EG +  ++N+ + YTNW+ ++P      +C  I+   +A G W    C      ICE          +  T+N              Y +   ++ +++A   CKK    L++I +      + + +   +  + W       N+ E  W +   +E S+  W   +P +    + C+Q +     +  W+ V C      +C     +P          +   KR   +   +    ++    AR  C      +V I +  + D  +      N  + W    D + E  +       +S+ +W   +P D    +NC V++    G W+D +C      IC+   +  N   + S  + +
Sbjct: 1536 DLVTIDNQYEQAFISSMMLSYTSKPRFWIGMNDIHTEGAFYWADNSPVRYTNWNTRQPMNRANLDCVDIEPRSWAAGKWAVRPCSWRVGYICESAALPIGPTAVAPTSNPDCPRFYSKYGDSCYRMSYIKLPWSEAREVCKKEGGDLVSIHSAFEQAFLLRNMINFVG-NVWTGMTRMPNTVEFTWSDQSVKEFSH--WSRGQPGRPGTTQMCVQAINSANSDARWSAVDCGVQNGFMCKINKGEPHITPTVDGKCLPGFKRFDKHCYLFRMFHRLTWPQARLRCQREGGDLVSILSQQEKDFLIYQMKTVNGIWIWTGLNDRSVERGYEWSDGSPVSFTSWLYGQPNDHWGRDNC-VAVQTRMGSWNDVNCMQRRGYICKAKLECSNPLGMASGNITY 1930          

HSP 7 Score: 53.9138 bits (128), Expect = 3.887e-7
Identity = 35/120 (29.17%), Postives = 58/120 (48.33%), Query Frame = -2
Query: 2662 YGYVVNLQK---MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEG--YWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3006
            Y +VV  Q    +++  A   C+     L +I +      +    I+Y+   +WI  ND G EG   WVD  ++   ++NW+ GEPN  + E+C   ++   G WND  C+     IC++
Sbjct:   38 YLFVVRSQSQIGLSWEDADIDCQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVDGSNS--SFKNWRKGEPNNWQNEDCAEAVWN-TGQWNDELCSNTYGYICKR 154          

HSP 8 Score: 53.9138 bits (128), Expect = 4.448e-7
Identity = 36/126 (28.57%), Postives = 62/126 (49.21%), Query Frame = -2
Query: 2656 YGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYY------WIDGNDNGMEGYWVDSKSNPMQYQNWKSGEP-NGKRQENCVHGLYYPA--GLWNDISCNTPNSVICQKKK 3006
            Y Y  N  K  + +A   C+ +  EL++I + +         I  ++G++      WI  +D  +E  W  S  +P+++ NW + +P N    E+C H  +  +  G WNDISC T  + IC++ K
Sbjct:  953 YCYQFNSDKRNWQSARLMCQNRGGELVSILSPVEQAH-----ITLEVGFFGLSTFAWIGFHDKTIESAWEWSDGSPVRFTNWWNYQPDNWINSEDCAHTYHQTSAMGRWNDISCYTNMAYICKRDK 1073          

HSP 9 Score: 53.5286 bits (127), Expect = 5.356e-7
Identity = 36/124 (29.03%), Postives = 60/124 (48.39%), Query Frame = -2
Query: 2623 LQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFN-MAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNG-KRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKSICRIRIP 2988
            + +  +  A + C++   EL++I++   N  V++    KY+    WI  ND   E  +  S  +P+ Y N+   EPN  + QE+C+  + +  G WND  CN  N  IC+K+     I     P
Sbjct: 1365 VSRQTWQDARAACQQAGAELISIQSAAENAFVYSGFRAKYRSWTIWIGLNDLDDESVYEWSDGSPLSYTNYNWKEPNDWQGQEDCLEMVRW-NGKWNDNQCNRKNPYICKKQNNSVPIISTPSP 1487          
BLAST of SMED30004599 vs. Ensembl Nematostella
Match: EDO49512 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGE1])

HSP 1 Score: 100.523 bits (249), Expect = 2.108e-21
Identity = 129/560 (23.04%), Postives = 213/560 (38.04%), Query Frame = -3
Query:  189 DRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKF-DYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRK-ENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSST-----------------------EKMNNLAAREFCA-----NRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEG--NWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGL--WDDAHCQSMNSVICE-------------------PINDTKNG---FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNL-GRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEP-KGGRNENCITGNN--YQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRN------------------------YKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNG-GKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVE 1613
            D  T+ +A ++C+K    L+++   + N  V   +K    +   W+  ND   EGV   +D   +SY NW  KEP  +   E+C +  R +G WND  C+     +C+   N   P    +  S                         ++ N + A   C+       +  +V I+N  +    +T  + SN    WI   D   EG   WVDY    ++Y NW + +P      +C    T ++ L  WD   C      +CE                   P   +K G   + +   K+ +  A + C+    +L+ I G  +  Q Y +    +L G  W           +  S Q++  +  W + +P + G ++ C+  NN    +  W+   CG  NS +C+  K  P   H++ S                           +      C  +   LV I + ++  F+     KS   + WI  ND   EG W  +D   L Y+ WN  +PN     ENC + +   +  WND  C  +   IC+ K+E
Sbjct: 1353 DLKTWMEARDFCRKSRGDLVSLRTANENAFVFSEIKTRYYYWTVWIGLNDLGTEGVNTWSDGSPMSYINWGNKEPNNWNGMEDCGEMSRFDGRWNDQNCNLKRTFVCRKHNNTIFPPFTMIPPSPGPAVGKCDSGWINYDKSCYKFVFDQRQNWVNAESVCSQGLNSTNSGHLVVINNLYEQAF-LTTMLASNRGNVWIGLNDLHTEGTFGWVDYS--SVAYTNWIAGKPGWSYWADCVGMSTSSSSLGEWDVEVCSGFQGYVCETDALPLGPTTAPPTPSPDCPSGYSKYGESCYLMYYNKLNWKEAGEVCQKDGAQLISIHG--VKEQAYMIKNLKDLVGNVWTGMVRMPNSLMFTWSDQSVKQYTNWARGQPGQPGTSQTCVQVNNSITSNGRWSAVDCGLKNSFMCKIYKGEP---HVTPSLLGECQPGWVKFDKFCYLFSGISAYVTWSQARSTCTRQGADLVSILNQEEQDFLI-YQSKSSYRSIWIGLNDRNIEGGWQWSDGSPLAYVAWNGGEPNDLVGVENCGE-MVAGNRLWNDYSCSQQRGYICKSKLE 1902          

HSP 2 Score: 97.4413 bits (241), Expect = 2.222e-20
Identity = 91/379 (24.01%), Postives = 150/379 (39.58%), Query Frame = -3
Query:  201 AREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEG--NWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE----PINDTKNGFHITSVKMKFDTAVKY-------CRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQ--WEDSKQNL-LSFKKWHKSEPKGGRN-ENCITG-NNYQDALWNDEKCGSLNSVICQ--------PIKYGPSK---YHISKSKR---NYKDGVKYCKSKKMS--LVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPN--GGKKENCIQGL---YFSDGTWNDVKCDMKNKVICE 1220
            A   C +    +  I + S+ +       +    +FW+   D ANE   NW D    K  Y NW   EP+  +       L   +GLW+D  C    S IC+    P++         +   KF T+ K        C      LVK+D     + +  +  T      WI  ND   EG   WE     L  ++  W+  EP    + E+CI+  +      WND+ C +L + +C+        P+ + P K   YH +  +     ++     C++      L+ I +  + +F+  +    K G  W+  ND  +EG +V +D   + Y NW   +P+  G    +C+  +    F  G W  V C   N  +C+
Sbjct:   54 AENLCQSYGGHLASISDQSEQNFITGRIKQYTNEHFWVGFNDRANESSYNWTD-GTAKPFYTNWRRGEPNNFQDNEDCTELLYQDGLWNDDDCSKEYSFICKTLKAPLSCDAGWSQYGASCYKFSTSSKTWLIAQQDCHQSGGYLVKVDNSDEQHFLSYMMKTVMKQAAWIGLNDRAIEGTYVWEGDNTKLGQNYSHWYSGEPNDHASVEDCISMYSGSLGGFWNDDYCDTLRAYVCEKPNGQSLCPVNWVPYKDSCYHFNTHQAQLVTWEKAYNVCQAAMPGSDLLSILEKDEQQFIEQVLSDRKSGDIWLGLNDRVSEGTFVWSDRSPVNYTNWGQYEPSKYGSDSRDCVSLIPWTPFGSGDWGTVSCTTTNAYVCK 431          

HSP 3 Score: 92.4337 bits (228), Expect = 6.252e-19
Identity = 91/393 (23.16%), Postives = 167/393 (42.49%), Query Frame = -3
Query:  921 TREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEG--NWVDSNNNKLSYTNWHYQEPDGGK-RENCIQSLVYADGFWNDVECDQPNSVICEPMR-----------HTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWL-NTDNEEIS--YKNWHPKEPQGYRK-ENCIQ--GLRINGLWNDVTCDSLGEVICQPIQNKKR------PSSNSLFYSST--------EKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPD--GGKTENCAVSLTD----ANGLWDDAHCQSMNSVICE 1979
            T    ++++A   C +   +L +I +++    +     QY  + +W+  ND   E   NW D       YTNW   EP+  +  E+C + L+Y DG WND +C +  S IC+ ++           +  + Y       T+  A   C +    L+ ++N      +  ++K  +K   W+  ND + EG ++   DN ++   Y +W+  EP  +   E+CI      + G WND  CD+L   +C+    +        P  +S ++ +T        EK  N+       +  + I++ D     +  ++     ++   W+   D  +EG +V      ++Y NW   EP   G  + +C VSL       +G W    C + N+ +C+
Sbjct:   45 TVRGQSWENAENLCQSYGGHLASISDQSEQNFITGRIKQYTNEHFWVGFNDRANESSYNWTDGTAKPF-YTNWRRGEPNNFQDNEDCTE-LLYQDGLWNDDDCSKEYSFICKTLKAPLSCDAGWSQYGASCYKFSTSSKTWLIAQQDCHQSGGYLVKVDNSDEQHFLSYMMKTVMKQAAWIGLNDRAIEGTYVWEGDNTKLGQNYSHWYSGEPNDHASVEDCISMYSGSLGGFWNDDYCDTLRAYVCEKPNGQSLCPVNWVPYKDSCYHFNTHQAQLVTWEKAYNVCQAAMPGSDLLSILEKDEQQFIEQVLSDRKSGDI---WLGLNDRVSEGTFVWSDRSPVNYTNWGQYEPSKYGSDSRDC-VSLIPWTPFGSGDWGTVSCTTTNAYVCK 431          

HSP 4 Score: 73.9442 bits (180), Expect = 2.800e-13
Identity = 70/254 (27.56%), Postives = 104/254 (40.94%), Query Frame = -3
Query:  201 FHITSVKMK---FDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQ--WEDSKQNLLSFKKWHKSEPKGGR-NENCITGNNYQDALWNDEKCGSLNSVICQPIK-----------YGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWV-DTDNESL--TYLNWNIRQPNG-GKKENCIQGLYFS-DGTWNDVKCDMKNKVICE 896
            F ++S+ ++   ++ A   C++    L  I      N +      +    +W+  ND   E    W D       +  W + EP   + NE+C T   YQD LWND+ C    S IC+ +K           YG S Y  S S + +    + C      LVK+ +  +  F+  +         WI  ND A EG +V + DN  L   Y +W   +PN     E+CI     S  G WND  CD     +CE
Sbjct:   39 FIVSSLTVRGQSWENAENLCQSYGGHLASISDQSEQNFITGRIKQYTNEHFWVGFNDRANESSYNWTDGTAKPF-YTNWRRGEPNNFQDNEDC-TELLYQDGLWNDDDCSKEYSFICKTLKAPLSCDAGWSQYGASCYKFSTSSKTWLIAQQDCHQSGGYLVKVDNSDEQHFLSYMMKTVMKQAAWIGLNDRAIEGTYVWEGDNTKLGQNYSHWYSGEPNDHASVEDCISMYSGSLGGFWNDDYCDTLRAYVCE 290          

HSP 5 Score: 73.9442 bits (180), Expect = 2.896e-13
Identity = 124/565 (21.95%), Postives = 206/565 (36.46%), Query Frame = -3
Query:  561 FGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVH-DLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDG-GKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHT----------TNKYHIGK------------------DRMTFNDAVNYCKK----RNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRIN----GLWNDVTCDSLGEVICQ-------------------PIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKL-SYKNWYSTEPDGGKTENCAVSLTD---ANGLWDDAHCQSMNSVIC-----EP------INDTKNG----------FHITSVKMKFDTAVKYCRNKKMELVKI-DGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENC---ITGNNYQDALWNDEKCGSLNSVICQ 1994
            F    T +  T+  A  +C     +LV++     N  V  ++  +Y     WI  NDL  EG    S+ + +SY NW  +EP+     E+C + +   DG WND  C+   + +C    +T          +    +GK                   R  + +A + C +     N   + + N    +     +  S + + W+  ND   EG +   D   ++Y NW   +P      +C+ G+  +    G W+   C      +C+                   P    K   S  L Y +  K+N   A E C     +++ I +  K    M   +K  +   W       N   +  + DQ +  Y NW   +P    T    V + +   +NG W    C   NS +C     EP      + + + G          F   S  + +  A   C  +  +LV I + ++ +  +Y    ++     WI  ND   EG W+ S  + L++  W+  EP      ENC   + GN     LWND  C      IC+
Sbjct: 1346 FSNATTADLKTWMEARDFCRKSRGDLVSLRTANENAFVFSEIKTRYYYWTVWIGLNDLGTEGVNTWSDGSPMSYINWGNKEPNNWNGMEDCGE-MSRFDGRWNDQNCNLKRTFVCRKHNNTIFPPFTMIPPSPGPAVGKCDSGWINYDKSCYKFVFDQRQNWVNAESVCSQGLNSTNSGHLVVINNLYEQAFLTTMLASNRGNVWIGLNDLHTEGTFGWVDYSSVAYTNWIAGKPGWSYWADCV-GMSTSSSSLGEWDVEVCSGFQGYVCETDALPLGPTTAPPTPSPDCPSGYSKYGESCYLMYYN--KLNWKEAGEVCQKDGAQLISI-HGVKEQAYMIKNLKDLVGNVWTGMVRMPNSLMFT-WSDQSVKQYTNWARGQPGQPGTSQTCVQVNNSITSNGRWSAVDCGLKNSFMCKIYKGEPHVTPSLLGECQPGWVKFDKFCYLFSGISAYVTWSQARSTCTRQGADLVSILNQEEQDFLIYQSKSSYR--SIWIGLNDRNIEGGWQWSDGSPLAYVAWNGGEPNDLVGVENCGEMVAGNR----LWNDYSCSQQRGYICK 1898          

HSP 6 Score: 63.929 bits (154), Expect = 4.443e-13
Identity = 35/122 (28.69%), Postives = 65/122 (53.28%), Query Frame = -2
Query: 2653 YGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIG-YYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEP-NGKRQENCVHGLYYP--AGLWNDISCNTPNSVICQKKKT 3006
            + Y  N++K +++ A   C+    +L++I++ +    +     ++ +  Y WI  +D  +E  W  S  +P+++ NW + +P N   QE+C H  + P   G WND+ C + NS IC+ KK 
Sbjct:  944 FCYQFNMEKKSWSAARQQCQANGGDLVSIQSPVEQAHITLEVGQFGVREYAWIGLHDESVESAWEWSDGSPVRFTNWYNNQPDNWLAQEDCAHTYHEPHAVGRWNDMPCYSGNSYICKAKKA 1065          

HSP 7 Score: 29.6462 bits (65), Expect = 4.443e-13
Identity = 26/113 (23.01%), Postives = 51/113 (45.13%), Query Frame = -3
Query: 2319 VEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVY-YNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNG-GRKENCIHGL----RYDNEFWNDVNC 2639
            V YG +++++  T+ +A   C  +   L +I     +  V ++ V  ++ G  WI   D ++ G +  +    + +  W+ GEPN  G   +C+         D  +W D +C
Sbjct: 1097 VCYGLILDKK--TWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGMYRWTDGSPVDWTHWWNGEPNDRGITGSCVRATMTVSSRDWMYWVDSDC 1207          

HSP 8 Score: 62.3882 bits (150), Expect = 1.008e-9
Identity = 56/236 (23.73%), Postives = 100/236 (42.37%), Query Frame = -3
Query: 1392 EFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNI-DWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGG-KRENCIQSL--VYADGFWNDVECDQPNSVICE------PMRHTTNK-----------------------YHIGKDRMTFNDAVNYCKKRNMVLINIENE-XXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEP 1997
            +F Y +  EK ++ +A + C A   +LV+I +      +     Q+ + ++ WI  +D   E  W  S+ + + +TNW+  +PD    +E+C  +    +A G WND+ C   NS IC+      P   + N                        Y +  D+ T+ DA + C+ +   L +I     S  +   LV      D W+   D ++ G++  TD   + + +W   EP
Sbjct:  943 QFCYQFNMEKKSWSAARQQCQANGGDLVSIQSPVEQAHITLEVGQFGVREYAWIGLHDESVESAWEWSDGSPVRFTNWYNNQPDNWLAQEDCAHTYHEPHAVGRWNDMPCYSGNSYICKAKKAYVPFGGSVNPTTGTVVTPGCPVGWKRSPDGNVCYGLILDKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGMYRWTDGSPVDWTHWWNGEP 1178          

HSP 9 Score: 43.8986 bits (102), Expect = 1.621e-8
Identity = 30/87 (34.48%), Postives = 47/87 (54.02%), Query Frame = -2
Query: 2617 WIDGNDNGMEGYWV---DSKSNPMQYQNWKSGEPNGKRQ-ENCVHGLYYPA--GLWNDISCNTPNSVICQKKKTKKSICRIR-IPYQ 2856
            WI  ND  +EG +V   D+      Y +W SGEPN     E+C+  +Y  +  G WND  C+T  + +C+K    +S+C +  +PY+
Sbjct:  222 WIGLNDRAIEGTYVWEGDNTKLGQNYSHWYSGEPNDHASVEDCIS-MYSGSLGGFWNDDYCDTLRAYVCEKPN-GQSLCPVNWVPYK 306          

HSP 10 Score: 33.8834 bits (76), Expect = 1.621e-8
Identity = 26/119 (21.85%), Postives = 51/119 (42.86%), Query Frame = -3
Query: 2277 EIMTYDEAVKFC--GEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPN--GGRKENCIHGL---RYDNEFWNDVNCFHKNMVICEPMEKS 2612
            +++T+++A   C        LL+I  +   + +  +      G  W+  ND   EG++V S    + +  W Q EP+  G    +C+  +    + +  W  V+C   N  +C+    S
Sbjct:  318 QLVTWEKAYNVCQAAMPGSDLLSILEKDEQQFIEQVLSDRKSGDIWLGLNDRVSEGTFVWSDRSPVNYTNWGQYEPSKYGSDSRDCVSLIPWTPFGSGDWGTVSCTTTNAYVCKKTRAS 436          

HSP 11 Score: 43.8986 bits (102), Expect = 1.664e-7
Identity = 35/123 (28.46%), Postives = 56/123 (45.53%), Query Frame = -3
Query: 2292 FVEYGYLIN--EEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTY---WITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRK-ENCIHGLRYDNEFWNDVNCFHKNMVICE 2642
            F ++ YL +     +T+ +A   C  +   L++I    +N+   +  +Y +  +Y   WI  ND + EG W  S    L +  W  GEPN     ENC   +   N  WND +C  +   IC+
Sbjct: 1781 FDKFCYLFSGISAYVTWSQARSTCTRQGADLVSI----LNQEEQDFLIYQSKSSYRSIWIGLNDRNIEGGWQWSDGSPLAYVAWNGGEPNDLVGVENCGE-MVAGNRLWNDYSCSQQRGYICK 1898          

HSP 12 Score: 30.4166 bits (67), Expect = 1.664e-7
Identity = 28/125 (22.40%), Postives = 51/125 (40.80%), Query Frame = -2
Query: 2641 YVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWID--GNDNGMEGYWVDSKSNPMQYQNWKSGEPNGK-RQENCVH--GLYYPAGLWNDISCNTPNSVICQKKKTKKSI 3000
            Y++   K+ +  A   C++   +L++I +G+  +      +K  +G  W       N +   W D      QY NW  G+P      + CV         G W+ + C   NS +C+  K +  +
Sbjct: 1645 YLMYYNKLNWKEAGEVCQKDGAQLISI-HGVKEQAYMIKNLKDLVGNVWTGMVRMPNSLMFTWSDQSVK--QYTNWARGQPGQPGTSQTCVQVNNSITSNGRWSAVDCGLKNSFMCKIYKGEPHV 1766          

HSP 13 Score: 53.9138 bits (128), Expect = 3.573e-7
Identity = 34/120 (28.33%), Postives = 54/120 (45.00%), Query Frame = -2
Query: 2644 VNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGY--WVDSKSNPMQYQNWKSGEPNG-KRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKS 2994
            + ++  ++  A + C+     L +I +      +     +Y   ++W+  ND   E    W D  + P  Y NW+ GEPN  +  E+C   L Y  GLWND  C+   S IC+  K   S
Sbjct:   44 LTVRGQSWENAENLCQSYGGHLASISDQSEQNFITGRIKQYTNEHFWVGFNDRANESSYNWTDGTAKPF-YTNWRRGEPNNFQDNEDCTE-LLYQDGLWNDDDCSKEYSFICKTLKAPLS 161          

HSP 14 Score: 53.9138 bits (128), Expect = 4.375e-7
Identity = 34/103 (33.01%), Postives = 52/103 (50.49%), Query Frame = -2
Query: 2662 AVSFCKEQNMELLTIKNGIINKRVFN-MAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNG-KRQENCVHGLYYPAGLWNDISCNTPNSVICQK 2964
            A  FC++   +L++++    N  VF+ +  +Y     WI  ND G EG    S  +PM Y NW + EPN     E+C     +  G WND +CN   + +C+K
Sbjct: 1360 ARDFCRKSRGDLVSLRTANENAFVFSEIKTRYYYWTVWIGLNDLGTEGVNTWSDGSPMSYINWGNKEPNNWNGMEDCGEMSRFD-GRWNDQNCNLKRTFVCRK 1461          

HSP 15 Score: 50.447 bits (119), Expect = 4.764e-6
Identity = 53/272 (19.49%), Postives = 107/272 (39.34%), Query Frame = -3
Query:  921 YHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDY-WVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGY-RKENCIQGL---RINGLWNDVTCDSLGEVICQ------------------------PIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKS-NLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEP-DGGKTENCAVSLTDANG----LWDDAHC-QSMNSVICE 1628
            Y    ++ +++ A   C+     L++I++      +   V +    +Y W+  +D S E  W  +D   + + NW+  +P  +  +E+C          G WND+ C S    IC+                        P+  K+ P  N  +    +K     AR+ C  +   +  I    ++ L  +  + S +    WI  TD+   G +       + + +W++ EP D G T +C  +    +      W D+ C ++ ++ +C+
Sbjct:  946 YQFNMEKKSWSAARQQCQANGGDLVSIQSPVEQAHITLEVGQFGVREYAWIGLHDESVESAWEWSDGSPVRFTNWYNNQPDNWLAQEDCAHTYHEPHAVGRWNDMPCYSGNSYICKAKKAYVPFGGSVNPTTGTVVTPGCPVGWKRSPDGNVCYGLILDKKTWPDARDSCRAQGAELASIHTGWESALVTSLLVTSWDAGDVWIGLTDTNQRGMYRWTDGSPVDWTHWWNGEPNDRGITGSCVRATMTVSSRDWMYWVDSDCTENSHAYVCK 1217          

HSP 16 Score: 49.6766 bits (117), Expect = 7.336e-6
Identity = 38/113 (33.63%), Postives = 53/113 (46.90%), Query Frame = -2
Query: 2659 MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYY---WIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQ-ENCVHGLYYPAG--LWNDISCNTPNSVICQKK 2979
            + ++ A S C  Q  +L++I    +N+   +  I      Y   WI  ND  +EG W  S  +P+ Y  W  GEPN     ENC   +   AG  LWND SC+     IC+ K
Sbjct: 1795 VTWSQARSTCTRQGADLVSI----LNQEEQDFLIYQSKSSYRSIWIGLNDRNIEGGWQWSDGSPLAYVAWNGGEPNDLVGVENCGEMV---AGNRLWNDYSCSQQRGYICKSK 1900          
BLAST of SMED30004599 vs. Ensembl Nematostella
Match: EDO46778 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP19])

HSP 1 Score: 55.4546 bits (132), Expect = 3.849e-9
Identity = 36/119 (30.25%), Postives = 58/119 (48.74%), Query Frame = -3
Query:  189 SKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQP-NGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVE 542
            S +     KR +KD  +YC++   +L  I   K+N FV +L    +   +WI  ND+ NE  +V +D  S+ +  W  ++P + GK ++C   L  S  TW D  C      +C   +E
Sbjct:   13 SCFKFVSEKRPWKDASRYCQNIGGNLTSIHSAKENDFVSNLG---EGNAYWIGLNDLKNEKAFVWSDGTSVGFTQWAFKRPSDNGKDKDCTYLLKQSK-TWIDFSCANSYPFVCRYPLE 127          

HSP 2 Score: 50.447 bits (119), Expect = 2.271e-7
Identity = 33/113 (29.20%), Postives = 51/113 (45.13%), Query Frame = -3
Query: 1653 YHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEP-DGGKRENCIQSLVYADGFWNDVECDQPNSVICE 1988
            + +  EK  +K A +YC     NL +I +   N  V +L      + YWI  NDL  E  +V S+   + +T W ++ P D GK ++C   L+     W D  C      +C 
Sbjct:   15 FKFVSEKRPWKDASRYCQNIGGNLTSIHSAKENDFVSNLG---EGNAYWIGLNDLKNEKAFVWSDGTSVGFTQWAFKRPSDNGKDKDCTY-LLKQSKTWIDFSCANSYPFVCR 123          
BLAST of SMED30004599 vs. Ensembl Nematostella
Match: EDO31778 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWZ4])

HSP 1 Score: 53.9138 bits (128), Expect = 1.060e-8
Identity = 31/115 (26.96%), Postives = 59/115 (51.30%), Query Frame = -3
Query: 1653 FGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGF-WNDVECDQPNSVICE 1994
            + Y  +   +T+K A   C   S  LV++ N   N  +     Q+N +  W+  +D+  EG +V ++ +  ++TNW   +P+  K ++C+ +L    G+ WNDV C   ++  C+
Sbjct:    7 YCYKTSNTCLTWKRAESACAVMSSGLVSVHNHEENVFIQQ---QHNGEKSWVGLSDVTTEGQFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGVNYGYKWNDVPCTACHNYTCK 118          

HSP 2 Score: 48.1358 bits (113), Expect = 8.967e-7
Identity = 31/113 (27.43%), Postives = 48/113 (42.48%), Query Frame = -3
Query:  201 YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDG-TWNDVKCDMKNKVICE 536
            Y  S +   +K     C      LV + + ++N F+       K    W+  +DV  EG +V  D     + NW   QPN  K ++C+  L  + G  WNDV C   +   C+
Sbjct:    9 YKTSNTCLTWKRAESACAVMSSGLVSVHNHEENVFIQQQHNGEKS---WVGLSDVTTEGQFVWADGSPTNFTNWAPNQPNDYKNQDCVHTLGVNYGYKWNDVPCTACHNYTCK 118          
BLAST of SMED30004599 vs. Ensembl Nematostella
Match: EDO46963 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNP3])

HSP 1 Score: 52.7582 bits (125), Expect = 3.727e-8
Identity = 39/132 (29.55%), Postives = 54/132 (40.91%), Query Frame = -3
Query:  186 IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLAL--KSKLGTFWIN---GNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGT---WNDVKCDMKNKVICELKVEK 557
            ++   S Y   ++  N+ D    C      LVKIT +++N FVY+L+          WI          +  WVD       Y  W   +PNG  +E+C Q   FS      WND+ CD  N   C    EK
Sbjct:    6 VRLNRSCYKADQTIMNWADARAACGKLGGDLVKITSEQENTFVYELSRNQAPSRSLMWIGLKRNPTTPTKFEWVDGSRP--LYTKWWTGEPNGLGREDCGQIHTFSGSGAKHWNDLSCDQGNAYKCGFICEK 135          

HSP 2 Score: 45.8246 bits (107), Expect = 8.598e-6
Identity = 35/119 (29.41%), Postives = 53/119 (44.54%), Query Frame = -3
Query: 1656 YHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSL----QYNIDWYWINGNDLIK-EGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADG---FWNDVECDQPNSVIC 1988
            Y   +  M +  A   C     +LV I +E  N  V++LS       ++ W  +  N     +  WVD   ++  YT W   EP+G  RE+C Q   ++      WND+ CDQ N+  C
Sbjct:   13 YKADQTIMNWADARAACGKLGGDLVKITSEQENTFVYELSRNQAPSRSLMWIGLKRNPTTPTKFEWVD--GSRPLYTKWWTGEPNGLGREDCGQIHTFSGSGAKHWNDLSCDQGNAYKC 129          
BLAST of SMED30004599 vs. Ensembl Medaka
Match: mrc1a (mannose receptor C-type 1 [Source:NCBI gene;Acc:101161518])

HSP 1 Score: 114.775 bits (286), Expect = 2.234e-25
Identity = 145/697 (20.80%), Postives = 251/697 (36.01%), Query Frame = -3
Query:  204 GYHYTR---EKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE----------PMR-----------HTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGY--RKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSN-----------SLFYSS------TEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENC-AVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHI-----------------------------TSVKMKFDTAVKYCRNKKMELVKIDGDQ-MNNQVYNLSVTFNLGRYWINGNDNRKEG-QWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNYQDALWNDEKCGSLNSVICQP------------------------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPN-GGKKENCIQGLYFSDGTWNDVKCDMKNKVIC 1991
            G  Y R     +T+  A K C  Q  +L++I        +  L+        WI  N L  E  W  SN N   Y NW    P      NC          W    C +    IC           P++           +  N Y + + +  + DA+  C+K    L +I +      V      S     W+  ND   + ++  +D+ ++++  W   EP      +E+C+     +G W D TC+ +   IC+   +      N           S  + S      +E      A++ CAN    ++ I N  +N   ++        YFW   +++ ++  +    ++K+++ ++ + +PD  + + C A++     GLWD   C +    IC+ + D      +                             ++ K  +  A  +C+    +L+ I   + +NN  +  S    L     N      EG  W D       F+ W   EP    + E+C   + Y    WND  C S N  ICQ                         I Y  S+++++      +    YCK     L  +T D + KF++    +     ++I G  V  +  +   D   +TY  WN  +PN     ENC+  +Y   G WND+ C ++   +C
Sbjct:  227 GVQYQRNAQAALTWHQARKSCQQQGADLLSIVELHEQSYISGLTSHLGTS-LWIGLNSLDFESGWQWSNGNPFRYLNWGPGHPSSEPGLNCATINAGKASKWESNACTKKLGYICRKGNSTNLPPPPIKGPSFCPSHWVPYAGNCYFLERSKKMWRDALAACRKDGGDLASIHSIEEQSFVISQTGYSQTDMLWIGFNDQRNQLLFEWSDHSQVTFTQWDTGEPSHIINHQEDCVLIRGKDGKWADHTCEKMHGYICKKKASTTMSEGNQEEVNPGCKLGSFRFGSFCYNIGSETKTFEEAKQACANSGGNLLDIANRYENAFLVSLVGLRPEKYFWTGFSNTEDKTIFKWTTNRKVTFTHFNAGQPD--RLQGCVAITTGIFAGLWDVISCTNKEKYICKKVADNVQMTTVPPTTPALNCAPGWTPVVERNTCLKIYRKESASKKTWQEAQDFCKTIGGDLLSIHSTRDLNNIEFRSSAWIGLRLQGTN------EGFAWSDGSP--FEFENWGYGEPNNHMDSEHCTEIHQYYGQYWNDRNCESYNDWICQIKKGVIPKPEPTVVEEVYNTTEDGWIIYNNSQFYVNNENLPMEAARAYCKKNFGDLAVMTGDSERKFIWRQIARFSDMQYYI-GMVVNLDKSFSWLDGTPVTYTAWNHNEPNFANNDENCVT-IYREMGYWNDINCGLELPSVC 910          

HSP 2 Score: 107.071 bits (266), Expect = 4.855e-23
Identity = 151/710 (21.27%), Postives = 279/710 (39.30%), Query Frame = -3
Query:  189 YHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDG--GKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNK----------------------YHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRN--MRIVKIDNASK--------------NDLAMTYAIK--SNLSY---FWID-GTDSANEG-NWVDYQDQKLSYKNWYSTEPDGG-KTENCAVSLTDANGLWDDAHCQSMNSVIC----------EPI------NDTKNG--------FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNR-KEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNYQD-ALWNDEKCGSLNSVICQ---------------PIKYGPSKYHISKSK---------RNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFS-----------DGTWNDVKCDMKNKVICELKVE 1988
            Y   R K  ++ A+  C     +L +I +      V   +     D  WI  ND   +  +  S+++++++T W   EP      +E+C+  +   DG W D  C++ +  IC+    TT                        Y+IG +  TF +A   C      L++I N   N  +  LV    +  +W   ++  ++ ++  T N ++++ +++  +P   +    I      GLW+ ++C +  + IC+ + +  + ++      +T  +N          RN  ++I + ++ASK               DL   ++ +  +N+ +    WI       NEG  W D       ++NW   EP+    +E+C          W+D +C+S N  IC          EP       N T++G        F++ +  +  + A  YC+    +L  + GD     ++     F+  +Y+I    N  K   W D     +++  W+ +EP    N ENC+T   Y++   WND  CG     +C+               P      ++ + K K         +N++D  ++C ++  +LV I ++ +  F+  + +      FWI  NDV  E H+V TD + ++Y NW    P        +    F             G W    C  K   IC+  V+
Sbjct:  371 YFLERSKKMWRDALAACRKDGGDLASIHSIEEQSFVISQTGYSQTDMLWIGFNDQRNQLLFEWSDHSQVTFTQWDTGEPSHIINHQEDCVL-IRGKDGKWADHTCEKMHGYICKKKASTTMSEGNQEEVNPGCKLGSFRFGSFCYNIGSETKTFEEAKQACANSGGNLLDIANRYENAFLVSLVGLRPEKYFWTGFSNTEDKTIFKWTTNRKVTFTHFNAGQPDRLQGCVAITTGIFAGLWDVISCTNKEKYICKKVADNVQMTT---VPPTTPALNCAPGWTPVVERNTCLKIYRKESASKKTWQEAQDFCKTIGGDLLSIHSTRDLNNIEFRSSAWIGLRLQGTNEGFAWSD--GSPFEFENWGYGEPNNHMDSEHCTEIHQYYGQYWNDRNCESYNDWICQIKKGVIPKPEPTVVEEVYNTTEDGWIIYNNSQFYVNNENLPMEAARAYCKKNFGDLAVMTGDSERKFIWRQIARFSDMQYYIGMVVNLDKSFSWLDGTP--VTYTAWNHNEPNFANNDENCVT--IYREMGYWNDINCGLELPSVCRRSNSFINTTMAPTAVPNGGCAPQWILFKGKCYKFFLGNNKNWRDAREFCTNEGGNLVSILNENEQAFL-TIQMFHYNEDFWIGMNDVNWEMHFVWTDGKGISYTNWAKGHPVSSPDGRYMMDEAFDCVIMTGNPAKLKGNWKVEDCGAKRGFICKKNVD 1069          

HSP 3 Score: 98.2117 bits (243), Expect = 2.540e-20
Identity = 160/728 (21.98%), Postives = 270/728 (37.09%), Query Frame = -3
Query:  201 EMTTVAPVVQKL-----------KNTVEFGYHY-TREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGG-KRENCIQSLVYADGFWNDVECD---------------QPNSVICEPMRHTT---------NKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGV-WLNTDNEEISYKNWHPKEPQ-GYRKENCIQGLRINGLWNDVTCDSLGEVICQP----IQNKKRPSSNS---------LFYSSTEKM------NNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYS----TEPDG----GKTENCAVSLTDANGL---WDDAHCQSMNSVICE--------PINDTKNGFH--------ITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ--------PIKYGPSKYHISKSKRNYKDGVKYCKSKK------------------MSLVKITDDKDNKFVYD--LALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 2045
            +MTTV P    L           +NT    Y   +  K T++ A  +C     +L++I    + + ++++  + +    WI          +  S+ +   + NW Y EP+     E+C +   Y   +WND  C+               +P   + E + +TT         +++++  + +    A  YCKK    L  +  +S  K + + + +     Y++    N ++   WL  D   ++Y  W+  EP      ENC+   R  G WND+ C      +C+     I     P++           LF     K       N   AREFC N    +V I N ++           N   FWI   D   E ++V    + +SY NW      + PDG     +  +C +   +   L   W    C +    IC+        P   T   F+        +   KM++D A + C+    +L  I  + +      L ++ +    WI  N+N   G+++      L + KW K EPK   N  C+  +   D  W    C +    +C+         I   P     SK +RN+     +C S +                   SLV I D  +  F+      L+    TFWI G   +++  W+  D   L Y NW    P   K E+C+  ++   G W+   C+     IC+
Sbjct:  631 QMTTVPPTTPALNCAPGWTPVVERNTCLKIYRKESASKKTWQEAQDFCKTIGGDLLSIH---STRDLNNIEFRSSA---WIGLRLQGTNEGFAWSDGSPFEFENWGYGEPNNHMDSEHCTEIHQYYGQYWNDRNCESYNDWICQIKKGVIPKPEPTVVEEVYNTTEDGWIIYNNSQFYVNNENLPMEAARAYCKKNFGDLAVMTGDSERKFIWRQIARFSDMQYYIGMVVNLDKSFSWL--DGTPVTYTAWNHNEPNFANNDENCVTIYREMGYWNDINCGLELPSVCRRSNSFINTTMAPTAVPNGGCAPQWILFKGKCYKFFLGNNKNWRDAREFCTNEGGNLVSILNENEQAFLTIQMFHYNED-FWIGMNDVNWEMHFVWTDGKGISYTNWAKGHPVSSPDGRYMMDEAFDCVIMTGNPAKLKGNWKVEDCGAKRGFICKKNVDSQIVPPPTTPQNFYKLGNDSYKLIVQKMRWDEARRQCQADDADLASIL-NPVTQAYMTLQMSSHNEPVWIGLNNNVTGGRFKWVDNWSLFYTKWGKDEPKS--NYGCVYID--VDKTWKTAPCTNTYYSVCKRSSEIAPTEIPQHPGSCPESKKQRNWIPFRGHCYSFRSSVVDNWAFASVECIKMGASLVSIQDPAEAMFIQKNLELLEDGAKTFWI-GLYKSHDDEWMWIDKSVLDYTNWKSGMP---KSESCVD-IHSDSGQWSTTSCNRYKSYICK 1339          

HSP 4 Score: 74.3294 bits (181), Expect = 6.266e-13
Identity = 72/316 (22.78%), Postives = 125/316 (39.56%), Query Frame = -3
Query:  192 QDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLG-RYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ----------PIKYGPSK------------YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNG--GKKENCIQGLYFSDGTWNDVKCDMKNKVICELKV 1064
            +D +   + W +TE D  K +      T  +  WD            +P+   +   +  +  + +  A K C+ +  +L+ I   +++ Q Y   +T +LG   WI  N    E  W+ S  N   +  W    P      NC T N  + + W    C      IC+          PIK GPS             Y + +SK+ ++D +  C+     L  I   ++  FV      S+    WI  ND  N+  +  +D+  +T+  W+  +P+     +E+C+  +   DG W D  C+  +  IC+ K 
Sbjct:  187 RDGRTDGQLWCATERDYDKEKKWGFCSTQGSSGWDS-----------DPVTGVQYQRNAQAA-LTWHQARKSCQQQGADLLSIV--ELHEQSYISGLTSHLGTSLWIGLNSLDFESGWQWSNGNPFRYLNWGPGHPSSEPGLNCATINAGKASKWESNACTKKLGYICRKGNSTNLPPPPIK-GPSFCPSHWVPYAGNCYFLERSKKMWRDALAACRKDGGDLASIHSIEEQSFVISQTGYSQTDMLWIGFNDQRNQLLFEWSDHSQVTFTQWDTGEPSHIINHQEDCVL-IRGKDGKWADHTCEKMHGYICKKKA 486          

HSP 5 Score: 71.633 bits (174), Expect = 3.503e-12
Identity = 76/389 (19.54%), Postives = 140/389 (35.99%), Query Frame = -3
Query:  201 AREFCANRNMRIVKIDNASKNDLAMTYAIKSNL-SYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTK---------------------NGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKG--GRNENCITGNNYQDALWNDEKCGSLNSVICQ----------------------PIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQ---GLYFSDGTWNDVKCDMKNKVICE 1220
            AR+ C  +   ++ I     ++ +    + S+L +  WI       E  W         Y NW    P      NCA         W+   C      IC   N T                      N + +   K  +  A+  CR    +L  I   +  + V + +        WI  ND R +  +E S  + ++F +W   EP       E+C+     +D  W D  C  ++  IC+                        ++G   Y+I    + +++  + C +   +L+ I +  +N F+  L        FW   ++  ++  +  T N  +T+ ++N  QP+  + + C+    G++   G W+ + C  K K IC+
Sbjct:  243 ARKSCQQQGADLLSI--VELHEQSYISGLTSHLGTSLWIGLNSLDFESGWQWSNGNPFRYLNWGPGHPSSEPGLNCATINAGKASKWESNACTKKLGYICRKGNSTNLPPPPIKGPSFCPSHWVPYAGNCYFLERSKKMWRDALAACRKDGGDLASIHSIEEQSFVISQTGYSQTDMLWIGFNDQRNQLLFEWSDHSQVTFTQWDTGEPSHIINHQEDCVLIRG-KDGKWADHTCEKMHGYICKKKASTTMSEGNQEEVNPGCKLGSFRFGSFCYNIGSETKTFEEAKQACANSGGNLLDIANRYENAFLVSLVGLRPEKYFWTGFSNTEDKTIFKWTTNRKVTFTHFNAGQPD--RLQGCVAITTGIF--AGLWDVISCTNKEKYICK 624          

HSP 6 Score: 46.2098 bits (108), Expect = 4.714e-9
Identity = 33/110 (30.00%), Postives = 49/110 (44.55%), Query Frame = -2
Query: 2656 KMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGK-RQENCVHGLYYPAGLWNDISCNTPNSVICQKKK 2982
            K  +  A  FCK    +LL+I +    + + N+  +      WI     G    +  S  +P +++NW  GEPN     E+C     Y    WND +C + N  ICQ KK
Sbjct:  668 KKTWQEAQDFCKTIGGDLLSIHS---TRDLNNIEFRSSA---WIGLRLQGTNEGFAWSDGSPFEFENWGYGEPNNHMDSEHCTEIHQYYGQYWNDRNCESYNDWICQIKK 771          

HSP 7 Score: 35.4242 bits (80), Expect = 4.714e-9
Identity = 28/113 (24.78%), Postives = 51/113 (45.13%), Query Frame = -3
Query: 2295 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVF-NIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPN-GGRKENCIHGLRYDNEFWNDVNCFHKNMVIC 2627
            + +N E +  + A  +C +    L  +  +   K ++  IA + ++  Y     +  K  SW+D   V+  +  W   EPN     ENC+   R +  +WND+NC  +   +C
Sbjct:  801 FYVNNENLPMEAARAYCKKNFGDLAVMTGDSERKFIWRQIARFSDMQYYIGMVVNLDKSFSWLDGTPVT--YTAWNHNEPNFANNDENCVTIYR-EMGYWNDINCGLELPSVC 910          

HSP 8 Score: 44.2838 bits (103), Expect = 8.350e-7
Identity = 32/125 (25.60%), Postives = 56/125 (44.80%), Query Frame = -2
Query: 2653 IIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGY-WVDSKSNPMQYQNWKSGEPN-GKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKT 3021
            II  +  + VN + +    A ++CK+   +L  +      K ++    ++    Y+I    N  + + W+D    P+ Y  W   EPN     ENCV  +Y   G WNDI+C      +C++  +
Sbjct:  794 IIYNNSQFYVNNENLPMEAARAYCKKNFGDLAVMTGDSERKFIWRQIARFSDMQYYIGMVVNLDKSFSWLDG--TPVTYTAWNHNEPNFANNDENCVT-IYREMGYWNDINCGLELPSVCRRSNS 915          

HSP 9 Score: 29.261 bits (64), Expect = 8.350e-7
Identity = 19/71 (26.76%), Postives = 37/71 (52.11%), Query Frame = -3
Query: 2391 YDEAVKFCGEKNLRLLTIKNEKINKRVF-NIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEP 2600
            + +A +FC  +   L++I NE  N++ F  I +++    +WI  ND + E  +V +    + +  W +G P
Sbjct:  953 WRDAREFCTNEGGNLVSILNE--NEQAFLTIQMFHYNEDFWIGMNDVNWEMHFVWTDGKGISYTNWAKGHP 1021          

HSP 10 Score: 41.5874 bits (96), Expect = 3.881e-6
Identity = 28/107 (26.17%), Postives = 46/107 (42.99%), Query Frame = -2
Query: 2662 MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGY-YWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 2979
            + +  A   C++Q  +LL+I    ++++ +   +   +G   WI  N    E  W  S  NP +Y NW  G P+ +   NC       A  W   +C      IC+K
Sbjct:  238 LTWHQARKSCQQQGADLLSIVE--LHEQSYISGLTSHLGTSLWIGLNSLDFESGWQWSNGNPFRYLNWGPGHPSSEPGLNCATINAGKASKWESNACTKKLGYICRK 342          

HSP 11 Score: 29.6462 bits (65), Expect = 3.881e-6
Identity = 25/114 (21.93%), Postives = 47/114 (41.23%), Query Frame = -3
Query: 2292 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNG--GRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2627
            Y +      + +A+  C +    L +I + +    V +   Y      WI  ND   +  +  S +  + F +W  GEP+     +E+C+  +R  +  W D  C   +  IC+
Sbjct:  371 YFLERSKKMWRDALAACRKDGGDLASIHSIEEQSFVISQTGYSQTDMLWIGFNDQRNQLLFEWSDHSQVTFTQWDTGEPSHIINHQEDCVL-IRGKDGKWADHTCEKMHGYICK 483          
BLAST of SMED30004599 vs. Ensembl Medaka
Match: mrc1b (macrophage mannose receptor 1 [Source:NCBI gene;Acc:101163769])

HSP 1 Score: 110.923 bits (276), Expect = 3.927e-24
Identity = 152/720 (21.11%), Postives = 288/720 (40.00%), Query Frame = -3
Query:  186 YHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPM---------------------RHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRIN-GLWNDVTCDSLGEVICQP-------------------IQNKKRPSSNSLFY-----SSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKS---------NLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDG-GKTENCA-VSLT--DANGLWDDAHCQSMNSVICE---------PINDTKNGFH---------------ITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPK-GGRNENCITGNNYQDALWNDEKCGSLNSVICQ---------------PIKYGPS----KYH------ISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEG-HWVDTDNESLTYLNWNIRQPNGG------KKENCI---QGLYFSDGTWNDVKCDMKNKVICELKVEK 1988
            +H  R  +T+  A+K C  +  +L +I N      V       + D  WI  ND   EG +  S+++ +++T+W + +P     ENC+  L   +G W D  C++ +  IC                        +H +  Y IG +  TF++A + CK  N  L+++ N   N  +  LV +  + ++W+  ++     V++ T+ +++ + +W+   P G+ +        I+ GLW+ + C +  + IC+                     ++  R  S ++ Y       +E+     AR++C      ++ I   S+ DL      K+         N  Y W DG+               +++ +W   EP+     E+CA V L   D NG W+DA+C+S N  +C+         P N+T   ++               I ++    + A  +C+    +L  I     N  ++ L ++ + G ++I  + +     W      +L F++W + +P     ++NC++   YQ   W+   CG     IC+               P K G +    K+       IS  K  +++  K C   + +LV +   +   F+   A  +    FWI  + +  +G +W D  + S T   +N  Q   G       +E+C+     +    G W    C+     IC+ K+++
Sbjct:  355 FHLHRTLLTWADALKECRKEGGDLSSIYNVEDQSFVISQLGYASSDELWIGLNDRSTEGLFEWSDHSTVTFTSWEFGKPLKSTSENCVL-LRGENGNWADRYCEEKHGFICMKQSSSERTGDEVDLNIGCKAGWKKHGSYCYFIGTETKTFDEAKDDCKTSNSYLVDVSNGVDNAFLVSLVGQRPEKNFWLGLSNQKNIDVFVWTNTDQVKFTHWNAGMP-GHAQGCVAMATGISAGLWDLLPCTNKEKYICKHQAEGAVLTVPPPTQTPPQCAEDWTRVGSRNICYKFFTGPRSEEKTWFEARDYCRAIGGDLLSIH--SQADLISRRGGKAWIGLHIADPNTGYVWSDGS--------------PVNFLHWQEGEPNNHNNAESCAEVQLYSWDENGSWNDANCESYNDWLCQIRAGVTPKAPPNNTVTDYNKTADGWIQWKGKEYFINTMPRSMEDARHFCQRHHADLASIGSLAENIFLWKL-ISRSYGAFYIGLSVDLDGSYWWTDGSPIL-FQQWDQDQPSTTAYDQNCVS-MKYQMGFWSTYNCGRELQSICKRTFSPPVNTTAAPTAPPKGGCTPPWMKFDKKCYNIISDRKATWEEARKQCIRMRSTLVAVPSRQVQAFLTIKAASNLASNFWIGLSCLNQDGFYWADGSSRSYTNWGYNKNQRRPGMFYQRWGEEDCVMMSSNVSSGIGKWIIKSCNDTYGFICQKKLDE 1053          

HSP 2 Score: 83.1889 bits (204), Expect = 1.034e-15
Identity = 81/385 (21.04%), Postives = 143/385 (37.14%), Query Frame = -3
Query:  189 AREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVIC------------------EP-INDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPI---------------------KYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCI-QGLYFSDGTWNDVKCDMKNKVICELKVE 1220
            A   C  +   ++ I +  +  + ++  + S  +  WI G     E  W     +   Y  W S  P      NC +  +    LW+ + C      IC                  +P I    + FH+    + +  A+K CR +  +L  I   +  + V +     +    WI  ND   EG +E S  + ++F  W   +P    +ENC+     ++  W D  C   +  IC                        K+G   Y I    + + +    CK+    LV +++  DN F+  L  +     FW+  ++  N   +V T+ + + + +WN   P  G  + C+      S G W+ + C  K K IC+ + E
Sbjct:  230 ADASCKQQASSLLSITDPVQQAV-ISALLGSGRNKLWI-GLVLDTEHGWKWTDGKPFRYLKWDSGNPQPNPGHNCGLLDSSGQFLWESSSCTKKMGYICYKGGIPPAPPHVEEGFCSDPWIPYNGHCFHLHRTLLTWADALKECRKEGGDLSSIYNVEDQSFVISQLGYASSDELWIGLNDRSTEGLFEWSDHSTVTFTSWEFGKPLKSTSENCVLLRG-ENGNWADRYCEEKHGFICMKQSSSERTGDEVDLNIGCKAGWKKHGSYCYFIGTETKTFDEAKDDCKTSNSYLVDVSNGVDNAFLVSLVGQRPEKNFWLGLSNQKNIDVFVWTNTDQVKFTHWNAGMP--GHAQGCVAMATGISAGLWDLLPCTNKEKYICKHQAE 609          

HSP 3 Score: 49.6766 bits (117), Expect = 1.257e-11
Identity = 33/111 (29.73%), Postives = 55/111 (49.55%), Query Frame = -3
Query: 2295 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVIC 2627
            + ++  ++T+ +A+K C ++   L +I N +    V +   Y +    WI  ND S EG +  S + ++ F  W  G+P     ENC+  LR +N  W D  C  K+  IC
Sbjct:  355 FHLHRTLLTWADALKECRKEGGDLSSIYNVEDQSFVISQLGYASSDELWIGLNDRSTEGLFEWSDHSTVTFTSWEFGKPLKSTSENCVL-LRGENGNWADRYCEEKHGFIC 464          

HSP 4 Score: 40.817 bits (94), Expect = 1.257e-11
Identity = 35/117 (29.91%), Postives = 50/117 (42.74%), Query Frame = -2
Query: 2662 YVVNLQK-MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGY-WVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAG--LWNDISCNTPNSVICQK 3000
            Y +N Q  + +  A + CK+Q   LL+I + +  + V +  +       WI    +   G+ W D K  P +Y  W SG P      NC  GL   +G  LW   SC      IC K
Sbjct:  217 YQINTQSALTWAQADASCKQQASSLLSITDPV-QQAVISALLGSGRNKLWIGLVLDTEHGWKWTDGK--PFRYLKWDSGNPQPNPGHNC--GLLDSSGQFLWESSSCTKKMGYICYK 328          

HSP 5 Score: 68.9366 bits (167), Expect = 2.585e-11
Identity = 56/248 (22.58%), Postives = 96/248 (38.71%), Query Frame = -3
Query:  204 TSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEG-QWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC-------QP------------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVIC 887
            T   + +  A   C+ +   L+ I  D +   V +  +     + WI    + + G +W D K     + KW    P+     NC   ++    LW    C      IC        P            I Y    +H+ ++   + D +K C+ +   L  I + +D  FV      +     WI  ND + EG +  +D+ ++T+ +W   +P     ENC+  L   +G W D  C+ K+  IC
Sbjct:  221 TQSALTWAQADASCKQQASSLLSIT-DPVQQAVISALLGSGRNKLWIGLVLDTEHGWKWTDGKP--FRYLKWDSGNPQPNPGHNCGLLDSSGQFLWESSSCTKKMGYICYKGGIPPAPPHVEEGFCSDPWIPYNGHCFHLHRTLLTWADALKECRKEGGDLSSIYNVEDQSFVISQLGYASSDELWIGLNDRSTEGLFEWSDHSTVTFTSWEFGKPLKSTSENCVL-LRGENGNWADRYCEEKHGFIC 464          

HSP 6 Score: 64.6994 bits (156), Expect = 5.697e-10
Identity = 136/710 (19.15%), Postives = 247/710 (34.79%), Query Frame = -3
Query:  201 EKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDG-GKRENCIQSLVYA---DGFWNDVECDQPNSVICEPMRHTTNK------------------------YHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYR-KENCIQGLRINGLWNDVTCDSLGEVICQ-----PIQNKKRPSS------NSLFYSSTEKMNNL---------AAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLS--------------YFWIDGTDSANEGNWVDYQDQK---LSYKNWYSTEPDGGKTENCAV---SLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVK------------------MKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSK------------------------------YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFV-YDLALKSKLGT-FWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 1973
            E+ T+  A  YC A   +L++I ++A      DL +       WI  +       +V S+ + +++ +W   EP+     E+C +  +Y+   +G WND  C+  N  +C+     T K                        Y I     +  DA ++C++ +  L +I +    + +      S  +  +  G     +G +  TD   I ++ W   +P      +NC+      G W+   C    + IC+     P+     P++         +    +K  N+          AR+ C      +V + +       +T    SNL+              ++W DG+ S +  NW   ++Q+   + Y+ W          E+C +   +++   G W    C      IC+   D        S+                   + ++ A+K C+     L  I  + M  QV  L+ T      WI  N N+  G ++      +SF KW + EP   R+  C+  +  QD  W    C      +C      P                                Y     +  + D    C      L  I D  + +F+  ++ +   + T FWI G    ++G W+  D   +T+ NW   +P+          +  SDG+W   +       IC+
Sbjct:  648 EEKTWFEARDYCRAIGGDLLSIHSQA------DL-ISRRGGKAWIGLHIADPNTGYVWSDGSPVNFLHWQEGEPNNHNNAESCAEVQLYSWDENGSWNDANCESYNDWLCQIRAGVTPKAPPNNTVTDYNKTADGWIQWKGKEYFINTMPRSMEDARHFCQRHHADLASIGS--LAENIFLWKLISRSYGAFYIGLSVDLDGSYWWTDGSPILFQQWDQDQPSTTAYDQNCVSMKYQMGFWSTYNCGRELQSICKRTFSPPVNTTAAPTAPPKGGCTPPWMKFDKKCYNIISDRKATWEEARKQCIRMRSTLVAVPSRQVQAF-LTIKAASNLASNFWIGLSCLNQDGFYWADGS-SRSYTNWGYNKNQRRPGMFYQRW--------GEEDCVMMSSNVSSGIGKWIIKSCNDTYGFICQKKLDESTQDQGESINPNIYTRLGNDSIKALPQNLTWEDAMKACKADNANLASIRSELMKAQVDLLAFTLK-APLWIGINKNKTGGSFKYVDGWHMSFAKWAELEPS--RDRPCVYVD--QDGNWRTAFCNQTMKSLCMQTTDVPLPDTDEFFGRCPEDTNVEYQESYTWMPFYGYCYLFVTEEIEWADAASSCVRHGGILASIEDPVEQQFIKSNIEMFQDVHTSFWI-GLYKTHKGEWLWLDYSFMTFTNWAPEEPDSE-----YGAIMTSDGSWTTGRRWHDKSYICK 1327          

HSP 7 Score: 58.9214 bits (141), Expect = 3.078e-8
Identity = 104/549 (18.94%), Postives = 192/549 (34.97%), Query Frame = -3
Query:  192 KDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRING---LWNDVTCDSLGEVIC-------QPIQNKKR-------PSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEG--NWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVIC------EPINDT------------KNG---FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCIT-GNNYQDALWNDEKCGSLNSVICQPIKYGPS---------------------------KYHIS--KSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNG-GKKENCIQGLYFS---DGTWNDVKCDMKNKVICELKV 1616
            +  +T+  A   CK++   L++I +     ++  L+        W+    ++E G W  TD +   Y  W    PQ     NC  GL  +    LW   +C      IC        P   ++        P +   F+     +    A + C      +  I N       ++    ++    WI   D + EG   W D+    +++ +W   +P    +ENC V L   NG W D +C+  +  IC      E   D             K+G   + I +    FD A   C+     LV +     N  + +L        +W+  ++ +    +  +  + + F  W+   P  G  + C+         LW+   C +    IC+    G                             K+       ++ + +   YC++    L+ I    D        +  + G  WI  +       +V +D   + +L+W   +PN     E+C +   +S   +G+WND  C+  N  +C+++ 
Sbjct:  222 QSALTWAQADASCKQQASSLLSITDPVQQAVISALLGSGRN-KLWIGLVLDTEHG-WKWTDGKPFRYLKWDSGNPQPNPGHNC--GLLDSSGQFLWESSSCTKKMGYICYKGGIPPAPPHVEEGFCSDPWIPYNGHCFHLHRTLLTWADALKECRKEGGDLSSIYNVEDQSFVISQLGYASSDELWIGLNDRSTEGLFEWSDH--STVTFTSWEFGKPLKSTSENC-VLLRGENGNWADRYCEEKHGFICMKQSSSERTGDEVDLNIGCKAGWKKHGSYCYFIGTETKTFDEAKDDCKTSNSYLVDVSNGVDNAFLVSLVGQRPEKNFWLGLSNQKNIDVFVWTNTDQVKFTHWNAGMP--GHAQGCVAMATGISAGLWDLLPCTNKEKYICKHQAEGAVLTVPPPTQTPPQCAEDWTRVGSRNICYKFFTGPRSEEKTWFEARDYCRAIGGDLLSIHSQAD-------LISRRGGKAWIGLHIADPNTGYVWSDGSPVNFLHWQEGEPNNHNNAESCAEVQLYSWDENGSWNDANCESYNDWLCQIRA 754          

HSP 8 Score: 39.2762 bits (90), Expect = 3.422e-8
Identity = 31/118 (26.27%), Postives = 51/118 (43.22%), Query Frame = -2
Query: 2665 QKMAYTTAVSFCKEQNMELLTIKN--GIINKRVFNMAIKYKI-----GYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKR-QENCVHGLYYP---AGLWNDISCNTPNSVICQ 2985
            ++  +  A  +C+    +LL+I +   +I++R     I   I     GY W DG+              P+ + +W+ GEPN     E+C     Y     G WND +C + N  +CQ
Sbjct:  648 EEKTWFEARDYCRAIGGDLLSIHSQADLISRRGGKAWIGLHIADPNTGYVWSDGS--------------PVNFLHWQEGEPNNHNNAESCAEVQLYSWDENGSWNDANCESYNDWLCQ 751          

HSP 9 Score: 39.2762 bits (90), Expect = 3.422e-8
Identity = 28/121 (23.14%), Postives = 57/121 (47.11%), Query Frame = -3
Query: 2268 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNG-GRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPAD 2627
            Y IN    + ++A  FC   +  L +I +   N  ++ + +  + G ++I G     +GS+  +    + F++W Q +P+     +NC+  ++Y   FW+  NC  +   IC+     P +
Sbjct:  784 YFINTMPRSMEDARHFCQRHHADLASIGSLAENIFLWKL-ISRSYGAFYI-GLSVDLDGSYWWTDGSPILFQQWDQDQPSTTAYDQNCV-SMKYQMGFWSTYNCGRELQSICKRTFSPPVN 901          

HSP 10 Score: 43.5134 bits (101), Expect = 3.563e-8
Identity = 33/141 (23.40%), Postives = 63/141 (44.68%), Query Frame = -2
Query: 2647 HLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGY-----YWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKK 3054
            H+    C    I    + + ++   + +  A+  C+++  +L +I N  +  + F ++   ++GY      WI  ND   EG +  S  + + + +W+ G+P     ENCV  L    G W D  C   +  IC K+ + +
Sbjct:  337 HVEEGFCSDPWIPYNGHCFHLHRTLLTWADALKECRKEGGDLSSIYN--VEDQSFVIS---QLGYASSDELWIGLNDRSTEGLFEWSDHSTVTFTSWEFGKPLKSTSENCVL-LRGENGNWADRYCEEKHGFICMKQSSSE 471          

HSP 11 Score: 34.6538 bits (78), Expect = 3.563e-8
Identity = 26/115 (22.61%), Postives = 46/115 (40.00%), Query Frame = -3
Query: 2292 YGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIH-GLRYDNEFWNDVNCFHKNMVICE 2633
            Y Y I  E  T+DEA   C   N  L+ + N   N  + ++        +W+  ++      +V +    ++F  W  G P  G  + C+          W+ + C +K   IC+
Sbjct:  493 YCYFIGTETKTFDEAKDDCKTSNSYLVDVSNGVDNAFLVSLVGQRPEKNFWLGLSNQKNIDVFVWTNTDQVKFTHWNAGMP--GHAQGCVAMATGISAGLWDLLPCTNKEKYICK 605          
BLAST of SMED30004599 vs. Ensembl Medaka
Match: mrc2 (mannose receptor C type 2 [Source:NCBI gene;Acc:101168215])

HSP 1 Score: 100.138 bits (248), Expect = 6.769e-21
Identity = 130/703 (18.49%), Postives = 253/703 (35.99%), Query Frame = -3
Query:  201 REKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNK--------------------------YHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYR--KENCIQGLRINGLWNDVTCDSLGEVICQPIQNKK--RPS-----------SNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNS-VICEPINDTKNG--------------------------------FHITSV--KMKFDTAVKYCRNKKMELVKIDGD-------QMNNQVYNLSVTFNLGRYWI--NGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGR---NENCITGNNYQDALWNDEKCGSLNSVICQP--------------------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDL---ALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 1976
            +  +++  A   C  Q  +L+++        ++ L   Y+    WI  NDL   G W  S+++ L Y NW  ++P+    ENC+     + G W + +C      +C+   + T                            Y +  ++  +N A   C+K    L +I      + + + ++K +    W+  +D   +  +  TD+  + +  WHP EP  +R   E+C+      G W+D  C+     IC+    K   +P            S + ++   + +    A++ C +    +V I N  +   A +     +   FWI   D  + G++       +SY NW   EP   ++   A++   A GLW+   C S  +  IC    DT                                   FH + +  ++ +  A  +CR     L+ I G        Q+ ++ +  S       +WI  N  +    G W+ S    ++++ +       GR   N       +     W    C S    IC+                     I +  ++Y     +  +    + C     SL  +    +  F+ +     +K +  ++W+  +   N+G +  +D+  L Y++W + +P+   ++     +  S   W+D KC      IC+
Sbjct:  257 QAALSWSEARISCQQQGADLLSVTKLHEQTYINGLLTGYSAA-LWIGLNDLDISGGWQWSDSSPLKYLNWEKEQPNHADEENCVVIRTESSGRWQNRDCSVDLPYVCKKRPNATMDPFTTDSWTDDEKYECDVGWQAFQAGCYKLNSEKTDWNAAQKNCQKVEANLASIHTLPELEFITRSLRKDID-QLWIGLHDTDMQMDFQWTDHTPVIFTYWHPFEPNNFRNTPEDCVSIWGAEGRWDDSPCNLTLPSICKKPGTKSDGKPQQQDCNQGWKWHSPACYWVGEDLLTFEDAKKSCESHQAALVPITNRFEQAFANSLVFGRSGESFWIGLYDQGSPGSFHWLSGDGVSYTNWNRNEPAKIQSGCVAMATGIATGLWEVKECASAKAKFICRQNQDTSLSPEPPAPLPTPSLSGSCPSGWKSNSNLRYCYKVFHSSQMENRLSWLDAHLFCRRHGAHLLSISGPDEEHFVLQVLHEAFGESEEHEQHWFWIGLNRRNPMDNGSWKWSDGMAVTYQNF-------GRYYYNVRQCAAADLGAMTWLAMHCDSELDWICKIPRGSVEKLPEITEGNTSPEWIMFKEAEYKFFDHRTTWDQAQRICSWFDSSLASVHSADEQMFLANTLRKMVKVEGDSWWLGLHTYENDGRFRWSDHSVLNYISWALGRPHPLSRDRRCVSISASKVDWSDQKCHSDLPYICK 950          

HSP 2 Score: 84.7297 bits (208), Expect = 3.844e-16
Identity = 187/922 (20.28%), Postives = 325/922 (35.25%), Query Frame = -3
Query:  201 CGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGK--RENCIQSLVYADGFWNDVECDQPNSVICE---------PMR---------HTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGV--WLNTDNEEISYKNWHPKEPQGYRKENCIQGLRI-NGLWNDVTCDSL-GEVICQPIQNKKR-----------------PS---SNS-------LFYSST--EKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKS-------NLSYFWI--DGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGK----TENCAVSLTDANGLWDDAHCQSMNSVIC-------EPINDTKNG-------------FHITSVKMKFDTAVKYCR--NKKMELVKIDGDQM--NNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKG-GRNENCITGNNYQDALWNDEKCGSLNSVICQPIKY-------------------GPSKYH------ISKSKRNYKDGVKY-CKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQP--NGGKKE-----NCIQGLYFSD----GTWNDVKCDMK-NKVICE 2579
            C ++   LL++        +  +   Y+    WI  ND    G W  S +  L++  W + +PN   +ENC+      +  W + +C      +C+    +  D                                   P +T    D+ +D E Y+  C V + A  +Q  C                        Y    EK  + +A K C     NL +I      + +   SL+ +ID  WI  +D   + ++  +++  + +T WH  EP+  +   E+C+ S+  A+G W+D  C+     IC+         P +         H+   Y +G+D +TF DA   C+     L+ I N         LV       +W+   D    G   WL+ D   +SY NW+  EP   +         I  GLW    C S   + IC+  Q+                    PS   SNS       +F+SS    +++ L A  FC      ++ I    +    +    ++          +FWI  +  +  + G+W       ++Y+N+       G+       CA +   A   W   HC S    IC       E + +   G             +     +  +D A + C   +  +  V    +QM   N +  + V      +W+  +    +G++  S  ++L++  W    P    R+  C++ +  +   W+D+KC S    IC+ +                     G + Y         +S R      K  C ++   L  ++   +  FV  L LK      W+ G     +GH+       L+Y NW   +P  N G        NC+  ++ +     G W    C+M+ N  IC+
Sbjct:  269 CQQQGADLLSVTKLHEQTYINGLLTGYS-AALWIGLNDLDISGGWQWSDSSPLKYLNWEKEQPNHADEENCVVIRTESSGRWQNRDCSVDLPYVCKKRPNATMD-----------------------------------PFTT----DSWTDDEKYE--CDVGWQA--FQAGC------------------------YKLNSEKTDWNAAQKNCQKVEANLASIHTLPELEFI-TRSLRKDIDQLWIGLHDTDMQMDFQWTDHTPVIFTYWHPFEPNNFRNTPEDCV-SIWGAEGRWDDSPCNLTLPSICKKPGTKSDGKPQQQDCNQGWKWHSPACYWVGEDLLTFEDAKKSCESHQAALVPITNRFEQAFANSLVFGRSGESFWIGLYDQGSPGSFHWLSGDG--VSYTNWNRNEPAKIQSGCVAMATGIATGLWEVKECASAKAKFICRQNQDTSLSPEPPAPLPTPSLSGSCPSGWKSNSNLRYCYKVFHSSQMENRLSWLDAHLFCRRHGAHLLSISGPDEEHFVLQVLHEAFGESEEHEQHWFWIGLNRRNPMDNGSWKWSDGMAVTYQNF-------GRYYYNVRQCAAADLGAM-TWLAMHCDSELDWICKIPRGSVEKLPEITEGNTSPEWIMFKEAEYKFFDHRTTWDQAQRICSWFDSSLASVHSADEQMFLANTLRKM-VKVEGDSWWLGLHTYENDGRFRWSDHSVLNYISWALGRPHPLSRDRRCVSISASK-VDWSDQKCHSDLPYICKRVNVTGTVPPTPSTPHPPSGCPDGWASYQHKCFKVFDQSPRVTWSAAKLKCDTQGGVLAVVSSPLEQAFVTTL-LKYISADLWV-GLTSDPKGHFQWAQAGLLSYTNWAPGEPLDNSGPHHNKTPGNCVVMIHGNPEKKVGMWASKACEMENNGFICQ 1106          

HSP 3 Score: 77.411 bits (189), Expect = 5.930e-14
Identity = 113/538 (21.00%), Postives = 199/538 (36.99%), Query Frame = -3
Query:  183 WVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRI--NGLWNDVTCDSLGEVICQPIQNKKRPSSN---------------------SLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLA----MTYAIKSNLSYFWI--DGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGK--TENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNG------------------FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLG--RYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNS-VICQP--------------------------------IKYGPSKYHISK--SKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGT--------FWI--NGNDVANEGHWVDTDNESLTYLN-----WNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELK---VEKL 1484
            W+  ND    G W  +D+  + Y NW  ++P    +ENC+  +R   +G W +  C      +C     KKRP++                        F +   K+N+       A +N + V+ + AS + L     +T +++ ++   WI    TD   +  W D+     +Y  W+  EP+  +   E+C VS+  A G WDD+ C      IC+      +G                  + +    + F+ A K C + +  LV I       Q +  S+ F      +WI   D    G +     + +S+  W+++EP   ++            LW  ++C S  +  IC+                                 ++Y    +H S+  ++ ++ D   +C+     L+ I+   +  FV  + L    G         FWI  N  +  + G W  +D  ++TY N     +N+RQ                  TW  + CD +   IC++    VEKL
Sbjct:  300 WIGLNDLDISGGWQWSDSSPLKYLNWEKEQPNHADEENCVV-IRTESSGRWQNRDCSVDLPYVC-----KKRPNATMDPFTTDSWTDDEKYECDVGWQAFQAGCYKLNSEKTDWNAAQKNCQKVEANLASIHTLPELEFITRSLRKDIDQLWIGLHDTDMQMDFQWTDHTPVIFTY--WHPFEPNNFRNTPEDC-VSIWGAEGRWDDSPCNLTLPSICKKPGTKSDGKPQQQDCNQGWKWHSPACYWVGEDLLTFEDAKKSCESHQAALVPI--TNRFEQAFANSLVFGRSGESFWIGLYDQGSPGSFHWLSGDGVSYTNWNRNEPAKIQSGCVAMATGIATGLWEVKECASAKAKFICRQNQDTSLSPEPPAPLPTPSLSGSCPSGWKSNSNLRYCYKVFHSSQMENRLSWLDAHLFCRRHGAHLLSISGPDEEHFVLQV-LHEAFGESEEHEQHWFWIGLNRRNPMDNGSWKWSDGMAVTYQNFGRYYYNVRQCAAAD---------LGAMTWLAMHCDSELDWICKIPRGSVEKL 816          

HSP 4 Score: 57.7658 bits (138), Expect = 7.614e-8
Identity = 34/119 (28.57%), Postives = 59/119 (49.58%), Query Frame = -2
Query: 2659 TDYGYVVNLQK-MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKK 3012
            TD  Y  N Q  ++++ A   C++Q  +LL++   +  +   N  +       WI  ND  + G W  S S+P++Y NW+  +PN   +ENCV      +G W +  C+     +C+K+
Sbjct:  248 TDSCYQFNFQAALSWSEARISCQQQGADLLSVTK-LHEQTYINGLLTGYSAALWIGLNDLDISGGWQWSDSSPLKYLNWEKEQPNHADEENCVVIRTESSGRWQNRDCSVDLPYVCKKR 365          
BLAST of SMED30004599 vs. Ensembl Medaka
Match: mrc1b (macrophage mannose receptor 1 [Source:NCBI gene;Acc:101163523])

HSP 1 Score: 93.2041 bits (230), Expect = 9.593e-19
Identity = 134/694 (19.31%), Postives = 247/694 (35.59%), Query Frame = -3
Query:  201 MTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDW---YWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQ------------------PNSVICEP--MRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYR-KENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNS------------------LFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENC-AVSLTDANGLWDDAHCQSMNSVICE---------------PINDTKNG----------FHITSVKMKFDTAVKYCR---------NKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNY---QDALWNDEKCGSLNSVICQP------------------------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 1967
            +T+  A   C  Q+  L+++ +      V  +     ++    +WI G  L  E  W  S+ N   Y NW    P       C  +   AD  W +  C +                  P + +C    + +    Y + + + T++DA   C+K    L++I N      +   +      + W+  ND + EG++  +D   + + +W   +P     +E+C+      G W D  C+     IC     KK  +S S                   +   +E      AR  C +    +  +  +  N    +        +FW+  ++      +V    +++ + +W +  P  G  + C A++     GLWD   C +    IC+               P+     G          F     K  +  A +YC          + K +LV   G      +   +   +LG  W +G+               ++F+ W   EP    N E+C   + Y    +  WND +C   NS  CQ                         +++  ++Y I++   + ++  ++CK     L  I    +N F++    +S  G +WI G +V  +G  V  D+  + Y  W+  QP+    +     +   DG W+D  C  ++K IC+
Sbjct:  212 LTWAEAESSCKQQNATLLSLTDPHQEAYVTAILTSGRMEEGYKFWI-GLTLDPEHGWKWSSQNPFRYLNWDSGYPLSSPGHVCGFADGTADYSWRNSVCSKRLGYICCSHGGPAVPTKAPEAGLCTAPWISYNGRCYQLYRSQKTWSDAQLTCRKEEGDLVSIHNVEEQSFIFSELGYVPTDELWIGLNDRTTEGLFDWSDQSAVRFTSWEFGKPGVQENQEDCVLIRGQKGNWADSVCEEKHGFICM----KKSEASGSEILQEEGCQTGWKRFGSYCYLVGSETKTFDEARMICDHSQSYLADVSTSVDNAFLTSLVGLRPEKHFWLGLSNQREINVFVWTNTKRVRFTHWNAEMP--GDRQGCVAMATGHHAGLWDVLPCANKEKYICKQLAKGAVVTPHPTTVPVQTCTVGWTKLPSGNFCFKFFGDKKTWYEAREYCTAIGGDLLSFHSKDDLVAGRGRHSRAWIGLSAPNLDLGYVWSDGSP--------------VNFQHWSNGEPNNKNNIESCTEFSMYGWDMEGSWNDNQCEKYNSWFCQIPLGVTPKPPPDPVTPDYNTTSDGWLEWKGNQYFINQKSLSMEEARQFCKQFHGDLATINSYNENAFLWKRISRSH-GNYWI-GLNVDFDGTRVWMDHSEVIYQQWDEGQPDYKHYDEQCVIMRVEDGVWHDYNCGFEHKSICK 882          

HSP 2 Score: 91.2781 bits (225), Expect = 3.640e-18
Identity = 133/660 (20.15%), Postives = 252/660 (38.18%), Query Frame = -3
Query:  300 YHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGK-RENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNK-------------------YHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQ---------------PIQN-----KKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDG-GKTENC---AVSLTDANGLWDDAHCQSMNSVICE-PI---------------NDTKNG--------FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGN-DNRKEGQWEDSKQNLLSFKKWHKSEPKGGR-NENCITGNNYQDALWNDEKCGSLNSVICQ------------PI------------KYGPSKYHISKSKR-NYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDV-ANEGHWVDTDNESLT-YLNWNIRQP 1988
            Y   R + T+  A   C  +  +LV+I N      +         D  WI  ND   EG +  S+ + + +T+W + +P   + +E+C+  +    G W D  C++ +  IC      +                     Y +G +  TF++A   C      L ++     N  +  LV    +  +W+  ++  E  V++ T+ + + + +W+ + P   +    +      GLW+ + C +  + IC+               P+Q       K PS N  F    +K     ARE+C      ++     SK+DL    A +   S  WI  +    +  +V      +++++W + EP+     E+C   ++   D  G W+D  C+  NS  C+ P+               N T +G        + I    +  + A ++C+    +L  I+    N  ++   ++ + G YWI  N D      W D  + +  +++W + +P     +E C+     +D +W+D  CG  +  IC+            PI            K+    Y+I K +R  + +  + C+    +L  I   +   F+    + +     WI  + +   E +W +    S    L  N R P
Sbjct:  347 YQLYRSQKTWSDAQLTCRKEEGDLVSIHNVEEQSFIFSELGYVPTDELWIGLNDRTTEGLFDWSDQSAVRFTSWEFGKPGVQENQEDCVL-IRGQKGNWADSVCEEKHGFICMKKSEASGSEILQEEGCQTGWKRFGSYCYLVGSETKTFDEARMICDHSQSYLADVSTSVDNAFLTSLVGLRPEKHFWLGLSNQREINVFVWTNTKRVRFTHWNAEMPGDRQGCVAMATGHHAGLWDVLPCANKEKYICKQLAKGAVVTPHPTTVPVQTCTVGWTKLPSGNFCFKFFGDKKTWYEAREYCTAIGGDLLSFH--SKDDLV---AGRGRHSRAWIGLSAPNLDLGYVWSDGSPVNFQHWSNGEPNNKNNIESCTEFSMYGWDMEGSWNDNQCEKYNSWFCQIPLGVTPKPPPDPVTPDYNTTSDGWLEWKGNQYFINQKSLSMEEARQFCKQFHGDLATINSYNENAFLWK-RISRSHGNYWIGLNVDFDGTRVWMDHSEVI--YQQWDEGQPDYKHYDEQCVI-MRVEDGVWHDYNCGFEHKSICKRSGPPHANSTVAPILTPKGGCEFPWRKFQSKCYNIVKDQRMTWFNAGQTCRGMNANLASIDSREVQAFLLTQMVDAATTDLWIGFHKLHGGEFYWSNGRKRSFVNLLERNFRNP 996          

HSP 3 Score: 74.3294 bits (181), Expect = 6.606e-13
Identity = 148/737 (20.08%), Postives = 265/737 (35.96%), Query Frame = -3
Query:  201 FGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKR-ENCIQSLVYA---DGFWNDVECDQPNSVICE-PMRHTT-----------------------NKYHIGKDRMTFNDAVNYCKK--RNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGN-DNSEEGVWLNTDNEEISYKNWHPKEPQ-GYRKENCIQGLRINGLWNDVTCDSLGEVICQ------------PIQNKK--------RPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNW---------------------------------VDYQDQKLSYKNW-YSTEPDGGKTENCAVSLTDAN---GLWDDAHCQSMNSVIC------------EPINDT------KNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQD--ALWNDEKCGSLNSVIC---------QPIKYG--------PSKYHISKSKR-----------NYKDGVKYCKSKKMSLVKITDDKDNKFVYDLA--LKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 1994
            F + +  +K T+  A +YC A   +L++  ++  + LV     +++  W  ++  +L  +  +V S+ + +++ +W   EP+     E+C +  +Y    +G WND +C++ NS  C+ P+  T                        N+Y I +  ++  +A  +CK+   ++  IN  NE++    +         +YW+  N D     VW+  D+ E+ Y+ W   +P   +  E C+     +G+W+D  C    + IC+            PI   K        +  S        ++M    A + C   N  +  ID+       +T  + +  +  WI G    + G +                                 V + D +L ++++ + +E      + CAV  T+ +   G W    C   N+ +C            EP   T       + F      M +D A KYC      L  I  +     V  L V       WI  N +R    +     + L F  W+++EP+   +++C+    Y D    W    C      +C         QP  +         PS  H     R           N+ +    C      +V I D  +  F+       K +  +FW+ G    ++G W   D   + Y NW+  QP           +  SDG W   +   K   IC+
Sbjct:  628 FCFKFFGDKKTWYEAREYCTAIGGDLLSFHSK--DDLVAGRG-RHSRAWIGLSAPNL--DLGYVWSDGSPVNFQHWSNGEPNNKNNIESCTEFSMYGWDMEGSWNDNQCEKYNSWFCQIPLGVTPKPPPDPVTPDYNTTSDGWLEWKGNQYFINQKSLSMEEARQFCKQFHGDLATINSYNENAFLWKRISRSHG---NYWIGLNVDFDGTRVWM--DHSEVIYQQWDEGQPDYKHYDEQCVIMRVEDGVWHDYNCGFEHKSICKRSGPPHANSTVAPILTPKGGCEFPWRKFQSKCYNIVKDQRMTWFNAGQTCRGMNANLASIDSREVQAFLLTQMVDAATTDLWI-GFHKLHGGEFYWSNGRKRSFVNLLERNFRNPFRDYHPYQIKRPVFFHDDELHFQDYVHFSEMHRSDRDKCAVINTNPSLGIGKWIPQFCNDTNAFVCLRDVDPKSPDSPEPTTPTGYTKIFNDSFKSFPQNMTWDGAQKYCAGDGANLASIKTEWAQAYV-ELQVAKLKRPVWIGLNKDRTSSYFRFIAGSRLKFVNWNENEPRS--DQSCV----YVDVGGKWKTSSCNQTYHFVCMKSSDVLPVQPSNFPGVCPDDPNPSSQHYWIPFRGHCYTFFTKLENWPEASTDCSKHGGMIVSIEDPSEQDFIETELQNYKDQHNSFWL-GLYKTHKGTWKWLDRTVMDYTNWDSHQPGMATYAE----IATSDGMWKTGRPWNKRPYICK 1341          

HSP 4 Score: 46.595 bits (109), Expect = 3.545e-10
Identity = 40/148 (27.03%), Postives = 69/148 (46.62%), Query Frame = -3
Query: 2229 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGN-DYSKEGSWVDSRNVSLQFKKWYQGEPNGGR-KENCIHGLRYDNEFWNDVNCFHKNMVICE----PMEKSPADPEIC---------KSFLELCYN 2627
            Y IN++ ++ +EA +FC + +  L TI +   N  ++   +  + G YWI  N D+     W+D   V  Q  +W +G+P+     E C+  +R ++  W+D NC  ++  IC+    P   S   P +          + F   CYN
Sbjct:  773 YFINQKSLSMEEARQFCKQFHGDLATINSYNENAFLWK-RISRSHGNYWIGLNVDFDGTRVWMDHSEVIYQ--QWDEGQPDYKHYDEQCVI-MRVEDGVWHDYNCGFEHKSICKRSGPPHANSTVAPILTPKGGCEFPWRKFQSKCYN 916          

HSP 5 Score: 38.5058 bits (88), Expect = 3.545e-10
Identity = 33/119 (27.73%), Postives = 48/119 (40.34%), Query Frame = -2
Query: 2665 KMAYTTAVSFCKEQNMELLTI--KNGIINKR-------VFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQ-ENCVHGLYYP---AGLWNDISCNTPNSVICQ 2982
            K  +  A  +C     +LL+   K+ ++  R       +   A    +GY W DG+              P+ +Q+W +GEPN K   E+C     Y     G WND  C   NS  CQ
Sbjct:  636 KKTWYEAREYCTAIGGDLLSFHSKDDLVAGRGRHSRAWIGLSAPNLDLGYVWSDGS--------------PVNFQHWSNGEPNNKNNIESCTEFSMYGWDMEGSWNDNQCEKYNSWFCQ 740          

HSP 6 Score: 64.6994 bits (156), Expect = 4.703e-10
Identity = 78/405 (19.26%), Postives = 140/405 (34.57%), Query Frame = -3
Query:  201 KRPSSNSLFYSSTEKMNNLA-AREFCANRNMRIVKIDNASKNDLAMTYAIKSNLS---YFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVIC----EPINDTK--------------NG--FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRN-ENCITGNNYQDALWNDEKCGSLNSVICQP-------------------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCI-QGLYFSDGTWNDVKCDMKNKVICE 1280
            K P + + +  +++     A A   C  +N  ++ + +  +            +     FWI  T     G W         Y NW S  P       C  +   A+  W ++ C      IC     P   TK              NG  + +   +  +  A   CR ++ +LV I   +  + +++          WI  ND   EG ++ S Q+ + F  W   +P    N E+C+     Q   W D  C   +  IC                      ++G   Y +    + + +    C   +  L  ++   DN F+  L        FW+  ++      +V T+ + + + +WN   P  G ++ C+        G W+ + C  K K IC+
Sbjct:  196 KHPKTGAYYQLNSDAALTWAEAESSCKQQNATLLSLTDPHQEAYVTAILTSGRMEEGYKFWIGLTLDPEHG-WKWSSQNPFRYLNWDSGYPLSSPGHVCGFADGTADYSWRNSVCSKRLGYICCSHGGPAVPTKAPEAGLCTAPWISYNGRCYQLYRSQKTWSDAQLTCRKEEGDLVSIHNVEEQSFIFSELGYVPTDELWIGLNDRTTEGLFDWSDQSAVRFTSWEFGKPGVQENQEDCVLIRG-QKGNWADSVCEEKHGFICMKKSEASGSEILQEEGCQTGWKRFGSYCYLVGSETKTFDEARMICDHSQSYLADVSTSVDNAFLTSLVGLRPEKHFWLGLSNQREINVFVWTNTKRVRFTHWNAEMP--GDRQGCVAMATGHHAGLWDVLPCANKEKYICK 596          

HSP 7 Score: 42.3578 bits (98), Expect = 4.086e-8
Identity = 32/130 (24.62%), Postives = 57/130 (43.85%), Query Frame = -2
Query: 2659 AVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKR-QENCVHGLYYPAGLWNDISCNTPNSVICQKK 3045
            A +C    I      Y +   +  ++ A   C+++  +L++I N      +F+          WI  ND   EG +  S  + +++ +W+ G+P  +  QE+CV  +    G W D  C   +  IC KK
Sbjct:  332 AGLCTAPWISYNGRCYQLYRSQKTWSDAQLTCRKEEGDLVSIHNVEEQSFIFSELGYVPTDELWIGLNDRTTEGLFDWSDQSAVRFTSWEFGKPGVQENQEDCVL-IRGQKGNWADSVCEEKHGFICMKK 460          

HSP 8 Score: 35.8094 bits (81), Expect = 4.086e-8
Identity = 25/122 (20.49%), Postives = 49/122 (40.16%), Query Frame = -3
Query: 2280 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIH-GLRYDNEFWNDVNCFHKNMVICEPMEK 2642
            F  Y YL+  E  T+DEA   C      L  +     N  + ++        +W+  ++  +   +V +    ++F  W    P  G ++ C+     +    W+ + C +K   IC+ + K
Sbjct:  481 FGSYCYLVGSETKTFDEARMICDHSQSYLADVSTSVDNAFLTSLVGLRPEKHFWLGLSNQREINVFVWTNTKRVRFTHWNAEMP--GDRQGCVAMATGHHAGLWDVLPCANKEKYICKQLAK 600          

HSP 9 Score: 57.3806 bits (137), Expect = 9.280e-8
Identity = 46/211 (21.80%), Postives = 81/211 (38.39%), Query Frame = -3
Query:  189 RYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC-------------------QP-IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGK-KENCIQGLYFSDGTWNDVKCDMKNKVICELKVE 758
            ++WI    + + G W+ S QN   +  W    P       C   +   D  W +  C      IC                    P I Y    Y + +S++ + D    C+ ++  LV I + ++  F++           WI  ND   EG +  +D  ++ + +W   +P   + +E+C+  +    G W D  C+ K+  IC  K E
Sbjct:  254 KFWIGLTLDPEHG-WKWSSQNPFRYLNWDSGYPLSSPGHVCGFADGTADYSWRNSVCSKRLGYICCSHGGPAVPTKAPEAGLCTAPWISYNGRCYQLYRSQKTWSDAQLTCRKEEGDLVSIHNVEEQSFIFSELGYVPTDELWIGLNDRTTEGLFDWSDQSAVRFTSWEFGKPGVQENQEDCVL-IRGQKGNWADSVCEEKHGFICMKKSE 462          

HSP 10 Score: 55.8398 bits (133), Expect = 2.457e-7
Identity = 96/551 (17.42%), Postives = 188/551 (34.12%), Query Frame = -3
Query:  192 YHIGKDR-MTFNDAVNYCKKRNMVLINI---ENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENC--IQGLRINGLWNDVTCDSLGEVICQ---PIQNKKRPSSNSL-------------FYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQK-LSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNG-------------------FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCIT-GNNYQDALWNDEKCGSLNSVICQPIKYG----------------------PSK---YHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKK-ENCIQGLYFS---DGTWNDVKCDMKNKVICELKV 1628
            Y +  D  +T+ +A + CK++N  L+++     E+    +    +    + +W+    + E G W  +      Y NW    P       C    G       N V    LG + C    P    K P +                 Y S +  ++  A+  C      +V I N  +     +          WI   D   EG   D+ DQ  + + +W   +P   + +   V +    G W D+ C+  +  IC   ++                       + + S    FD A   C + +  L  +     N  + +L        +W+  ++ R+   +  +    + F  W+   P  G  + C+     +   LW+   C +    IC+ +  G                      PS    +     K+ + +  +YC +    L+      D      +A + +    WI  +    +  +V +D   + + +W+  +PN     E+C +   +    +G+WND +C+  N   C++ +
Sbjct:  204 YQLNSDAALTWAEAESSCKQQNATLLSLTDPHQEAYVTAILTSGRMEEGYKFWIGLTLDPEHG-WKWSSQNPFRYLNWDSGYPLSSPGHVCGFADGTADYSWRNSVCSKRLGYICCSHGGPAVPTKAPEAGLCTAPWISYNGRCYQLYRSQKTWSD--AQLTCRKEEGDLVSIHNVEEQSFIFSELGYVPTDELWIGLNDRTTEG-LFDWSDQSAVRFTSWEFGKPGVQENQEDCVLIRGQKGNWADSVCEEKHGFICMKKSEASGSEILQEEGCQTGWKRFGSYCYLVGSETKTFDEARMICDHSQSYLADVSTSVDNAFLTSLVGLRPEKHFWLGLSNQREINVFVWTNTKRVRFTHWNAEMP--GDRQGCVAMATGHHAGLWDVLPCANKEKYICKQLAKGAVVTPHPTTVPVQTCTVGWTKLPSGNFCFKFFGDKKTWYEAREYCTAIGGDLLSFHSKDDL-----VAGRGRHSRAWIGLSAPNLDLGYVWSDGSPVNFQHWSNGEPNNKNNIESCTEFSMYGWDMEGSWNDNQCEKYNSWFCQIPL 743          
BLAST of SMED30004599 vs. Ensembl Medaka
Match: ENSORLT00000037766.1 (pep primary_assembly:ASM223467v1:21:6513805:6529236:1 gene:ENSORLG00000030608.1 transcript:ENSORLT00000037766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 2.526e-13
Identity = 36/119 (30.25%), Postives = 61/119 (51.26%), Query Frame = -3
Query:  201 IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 557
            I +G S Y  S+ K+++ +  ++C++ +  LV I   ++N F++ +         WI   D   EG W   D   LT   W   QP+  K+E+C+Q +  + G+WND  C+   + ICE
Sbjct:   19 ISFGFSCYFFSEEKKSWDEAREFCRTTEADLVVINSKEENYFLFRVK-PYHFKPVWIGLTDKVQEGTWKWVDGSPLTLKFWEENQPDDYKEEDCVQ-IRHAAGSWNDFSCETSMRWICE 135          

HSP 2 Score: 63.5438 bits (153), Expect = 1.930e-11
Identity = 35/119 (29.41%), Postives = 60/119 (50.42%), Query Frame = -3
Query: 1653 VEFG---YHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE 2000
            + FG   Y ++ EK ++  A ++C     +LV I+++  N  +  +   Y+    WI   D ++EG W   + + L+   W   +PD  K E+C+Q + +A G WND  C+     ICE
Sbjct:   19 ISFGFSCYFFSEEKKSWDEAREFCRTTEADLVVINSKEENYFLFRVK-PYHFKPVWIGLTDKVQEGTWKWVDGSPLTLKFWEENQPDDYKEEDCVQ-IRHAAGSWNDFSCETSMRWICE 135          

HSP 3 Score: 62.003 bits (149), Expect = 6.970e-11
Identity = 33/114 (28.95%), Postives = 56/114 (49.12%), Query Frame = -2
Query: 2659 YVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKK 3000
            Y  + +K ++  A  FC+    +L+ I +   N  +F +   Y     WI   D   EG W     +P+  + W+  +P+  ++E+CV  + + AG WND SC T    IC+K+
Sbjct:   26 YFFSEEKKSWDEAREFCRTTEADLVVINSKEENYFLFRVK-PYHFKPVWIGLTDKVQEGTWKWVDGSPLTLKFWEENQPDDYKEEDCVQ-IRHAAGSWNDFSCETSMRWICEKE 137          

HSP 4 Score: 58.5362 bits (140), Expect = 1.141e-9
Identity = 35/114 (30.70%), Postives = 61/114 (53.51%), Query Frame = -3
Query: 2292 YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSW--VDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2627
            Y  +EE  ++DEA +FC      L+ I +++ N  +F +  Y+     WI   D  +EG+W  VD   ++L+F  W + +P+  ++E+C+  +R+    WND +C      ICE
Sbjct:   26 YFFSEEKKSWDEAREFCRTTEADLVVINSKEENYFLFRVKPYH-FKPVWIGLTDKVQEGTWKWVDGSPLTLKF--WEENQPDDYKEEDCVQ-IRHAAGSWNDFSCETSMRWICE 135          

HSP 5 Score: 57.3806 bits (137), Expect = 2.822e-9
Identity = 37/115 (32.17%), Postives = 54/115 (46.96%), Query Frame = -3
Query:  921 SLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKS-NLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE 1262
            S ++ S EK +   AREFC      +V I++  +N     + +K  +    WI  TD   EG W       L+ K W   +PD  K E+C V +  A G W+D  C++    ICE
Sbjct:   24 SCYFFSEEKKSWDEAREFCRTTEADLVVINSKEEN--YFLFRVKPYHFKPVWIGLTDKVQEGTWKWVDGSPLTLKFWEENQPDDYKEEDC-VQIRHAAGSWNDFSCETSMRWICE 135          

HSP 6 Score: 53.9138 bits (128), Expect = 3.985e-8
Identity = 28/113 (24.78%), Postives = 56/113 (49.56%), Query Frame = -3
Query: 1296 YHIGKDRMTFNDAVNYCK--KRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQ 1628
            Y   +++ ++++A  +C+  + ++V+IN + E+      K          W+   D  +EG W   D   ++ K W   +P  Y++E+C+Q     G WND +C++    IC+
Sbjct:   26 YFFSEEKKSWDEAREFCRTTEADLVVINSKEENYFLFRVKPYHFK---PVWIGLTDKVQEGTWKWVDGSPLTLKFWEENQPDDYKEEDCVQIRHAAGSWNDFSCETSMRWICE 135          

HSP 7 Score: 48.9062 bits (115), Expect = 2.733e-6
Identity = 27/112 (24.11%), Postives = 55/112 (49.11%), Query Frame = -3
Query:  561 FHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ 896
            +  +  K  +D A ++CR  + +LV I+  + N  ++ +   ++    WI   D  +EG W+    + L+ K W +++P   + E+C+   +   + WND  C +    IC+
Sbjct:   26 YFFSEEKKSWDEAREFCRTTEADLVVINSKEENYFLFRVK-PYHFKPVWIGLTDKVQEGTWKWVDGSPLTLKFWEENQPDDYKEEDCVQIRHAAGS-WNDFSCETSMRWICE 135          
BLAST of SMED30004599 vs. Planmine SMEST
Match: SMESG000053698.1 (SMESG000053698.1)

HSP 1 Score: 1651.72 bits (4276), Expect = 0.000e+0
Identity = 820/820 (100.00%), Postives = 820/820 (100.00%), Query Frame = -3
Query:  183 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 2642
            FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENESSNKIVKKLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL
Sbjct:  502 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENESSNKIVKKLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 1321          

HSP 2 Score: 511.531 bits (1316), Expect = 9.465e-162
Identity = 270/612 (44.12%), Postives = 376/612 (61.44%), Query Frame = -3
Query:  201 VEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE-PMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRI-NGLWNDVTCDSLGEVICQ-PIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVIC--EPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQP-------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 2000
            VEFGYH  +E+M Y SAV YC  Q M+++TI +   NK V D++++YN+  YWINGND+ KEG W+DS NN L Y NW   EP+G +RENCI  L Y  G+WND+ C+   +VICE  +++    YH+ K++M +N AVNYCK++ M +I I + + NK V  +  K     YW+NGND ++EG+WL++ N  + YKNW   EP G R+ENCI GL   +G WND+ C+    VIC+  IQN +       ++ + EKMN  +A  +C  +NM +V I NA+ N       +K NL  +WI+G D A EG W+D ++  L YKNW   EP G + ENC  SL    G W+D  C  +N+VIC   PI  T  G+ +   KM + TAV +C+ + MEL+ I    +N +V+N+++ + +G YWI+GNDN  EG W DSK N + ++ W   EP G R ENC+ G  Y   LWND  C + NSVICQ        ++YG   Y I++    Y + VK+C  K + L+ I ++K NK V+++A+   LGT+WI GND + EG WVD+ N SL +  W   +PNGG+KENCI GL + +  WNDV C  KN VICE
Sbjct:   15 VEFGYHLNKERMNYNSAVNYCKRQKMDMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEKTIQNVEFGYHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQNVEFG-----YHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKSQFVEYG---YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 618          

HSP 3 Score: 430.254 bits (1105), Expect = 1.995e-131
Identity = 224/514 (43.58%), Postives = 307/514 (59.73%), Query Frame = -3
Query:  519 TVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE-PMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRIN-GLWNDVTCDSLGEVICQPIQNKKRP--SSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKN----GFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKS 2036
            + A + +K    VEFGYH  +EKM Y SAV YC  Q M ++TI +   NK V D++++YN+  YWINGND+ KEG W+DS NN L Y NW   EP+G +RENCI  L Y DG+WND+ C+   +VICE  +++    YH+ K++M +N AVNYCK++NM ++ I N + NK V  +  K     YW+NGND ++EG+WL++ N  + YKNW   EP G R+ENCI  L    G WND+ C+ L  VIC      K P   ++  +  + +KM    A  FC  +NM ++ I N   N      AIK  + Y+WIDG D+  EG WVD +   + Y+NW S EP+G + ENC   L    GLW+D  C + NSVIC+           G+ I    M +D AVK+C  K + L+ I  +++N +V+N++V +NLG YWI GND  KEG W DS+   L FKKW++ EP GGR ENCI G  Y +  WND  C   N VIC+P++  P+   I KS
Sbjct:  124 SYAVICEKTIQNVEFGYHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQNVEFGYHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICM-----KSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKSQFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKS 632          

HSP 4 Score: 386.726 bits (992), Expect = 1.752e-115
Identity = 205/494 (41.50%), Postives = 297/494 (60.12%), Query Frame = -3
Query:  186 PMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRIN-GLWNDVTCDSLGEVICQ-PIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE-PINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC--QPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEK 1652
            P+++    YH+ K+RM +N AVNYCK++ M +I I + + NK V  +  K     YW+NGND ++EG+WL++ N  + YKNW   EP G R+ENCI GL    G WND+ C+    VIC+  IQN +       ++ + EKMN  +A  +C  + M ++ I +A+ N   +  A+K NL  +WI+G D A EG W+D ++  L YKNW   EP+G + ENC   L   +G W+D  C    +VICE  I + + G+H+   KM +++AV YC+ + ME+V I    +N QV++++V +NLG+YWINGND  KEG W DS+ N L +K W   EP G R ENCI    Y    WND  C  LN+VIC   PI      Y ++  K  Y   V +CK + M L+ I +   NK V+++A+K K+G +WI+GND   EG+WVD+ +  + Y NW   +PNG ++ENC+ GLY+  G WND+ C+  N VIC+ K +K
Sbjct:   11 PVQNVEFGYHLNKERMNYNSAVNYCKRQKMDMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEKTIQNVEFG-----YHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQNVEFGYHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQK 499          

HSP 5 Score: 237.654 bits (605), Expect = 5.342e-105
Identity = 144/381 (37.80%), Postives = 198/381 (51.97%), Query Frame = -3
Query: 1599 VEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQN-------------TCKFWQSTTTRKIPVSTSKSLDNISDKEFYD-KYCSVRY----------------LANLYQKICGWMEKEMTTVAPVV-QKLKNTVEF---GYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTF 2639
            VE+GY +N+E M Y+ AV +C  +N+ ++ I+N  INK+VF+I V YNLG YWI GND +KEG W+DSRN  LQ+K W  GEP+G R+ENCIH L Y   +WND+ C H N VIC        D     +  ++ Y + +   C+                + +      KI        DN  +  + D K   ++Y                +  LY     W +    T   V+ QK K   +F   GY    E MTY  AVK+C  +++ L+TI NE  NK V ++++ YN+  YWI GND  KEG+WVDS N  L +  W+  EP+GG++ENCI  L Y + FWNDV C   N VICEPM  +     I K  +  
Sbjct:  257 VEFGYHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKTDYGYVVNLQKMAYTTAV-SFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKSQFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLEL 636          

HSP 6 Score: 165.236 bits (417), Expect = 5.342e-105
Identity = 73/128 (57.03%), Postives = 100/128 (78.12%), Query Frame = -2
Query: 2662 AVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3045
            AVIC K+ I   ++GY +N +KM Y +AV++CK Q ME++TI +  INKRV ++A+KY +G YWI+GND   EG W+DS++NP+QY+NWK GEPNG+R+ENC+HGL+YP G WNDI CN   +VIC+K
Sbjct:  126 AVICEKT-IQNVEFGYHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEK 252          

HSP 7 Score: 279.641 bits (714), Expect = 6.223e-78
Identity = 134/138 (97.10%), Postives = 134/138 (97.10%), Query Frame = -2
Query: 2641 HLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKSI 3054
            HLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKK K   
Sbjct:  365 HLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKSQF 502          

HSP 8 Score: 159.844 bits (403), Expect = 4.233e-74
Identity = 66/121 (54.55%), Postives = 95/121 (78.51%), Query Frame = -2
Query: 2662 PIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3024
            P+   ++GY +N ++M Y +AV++CK Q M+++TI +  INKRV ++A+KY +G YWI+GND   EG W+DS++NP+QY+NWK GEPNG+R+ENC+HGL+YP G WNDI CN   +VIC+K
Sbjct:   11 PVQNVEFGYHLNKERMNYNSAVNYCKRQKMDMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEK 131          

HSP 9 Score: 139.428 bits (350), Expect = 4.233e-74
Identity = 65/116 (56.03%), Postives = 83/116 (71.55%), Query Frame = -3
Query: 2292 VEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2639
            VE+GY +N+E M Y+ AV +C  + + ++TI +  INKRV +IAV YNLG YWI GND +KEG W+DSRN  LQ+K W  GEPNG R+ENCIHGL Y + +WND+ C     VICE
Sbjct:  136 VEFGYHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICE 251          

HSP 10 Score: 234.572 bits (597), Expect = 3.754e-63
Identity = 111/250 (44.40%), Postives = 161/250 (64.40%), Query Frame = -3
Query:  183 PINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC----QPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 920
            P+ + + G+H+   +M +++AV YC+ +KM+++ I    +N +V +++V +NLG+YWINGND  KEG W DS+ N L +K W   EP G R ENCI G  Y    WND  C    +VIC    Q +++G   YH++K K NY   V YCK +KM ++ I+D   NK V D+A+K  LG +WINGND+A EG W+D+ N  L Y NW I +PNG ++ENCI GL++ DG WND+ C++   VICE  ++ +
Sbjct:   11 PVQNVEFGYHLNKERMNYNSAVNYCKRQKMDMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEKTIQNVEFG---YHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQNV 257          

HSP 11 Score: 164.081 bits (414), Expect = 8.731e-41
Identity = 74/134 (55.22%), Postives = 102/134 (76.12%), Query Frame = -2
Query: 2644 AVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKS 3045
            AVIC K+ I   ++GY +N +KM Y +AV++CK QNME++ I+N  INK+VF++ +KY +G YWI+GND   EG W+DS++NP+QY+NWK GEP+GKR+ENC+H L+YP G WNDI CN  N+VIC K    K+
Sbjct:  247 AVICEKT-IQNVEFGYHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKT 379          

HSP 12 Score: 143.28 bits (360), Expect = 2.544e-34
Identity = 71/143 (49.65%), Postives = 92/143 (64.34%), Query Frame = -2
Query: 2635 NAVICMKSPIIK--TDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVIC---QKKKTKKSICR 3048
            N+VIC K        +YGY++N + M Y  AV FC E+N+ LLTIKN  INKRVFN+A+ Y +G YWI GND   EG WVDS++  +Q++ W  GEPNG R+ENC+HGL Y    WND++C   N VIC   +K      IC+
Sbjct:  489 NSVICQKKKQKSQFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICK 631          

HSP 13 Score: 137.887 bits (346), Expect = 1.378e-32
Identity = 65/116 (56.03%), Postives = 82/116 (70.69%), Query Frame = -3
Query: 2292 VEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2639
            VE+GY +N+E M Y+ AV +C  + + ++TI +  INKRV +IAV YNLG YWI GND +KEG W+DSRN  LQ+K W  GEPNG R+ENCIHGL Y   +WND+ C     VICE
Sbjct:   15 VEFGYHLNKERMNYNSAVNYCKRQKMDMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICE 130          

HSP 14 Score: 123.635 bits (309), Expect = 3.481e-28
Identity = 55/126 (43.65%), Postives = 82/126 (65.08%), Query Frame = -2
Query: 2665 SPIIK-----TDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQ 3027
            +P+++      ++GY    +KM Y +AV +C  Q+M L+TI N   NK V +++++Y I +YWI+GND   EG WVDS +N + Y NW   EP+G ++ENC+  L Y  G WND+ C+ PNSVIC+
Sbjct:  706 APVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE 831          

HSP 15 Score: 121.709 bits (304), Expect = 1.297e-27
Identity = 62/150 (41.33%), Postives = 89/150 (59.33%), Query Frame = -2
Query: 2611 LNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKK---TKKSICRIRIPYQRG 3051
            +N+VIC   PI  T  G+ +   KM + TAV +C+ + MEL+ I    +N +V+N+++ + +G YWI+GNDN  EG W DSK N + ++ W   EP G R ENC+ G  Y   LWND  C + NSVICQ  K   +K  I + +  Y+ G
Sbjct: 1069 MNSVIC--EPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDG 1216          

HSP 16 Score: 115.931 bits (289), Expect = 6.740e-26
Identity = 56/134 (41.79%), Postives = 82/134 (61.19%), Query Frame = -2
Query: 2650 LNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTK 3051
            LN+VIC   PI      Y ++  K  Y   V +CK + M L+ I +   NK V+++A+K K+G +WI+GND   EG+WVD+ +  + Y NW   +PNG ++ENC+ GLY+  G WND+ C+  N VIC+ K  K
Sbjct: 1189 LNSVIC--QPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEK 1320          

HSP 17 Score: 101.293 bits (251), Expect = 2.587e-21
Identity = 54/134 (40.30%), Postives = 81/134 (60.45%), Query Frame = -2
Query: 2647 NAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKK 3048
            N+VIC   P+  T   Y +   +M +  AV++CK++NM L+ I+N   NK V  +  K     YW++GNDN  EG W+++ +  + Y+NW   EP G R+ENC+ GL    GLWND++C++   VICQ  + KK
Sbjct:  826 NSVIC--EPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENESSNKIVKKLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRI-NGLWNDVTCDSLGEVICQPIQNKK 956          

HSP 18 Score: 95.5153 bits (236), Expect = 1.375e-19
Identity = 45/107 (42.06%), Postives = 60/107 (56.07%), Query Frame = -2
Query: 2665 QKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQ 2985
            +KM    A  FC  +NM ++ I N   N      AIK  + Y+WIDG D+  EG WVD +   + Y+NW S EP+G + ENC   L    GLW+D  C + NSVIC+
Sbjct:  969 EKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE 1075          
BLAST of SMED30004599 vs. Planmine SMEST
Match: SMESG000053698.1 (SMESG000053698.1)

HSP 1 Score: 1649.8 bits (4271), Expect = 0.000e+0
Identity = 820/820 (100.00%), Postives = 820/820 (100.00%), Query Frame = -3
Query:  183 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 2642
            FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENESSNKIVKKLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL
Sbjct:  477 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENESSNKIVKKLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 1296          

HSP 2 Score: 494.582 bits (1272), Expect = 1.516e-155
Identity = 263/601 (43.76%), Postives = 367/601 (61.06%), Query Frame = -3
Query:  201 MTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE-PMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRI-NGLWNDVTCDSLGEVICQ-PIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVIC--EPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQP-------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 1967
            M Y SAV YC  Q M+++TI +   NK V D++++YN+  YWINGND+ KEG W+DS NN L Y NW   EP+G +RENCI  L Y  G+WND+ C+   +VICE  +++    YH+ K++M +N AVNYCK++ M +I I + + NK V  +  K     YW+NGND ++EG+WL++ N  + YKNW   EP G R+ENCI GL   +G WND+ C+    VIC+  IQN +       ++ + EKMN  +A  +C  +NM +V I NA+ N       +K NL  +WI+G D A EG W+D ++  L YKNW   EP G + ENC  SL    G W+D  C  +N+VIC   PI  T  G+ +   KM + TAV +C+ + MEL+ I    +N +V+N+++ + +G YWI+GNDN  EG W DSK N + ++ W   EP G R ENC+ G  Y   LWND  C + NSVICQ        ++YG   Y I++    Y + VK+C  K + L+ I ++K NK V+++A+   LGT+WI GND + EG WVD+ N SL +  W   +PNGG+KENCI GL + +  WNDV C  KN VICE
Sbjct:    1 MNYNSAVNYCKRQKMDMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEKTIQNVEFGYHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQNVEFG-----YHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKSQFVEYG---YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 593          

HSP 3 Score: 430.254 bits (1105), Expect = 1.278e-131
Identity = 224/514 (43.58%), Postives = 307/514 (59.73%), Query Frame = -3
Query:  519 TVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE-PMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRIN-GLWNDVTCDSLGEVICQPIQNKKRP--SSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKN----GFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKS 2036
            + A + +K    VEFGYH  +EKM Y SAV YC  Q M ++TI +   NK V D++++YN+  YWINGND+ KEG W+DS NN L Y NW   EP+G +RENCI  L Y DG+WND+ C+   +VICE  +++    YH+ K++M +N AVNYCK++NM ++ I N + NK V  +  K     YW+NGND ++EG+WL++ N  + YKNW   EP G R+ENCI  L    G WND+ C+ L  VIC      K P   ++  +  + +KM    A  FC  +NM ++ I N   N      AIK  + Y+WIDG D+  EG WVD +   + Y+NW S EP+G + ENC   L    GLW+D  C + NSVIC+           G+ I    M +D AVK+C  K + L+ I  +++N +V+N++V +NLG YWI GND  KEG W DS+   L FKKW++ EP GGR ENCI G  Y +  WND  C   N VIC+P++  P+   I KS
Sbjct:   99 SYAVICEKTIQNVEFGYHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQNVEFGYHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICM-----KSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKSQFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKS 607          

HSP 4 Score: 374.015 bits (959), Expect = 5.143e-111
Identity = 200/479 (41.75%), Postives = 287/479 (59.92%), Query Frame = -3
Query:  186 MTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRIN-GLWNDVTCDSLGEVICQ-PIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE-PINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC--QPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEK 1607
            M +N AVNYCK++ M +I I + + NK V  +  K     YW+NGND ++EG+WL++ N  + YKNW   EP G R+ENCI GL    G WND+ C+    VIC+  IQN +       ++ + EKMN  +A  +C  + M ++ I +A+ N   +  A+K NL  +WI+G D A EG W+D ++  L YKNW   EP+G + ENC   L   +G W+D  C    +VICE  I + + G+H+   KM +++AV YC+ + ME+V I    +N QV++++V +NLG+YWINGND  KEG W DS+ N L +K W   EP G R ENCI    Y    WND  C  LN+VIC   PI      Y ++  K  Y   V +CK + M L+ I +   NK V+++A+K K+G +WI+GND   EG+WVD+ +  + Y NW   +PNG ++ENC+ GLY+  G WND+ C+  N VIC+ K +K
Sbjct:    1 MNYNSAVNYCKRQKMDMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEKTIQNVEFG-----YHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQNVEFGYHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQK 474          

HSP 5 Score: 237.654 bits (605), Expect = 4.600e-105
Identity = 144/381 (37.80%), Postives = 198/381 (51.97%), Query Frame = -3
Query: 1599 VEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQN-------------TCKFWQSTTTRKIPVSTSKSLDNISDKEFYD-KYCSVRY----------------LANLYQKICGWMEKEMTTVAPVV-QKLKNTVEF---GYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTF 2639
            VE+GY +N+E M Y+ AV +C  +N+ ++ I+N  INK+VF+I V YNLG YWI GND +KEG W+DSRN  LQ+K W  GEP+G R+ENCIH L Y   +WND+ C H N VIC        D     +  ++ Y + +   C+                + +      KI        DN  +  + D K   ++Y                +  LY     W +    T   V+ QK K   +F   GY    E MTY  AVK+C  +++ L+TI NE  NK V ++++ YN+  YWI GND  KEG+WVDS N  L +  W+  EP+GG++ENCI  L Y + FWNDV C   N VICEPM  +     I K  +  
Sbjct:  232 VEFGYHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKTDYGYVVNLQKMAYTTAV-SFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKSQFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLEL 611          

HSP 6 Score: 165.236 bits (417), Expect = 4.600e-105
Identity = 73/128 (57.03%), Postives = 100/128 (78.12%), Query Frame = -2
Query: 2662 AVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3045
            AVIC K+ I   ++GY +N +KM Y +AV++CK Q ME++TI +  INKRV ++A+KY +G YWI+GND   EG W+DS++NP+QY+NWK GEPNG+R+ENC+HGL+YP G WNDI CN   +VIC+K
Sbjct:  101 AVICEKT-IQNVEFGYHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEK 227          

HSP 7 Score: 279.641 bits (714), Expect = 6.039e-78
Identity = 134/138 (97.10%), Postives = 134/138 (97.10%), Query Frame = -2
Query: 2641 HLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKSI 3054
            HLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKK K   
Sbjct:  340 HLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKSQF 477          

HSP 8 Score: 148.288 bits (373), Expect = 1.240e-70
Identity = 62/106 (58.49%), Postives = 85/106 (80.19%), Query Frame = -2
Query: 2662 MAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 2979
            M Y +AV++CK Q M+++TI +  INKRV ++A+KY +G YWI+GND   EG W+DS++NP+QY+NWK GEPNG+R+ENC+HGL+YP G WNDI CN   +VIC+K
Sbjct:    1 MNYNSAVNYCKRQKMDMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEK 106          

HSP 9 Score: 139.813 bits (351), Expect = 1.240e-70
Identity = 65/116 (56.03%), Postives = 83/116 (71.55%), Query Frame = -3
Query: 2292 VEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2639
            VE+GY +N+E M Y+ AV +C  + + ++TI +  INKRV +IAV YNLG YWI GND +KEG W+DSRN  LQ+K W  GEPNG R+ENCIHGL Y + +WND+ C     VICE
Sbjct:  111 VEFGYHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICE 226          

HSP 10 Score: 224.172 bits (570), Expect = 1.051e-59
Identity = 108/235 (45.96%), Postives = 152/235 (64.68%), Query Frame = -3
Query:  183 MKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC----QPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 875
            M +++AV YC+ +KM+++ I    +N +V +++V +NLG+YWINGND  KEG W DS+ N L +K W   EP G R ENCI G  Y    WND  C    +VIC    Q +++G   YH++K K NY   V YCK +KM ++ I+D   NK V D+A+K  LG +WINGND+A EG W+D+ N  L Y NW I +PNG ++ENCI GL++ DG WND+ C++   VICE  ++ +
Sbjct:    1 MNYNSAVNYCKRQKMDMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEKTIQNVEFG---YHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQNV 232          

HSP 11 Score: 164.081 bits (414), Expect = 8.692e-41
Identity = 74/134 (55.22%), Postives = 102/134 (76.12%), Query Frame = -2
Query: 2644 AVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKS 3045
            AVIC K+ I   ++GY +N +KM Y +AV++CK QNME++ I+N  INK+VF++ +KY +G YWI+GND   EG W+DS++NP+QY+NWK GEP+GKR+ENC+H L+YP G WNDI CN  N+VIC K    K+
Sbjct:  222 AVICEKT-IQNVEFGYHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKT 354          

HSP 12 Score: 143.28 bits (360), Expect = 2.501e-34
Identity = 71/143 (49.65%), Postives = 92/143 (64.34%), Query Frame = -2
Query: 2635 NAVICMKSPIIK--TDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVIC---QKKKTKKSICR 3048
            N+VIC K        +YGY++N + M Y  AV FC E+N+ LLTIKN  INKRVFN+A+ Y +G YWI GND   EG WVDS++  +Q++ W  GEPNG R+ENC+HGL Y    WND++C   N VIC   +K      IC+
Sbjct:  464 NSVICQKKKQKSQFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICK 606          

HSP 13 Score: 125.561 bits (314), Expect = 7.819e-29
Identity = 59/105 (56.19%), Postives = 73/105 (69.52%), Query Frame = -3
Query: 2292 MTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2606
            M Y+ AV +C  + + ++TI +  INKRV +IAV YNLG YWI GND +KEG W+DSRN  LQ+K W  GEPNG R+ENCIHGL Y   +WND+ C     VICE
Sbjct:    1 MNYNSAVNYCKRQKMDMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICE 105          

HSP 14 Score: 123.635 bits (309), Expect = 3.349e-28
Identity = 55/126 (43.65%), Postives = 82/126 (65.08%), Query Frame = -2
Query: 2665 SPIIK-----TDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQ 3027
            +P+++      ++GY    +KM Y +AV +C  Q+M L+TI N   NK V +++++Y I +YWI+GND   EG WVDS +N + Y NW   EP+G ++ENC+  L Y  G WND+ C+ PNSVIC+
Sbjct:  681 APVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE 806          

HSP 15 Score: 121.709 bits (304), Expect = 1.325e-27
Identity = 62/150 (41.33%), Postives = 89/150 (59.33%), Query Frame = -2
Query: 2611 LNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKK---TKKSICRIRIPYQRG 3051
            +N+VIC   PI  T  G+ +   KM + TAV +C+ + MEL+ I    +N +V+N+++ + +G YWI+GNDN  EG W DSK N + ++ W   EP G R ENC+ G  Y   LWND  C + NSVICQ  K   +K  I + +  Y+ G
Sbjct: 1044 MNSVIC--EPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDG 1191          

HSP 16 Score: 115.931 bits (289), Expect = 6.493e-26
Identity = 56/134 (41.79%), Postives = 82/134 (61.19%), Query Frame = -2
Query: 2650 LNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTK 3051
            LN+VIC   PI      Y ++  K  Y   V +CK + M L+ I +   NK V+++A+K K+G +WI+GND   EG+WVD+ +  + Y NW   +PNG ++ENC+ GLY+  G WND+ C+  N VIC+ K  K
Sbjct: 1164 LNSVIC--QPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEK 1295          

HSP 17 Score: 101.293 bits (251), Expect = 2.585e-21
Identity = 54/134 (40.30%), Postives = 81/134 (60.45%), Query Frame = -2
Query: 2647 NAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKK 3048
            N+VIC   P+  T   Y +   +M +  AV++CK++NM L+ I+N   NK V  +  K     YW++GNDN  EG W+++ +  + Y+NW   EP G R+ENC+ GL    GLWND++C++   VICQ  + KK
Sbjct:  801 NSVIC--EPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENESSNKIVKKLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRI-NGLWNDVTCDSLGEVICQPIQNKK 931          

HSP 18 Score: 95.5153 bits (236), Expect = 1.306e-19
Identity = 45/107 (42.06%), Postives = 60/107 (56.07%), Query Frame = -2
Query: 2665 QKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQ 2985
            +KM    A  FC  +NM ++ I N   N      AIK  + Y+WIDG D+  EG WVD +   + Y+NW S EP+G + ENC   L    GLW+D  C + NSVIC+
Sbjct:  944 EKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE 1050          
BLAST of SMED30004599 vs. Planmine SMEST
Match: SMESG000053698.1 (SMESG000053698.1)

HSP 1 Score: 1649.41 bits (4270), Expect = 0.000e+0
Identity = 820/820 (100.00%), Postives = 820/820 (100.00%), Query Frame = -3
Query:  183 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 2642
            FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENESSNKIVKKLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL
Sbjct:  435 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENESSNKIVKKLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 1254          

HSP 2 Score: 429.869 bits (1104), Expect = 8.897e-132
Identity = 224/514 (43.58%), Postives = 307/514 (59.73%), Query Frame = -3
Query:  519 TVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE-PMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRIN-GLWNDVTCDSLGEVICQPIQNKKRP--SSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKN----GFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKS 2036
            + A + +K    VEFGYH  +EKM Y SAV YC  Q M ++TI +   NK V D++++YN+  YWINGND+ KEG W+DS NN L Y NW   EP+G +RENCI  L Y DG+WND+ C+   +VICE  +++    YH+ K++M +N AVNYCK++NM ++ I N + NK V  +  K     YW+NGND ++EG+WL++ N  + YKNW   EP G R+ENCI  L    G WND+ C+ L  VIC      K P   ++  +  + +KM    A  FC  +NM ++ I N   N      AIK  + Y+WIDG D+  EG WVD +   + Y+NW S EP+G + ENC   L    GLW+D  C + NSVIC+           G+ I    M +D AVK+C  K + L+ I  +++N +V+N++V +NLG YWI GND  KEG W DS+   L FKKW++ EP GGR ENCI G  Y +  WND  C   N VIC+P++  P+   I KS
Sbjct:   57 SYAVICEKTIQNVEFGYHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQNVEFGYHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICM-----KSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKSQFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKS 565          

HSP 3 Score: 425.246 bits (1092), Expect = 5.431e-130
Identity = 229/536 (42.72%), Postives = 322/536 (60.07%), Query Frame = -3
Query:  201 NWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE-PMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRI-NGLWNDVTCDSLGEVICQ-PIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVIC--EPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQP-------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 1772
            NW   EP+G +RENCI  L Y  G+WND+ C+   +VICE  +++    YH+ K++M +N AVNYCK++ M +I I + + NK V  +  K     YW+NGND ++EG+WL++ N  + YKNW   EP G R+ENCI GL   +G WND+ C+    VIC+  IQN +       ++ + EKMN  +A  +C  +NM +V I NA+ N       +K NL  +WI+G D A EG W+D ++  L YKNW   EP G + ENC  SL    G W+D  C  +N+VIC   PI  T  G+ +   KM + TAV +C+ + MEL+ I    +N +V+N+++ + +G YWI+GNDN  EG W DSK N + ++ W   EP G R ENC+ G  Y   LWND  C + NSVICQ        ++YG   Y I++    Y + VK+C  K + L+ I ++K NK V+++A+   LGT+WI GND + EG WVD+ N SL +  W   +PNGG+KENCI GL + +  WNDV C  KN VICE
Sbjct:   24 NWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEKTIQNVEFGYHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQNVEFG-----YHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKSQFVEYG---YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 551          

HSP 4 Score: 237.269 bits (604), Expect = 6.053e-105
Identity = 144/381 (37.80%), Postives = 198/381 (51.97%), Query Frame = -3
Query: 1599 VEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQN-------------TCKFWQSTTTRKIPVSTSKSLDNISDKEFYD-KYCSVRY----------------LANLYQKICGWMEKEMTTVAPVV-QKLKNTVEF---GYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTF 2639
            VE+GY +N+E M Y+ AV +C  +N+ ++ I+N  INK+VF+I V YNLG YWI GND +KEG W+DSRN  LQ+K W  GEP+G R+ENCIH L Y   +WND+ C H N VIC        D     +  ++ Y + +   C+                + +      KI        DN  +  + D K   ++Y                +  LY     W +    T   V+ QK K   +F   GY    E MTY  AVK+C  +++ L+TI NE  NK V ++++ YN+  YWI GND  KEG+WVDS N  L +  W+  EP+GG++ENCI  L Y + FWNDV C   N VICEPM  +     I K  +  
Sbjct:  190 VEFGYHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKTDYGYVVNLQKMAYTTAV-SFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKSQFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLEL 569          

HSP 5 Score: 165.236 bits (417), Expect = 6.053e-105
Identity = 73/128 (57.03%), Postives = 100/128 (78.12%), Query Frame = -2
Query: 2662 AVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3045
            AVIC K+ I   ++GY +N +KM Y +AV++CK Q ME++TI +  INKRV ++A+KY +G YWI+GND   EG W+DS++NP+QY+NWK GEPNG+R+ENC+HGL+YP G WNDI CN   +VIC+K
Sbjct:   59 AVICEKT-IQNVEFGYHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEK 185          

HSP 6 Score: 327.791 bits (839), Expect = 9.965e-95
Identity = 173/415 (41.69%), Postives = 246/415 (59.28%), Query Frame = -3
Query:  186 KNWHPKEPQGYRKENCIQGLRIN-GLWNDVTCDSLGEVICQ-PIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE-PINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC--QPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEK 1415
            KNW   EP G R+ENCI GL    G WND+ C+    VIC+  IQN +       ++ + EKMN  +A  +C  + M ++ I +A+ N   +  A+K NL  +WI+G D A EG W+D ++  L YKNW   EP+G + ENC   L   +G W+D  C    +VICE  I + + G+H+   KM +++AV YC+ + ME+V I    +N QV++++V +NLG+YWINGND  KEG W DS+ N L +K W   EP G R ENCI    Y    WND  C  LN+VIC   PI      Y ++  K  Y   V +CK + M L+ I +   NK V+++A+K K+G +WI+GND   EG+WVD+ +  + Y NW   +PNG ++ENC+ GLY+  G WND+ C+  N VIC+ K +K
Sbjct:   23 KNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEKTIQNVEFG-----YHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQNVEFGYHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQK 432          

HSP 7 Score: 279.641 bits (714), Expect = 4.507e-78
Identity = 134/138 (97.10%), Postives = 134/138 (97.10%), Query Frame = -2
Query: 2641 HLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKSI 3054
            HLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKK K   
Sbjct:  298 HLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKSQF 435          

HSP 8 Score: 164.081 bits (414), Expect = 8.141e-41
Identity = 74/134 (55.22%), Postives = 102/134 (76.12%), Query Frame = -2
Query: 2644 AVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKS 3045
            AVIC K+ I   ++GY +N +KM Y +AV++CK QNME++ I+N  INK+VF++ +KY +G YWI+GND   EG W+DS++NP+QY+NWK GEP+GKR+ENC+H L+YP G WNDI CN  N+VIC K    K+
Sbjct:  180 AVICEKT-IQNVEFGYHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKT 312          

HSP 9 Score: 160.614 bits (405), Expect = 1.170e-39
Identity = 79/171 (46.20%), Postives = 106/171 (61.99%), Query Frame = -3
Query:  183 KKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC----QPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 683
            K W   EP G R ENCI G  Y    WND  C    +VIC    Q +++G   YH++K K NY   V YCK +KM ++ I+D   NK V D+A+K  LG +WINGND+A EG W+D+ N  L Y NW I +PNG ++ENCI GL++ DG WND+ C++   VICE  ++ +
Sbjct:   23 KNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEKTIQNVEFG---YHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQNV 190          

HSP 10 Score: 143.28 bits (360), Expect = 2.303e-34
Identity = 71/143 (49.65%), Postives = 92/143 (64.34%), Query Frame = -2
Query: 2635 NAVICMKSPIIK--TDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVIC---QKKKTKKSICR 3048
            N+VIC K        +YGY++N + M Y  AV FC E+N+ LLTIKN  INKRVFN+A+ Y +G YWI GND   EG WVDS++  +Q++ W  GEPNG R+ENC+HGL Y    WND++C   N VIC   +K      IC+
Sbjct:  422 NSVICQKKKQKSQFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICK 564          

HSP 11 Score: 140.198 bits (352), Expect = 2.139e-33
Identity = 80/196 (40.82%), Postives = 106/196 (54.08%), Query Frame = -3
Query: 2292 MEMIMGWRDTGWILSRTQCNT----KIGNLVSPMANVRKTVFTVYII------QLACGMIFLAILPTXXXXXXXXXXXQFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2849
            M M +  +++GWIL     NT    KIG    P    R+               + C + +  I                VE+GY +N+E M Y+ AV +C  + + ++TI +  INKRV +IAV YNLG YWI GND +KEG W+DSRN  LQ+K W  GEPNG R+ENCIHGL Y + +WND+ C     VICE
Sbjct:    1 MGMTLQKKESGWILEIILYNTSKNWKIG---EPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEKTIQN---------VEFGYHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICE 184          

HSP 12 Score: 123.635 bits (309), Expect = 3.271e-28
Identity = 55/126 (43.65%), Postives = 82/126 (65.08%), Query Frame = -2
Query: 2665 SPIIK-----TDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQ 3027
            +P+++      ++GY    +KM Y +AV +C  Q+M L+TI N   NK V +++++Y I +YWI+GND   EG WVDS +N + Y NW   EP+G ++ENC+  L Y  G WND+ C+ PNSVIC+
Sbjct:  639 APVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE 764          

HSP 13 Score: 121.709 bits (304), Expect = 1.199e-27
Identity = 62/150 (41.33%), Postives = 89/150 (59.33%), Query Frame = -2
Query: 2611 LNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKK---TKKSICRIRIPYQRG 3051
            +N+VIC   PI  T  G+ +   KM + TAV +C+ + MEL+ I    +N +V+N+++ + +G YWI+GNDN  EG W DSK N + ++ W   EP G R ENC+ G  Y   LWND  C + NSVICQ  K   +K  I + +  Y+ G
Sbjct: 1002 MNSVIC--EPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDG 1149          

HSP 14 Score: 115.931 bits (289), Expect = 6.143e-26
Identity = 56/134 (41.79%), Postives = 82/134 (61.19%), Query Frame = -2
Query: 2650 LNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTK 3051
            LN+VIC   PI      Y ++  K  Y   V +CK + M L+ I +   NK V+++A+K K+G +WI+GND   EG+WVD+ +  + Y NW   +PNG ++ENC+ GLY+  G WND+ C+  N VIC+ K  K
Sbjct: 1122 LNSVIC--QPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEK 1253          

HSP 15 Score: 101.293 bits (251), Expect = 2.334e-21
Identity = 54/134 (40.30%), Postives = 81/134 (60.45%), Query Frame = -2
Query: 2647 NAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKK 3048
            N+VIC   P+  T   Y +   +M +  AV++CK++NM L+ I+N   NK V  +  K     YW++GNDN  EG W+++ +  + Y+NW   EP G R+ENC+ GL    GLWND++C++   VICQ  + KK
Sbjct:  759 NSVIC--EPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENESSNKIVKKLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRI-NGLWNDVTCDSLGEVICQPIQNKK 889          

HSP 16 Score: 95.5153 bits (236), Expect = 1.275e-19
Identity = 45/107 (42.06%), Postives = 60/107 (56.07%), Query Frame = -2
Query: 2665 QKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQ 2985
            +KM    A  FC  +NM ++ I N   N      AIK  + Y+WIDG D+  EG WVD +   + Y+NW S EP+G + ENC   L    GLW+D  C + NSVIC+
Sbjct:  902 EKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE 1008          

HSP 17 Score: 70.0922 bits (170), Expect = 7.589e-12
Identity = 28/42 (66.67%), Postives = 35/42 (83.33%), Query Frame = -2
Query: 2662 QNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 2787
            +NWK GEPNG+R+ENC+HGL+YP G WNDI CN   +VIC+K
Sbjct:   23 KNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEK 64          

HSP 18 Score: 55.4546 bits (132), Expect = 2.721e-7
Identity = 22/49 (44.90%), Postives = 33/49 (67.35%), Query Frame = -3
Query:  183 TYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 329
            T  NW I +PNG ++ENCI GL++  G WND+ C++   VICE  ++ +
Sbjct:   21 TSKNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEKTIQNV 69          
BLAST of SMED30004599 vs. Planmine SMEST
Match: SMESG000053698.1 (SMESG000053698.1)

HSP 1 Score: 1649.41 bits (4270), Expect = 0.000e+0
Identity = 820/820 (100.00%), Postives = 820/820 (100.00%), Query Frame = -3
Query:  183 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 2642
            FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENESSNKIVKKLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL
Sbjct:  463 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENESSNKIVKKLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 1282          

HSP 2 Score: 479.174 bits (1232), Expect = 7.975e-150
Identity = 255/587 (43.44%), Postives = 359/587 (61.16%), Query Frame = -3
Query:  201 MNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE-PMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRI-NGLWNDVTCDSLGEVICQ-PIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVIC--EPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQP-------IKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 1925
            M+++TI +   NK V D++++YN+  YWINGND+ KEG W+DS NN L Y NW   EP+G +RENCI  L Y  G+WND+ C+   +VICE  +++    YH+ K++M +N AVNYCK++ M +I I + + NK V  +  K     YW+NGND ++EG+WL++ N  + YKNW   EP G R+ENCI GL   +G WND+ C+    VIC+  IQN +       ++ + EKMN  +A  +C  +NM +V I NA+ N       +K NL  +WI+G D A EG W+D ++  L YKNW   EP G + ENC  SL    G W+D  C  +N+VIC   PI  T  G+ +   KM + TAV +C+ + MEL+ I    +N +V+N+++ + +G YWI+GNDN  EG W DSK N + ++ W   EP G R ENC+ G  Y   LWND  C + NSVICQ        ++YG   Y I++    Y + VK+C  K + L+ I ++K NK V+++A+   LGT+WI GND + EG WVD+ N SL +  W   +PNGG+KENCI GL + +  WNDV C  KN VICE
Sbjct:    1 MDMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEKTIQNVEFGYHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQNVEFG-----YHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKSQFVEYG---YLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 579          

HSP 3 Score: 429.869 bits (1104), Expect = 1.796e-131
Identity = 224/514 (43.58%), Postives = 307/514 (59.73%), Query Frame = -3
Query:  519 TVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE-PMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRIN-GLWNDVTCDSLGEVICQPIQNKKRP--SSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKN----GFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKS 2036
            + A + +K    VEFGYH  +EKM Y SAV YC  Q M ++TI +   NK V D++++YN+  YWINGND+ KEG W+DS NN L Y NW   EP+G +RENCI  L Y DG+WND+ C+   +VICE  +++    YH+ K++M +N AVNYCK++NM ++ I N + NK V  +  K     YW+NGND ++EG+WL++ N  + YKNW   EP G R+ENCI  L    G WND+ C+ L  VIC      K P   ++  +  + +KM    A  FC  +NM ++ I N   N      AIK  + Y+WIDG D+  EG WVD +   + Y+NW S EP+G + ENC   L    GLW+D  C + NSVIC+           G+ I    M +D AVK+C  K + L+ I  +++N +V+N++V +NLG YWI GND  KEG W DS+   L FKKW++ EP GGR ENCI G  Y +  WND  C   N VIC+P++  P+   I KS
Sbjct:   85 SYAVICEKTIQNVEFGYHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQNVEFGYHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICM-----KSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKSQFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKS 593          

HSP 4 Score: 357.066 bits (915), Expect = 5.329e-105
Identity = 185/439 (42.14%), Postives = 265/439 (60.36%), Query Frame = -3
Query:  186 YWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRIN-GLWNDVTCDSLGEVICQ-PIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE-PINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC--QPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEK 1487
            YW+NGND ++EG+WL++ N  + YKNW   EP G R+ENCI GL    G WND+ C+    VIC+  IQN +       ++ + EKMN  +A  +C  + M ++ I +A+ N   +  A+K NL  +WI+G D A EG W+D ++  L YKNW   EP+G + ENC   L   +G W+D  C    +VICE  I + + G+H+   KM +++AV YC+ + ME+V I    +N QV++++V +NLG+YWINGND  KEG W DS+ N L +K W   EP G R ENCI    Y    WND  C  LN+VIC   PI      Y ++  K  Y   V +CK + M L+ I +   NK V+++A+K K+G +WI+GND   EG+WVD+ +  + Y NW   +PNG ++ENC+ GLY+  G WND+ C+  N VIC+ K +K
Sbjct:   27 YWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEKTIQNVEFG-----YHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQNVEFGYHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQK 460          

HSP 5 Score: 237.654 bits (605), Expect = 6.002e-105
Identity = 144/381 (37.80%), Postives = 198/381 (51.97%), Query Frame = -3
Query: 1599 VEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQN-------------TCKFWQSTTTRKIPVSTSKSLDNISDKEFYD-KYCSVRY----------------LANLYQKICGWMEKEMTTVAPVV-QKLKNTVEF---GYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTF 2639
            VE+GY +N+E M Y+ AV +C  +N+ ++ I+N  INK+VF+I V YNLG YWI GND +KEG W+DSRN  LQ+K W  GEP+G R+ENCIH L Y   +WND+ C H N VIC        D     +  ++ Y + +   C+                + +      KI        DN  +  + D K   ++Y                +  LY     W +    T   V+ QK K   +F   GY    E MTY  AVK+C  +++ L+TI NE  NK V ++++ YN+  YWI GND  KEG+WVDS N  L +  W+  EP+GG++ENCI  L Y + FWNDV C   N VICEPM  +     I K  +  
Sbjct:  218 VEFGYHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKTDYGYVVNLQKMAYTTAV-SFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKSQFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLEL 597          

HSP 6 Score: 164.851 bits (416), Expect = 6.002e-105
Identity = 73/128 (57.03%), Postives = 100/128 (78.12%), Query Frame = -2
Query: 2662 AVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3045
            AVIC K+ I   ++GY +N +KM Y +AV++CK Q ME++TI +  INKRV ++A+KY +G YWI+GND   EG W+DS++NP+QY+NWK GEPNG+R+ENC+HGL+YP G WNDI CN   +VIC+K
Sbjct:   87 AVICEKT-IQNVEFGYHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEK 213          

HSP 7 Score: 279.256 bits (713), Expect = 6.098e-78
Identity = 134/138 (97.10%), Postives = 134/138 (97.10%), Query Frame = -2
Query: 2641 HLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKSI 3054
            HLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKK K   
Sbjct:  326 HLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKQKSQF 463          

HSP 8 Score: 139.428 bits (350), Expect = 5.683e-66
Identity = 65/116 (56.03%), Postives = 83/116 (71.55%), Query Frame = -3
Query: 2292 VEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2639
            VE+GY +N+E M Y+ AV +C  + + ++TI +  INKRV +IAV YNLG YWI GND +KEG W+DSRN  LQ+K W  GEPNG R+ENCIHGL Y + +WND+ C     VICE
Sbjct:   97 VEFGYHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICE 212          

HSP 9 Score: 132.88 bits (333), Expect = 5.683e-66
Identity = 55/92 (59.78%), Postives = 75/92 (81.52%), Query Frame = -2
Query: 2662 MELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 2937
            M+++TI +  INKRV ++A+KY +G YWI+GND   EG W+DS++NP+QY+NWK GEPNG+R+ENC+HGL+YP G WNDI CN   +VIC+K
Sbjct:    1 MDMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEK 92          

HSP 10 Score: 208.764 bits (530), Expect = 7.630e-55
Identity = 102/221 (46.15%), Postives = 141/221 (63.80%), Query Frame = -3
Query:  183 MELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC----QPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 833
            M+++ I    +N +V +++V +NLG+YWINGND  KEG W DS+ N L +K W   EP G R ENCI G  Y    WND  C    +VIC    Q +++G   YH++K K NY   V YCK +KM ++ I+D   NK V D+A+K  LG +WINGND+A EG W+D+ N  L Y NW I +PNG ++ENCI GL++ DG WND+ C++   VICE  ++ +
Sbjct:    1 MDMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICEKTIQNVEFG---YHLNKEKMNYNSAVNYCKRQKMEMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPDGWWNDIPCNLAYAVICEKTIQNV 218          

HSP 11 Score: 164.081 bits (414), Expect = 9.117e-41
Identity = 74/134 (55.22%), Postives = 102/134 (76.12%), Query Frame = -2
Query: 2644 AVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKS 3045
            AVIC K+ I   ++GY +N +KM Y +AV++CK QNME++ I+N  INK+VF++ +KY +G YWI+GND   EG W+DS++NP+QY+NWK GEP+GKR+ENC+H L+YP G WNDI CN  N+VIC K    K+
Sbjct:  208 AVICEKT-IQNVEFGYHLNKEKMNYNSAVNYCKRQNMEMVIIRNATINKQVFDITVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKFGEPSGKRRENCIHSLFYPYGWWNDIPCNHLNAVICMKSPIIKT 340          

HSP 12 Score: 143.28 bits (360), Expect = 2.585e-34
Identity = 71/143 (49.65%), Postives = 92/143 (64.34%), Query Frame = -2
Query: 2635 NAVICMKSPIIK--TDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVIC---QKKKTKKSICR 3048
            N+VIC K        +YGY++N + M Y  AV FC E+N+ LLTIKN  INKRVFN+A+ Y +G YWI GND   EG WVDS++  +Q++ W  GEPNG R+ENC+HGL Y    WND++C   N VIC   +K      IC+
Sbjct:  450 NSVICQKKKQKSQFVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICK 592          

HSP 13 Score: 123.25 bits (308), Expect = 3.469e-28
Identity = 55/126 (43.65%), Postives = 82/126 (65.08%), Query Frame = -2
Query: 2665 SPIIK-----TDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQ 3027
            +P+++      ++GY    +KM Y +AV +C  Q+M L+TI N   NK V +++++Y I +YWI+GND   EG WVDS +N + Y NW   EP+G ++ENC+  L Y  G WND+ C+ PNSVIC+
Sbjct:  667 APVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE 792          

HSP 14 Score: 121.324 bits (303), Expect = 1.372e-27
Identity = 62/150 (41.33%), Postives = 89/150 (59.33%), Query Frame = -2
Query: 2611 LNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKK---TKKSICRIRIPYQRG 3051
            +N+VIC   PI  T  G+ +   KM + TAV +C+ + MEL+ I    +N +V+N+++ + +G YWI+GNDN  EG W DSK N + ++ W   EP G R ENC+ G  Y   LWND  C + NSVICQ  K   +K  I + +  Y+ G
Sbjct: 1030 MNSVIC--EPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDG 1177          

HSP 15 Score: 115.931 bits (289), Expect = 6.729e-26
Identity = 56/134 (41.79%), Postives = 82/134 (61.19%), Query Frame = -2
Query: 2650 LNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTK 3051
            LN+VIC   PI      Y ++  K  Y   V +CK + M L+ I +   NK V+++A+K K+G +WI+GND   EG+WVD+ +  + Y NW   +PNG ++ENC+ GLY+  G WND+ C+  N VIC+ K  K
Sbjct: 1150 LNSVIC--QPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEK 1281          

HSP 16 Score: 114.005 bits (284), Expect = 2.989e-25
Identity = 54/91 (59.34%), Postives = 65/91 (71.43%), Query Frame = -3
Query: 2292 LRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICE 2564
            + ++TI +  INKRV +IAV YNLG YWI GND +KEG W+DSRN  LQ+K W  GEPNG R+ENCIHGL Y   +WND+ C     VICE
Sbjct:    1 MDMITISDATINKRVLDIAVKYNLGQYWINGNDIAKEGIWLDSRNNPLQYKNWKIGEPNGQRRENCIHGLFYPYGWWNDIPCNLSYAVICE 91          

HSP 17 Score: 100.908 bits (250), Expect = 2.660e-21
Identity = 54/134 (40.30%), Postives = 81/134 (60.45%), Query Frame = -2
Query: 2647 NAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKK 3048
            N+VIC   P+  T   Y +   +M +  AV++CK++NM L+ I+N   NK V  +  K     YW++GNDN  EG W+++ +  + Y+NW   EP G R+ENC+ GL    GLWND++C++   VICQ  + KK
Sbjct:  787 NSVIC--EPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENESSNKIVKKLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRI-NGLWNDVTCDSLGEVICQPIQNKK 917          

HSP 18 Score: 95.5153 bits (236), Expect = 1.368e-19
Identity = 45/107 (42.06%), Postives = 60/107 (56.07%), Query Frame = -2
Query: 2665 QKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQ 2985
            +KM    A  FC  +NM ++ I N   N      AIK  + Y+WIDG D+  EG WVD +   + Y+NW S EP+G + ENC   L    GLW+D  C + NSVIC+
Sbjct:  930 EKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE 1036          
BLAST of SMED30004599 vs. Planmine SMEST
Match: SMESG000053708.1 (SMESG000053708.1)

HSP 1 Score: 1585.08 bits (4103), Expect = 0.000e+0
Identity = 781/820 (95.24%), Postives = 801/820 (97.68%), Query Frame = -3
Query:  183 FVEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 2642
            FVEYGYLI +E + YD AVKFC EKNLRLLTIKNEKINKR+FNIAVYYNLGTYWI GNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGR ENCIHGLRYDNEFWNDVNC+ +N+VICEPMEKSPADPEICKSFLELCYNSKIRKICQ TCKFWQS TT+KI V+TSKSLDNISDKEFYDKYCSVR+LANLYQKICGWMEKEMTTVAPVVQKLK+TVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRM FNDAVNYCKKRNMVLINIENESSNKIV +LVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGY+KENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYS +PDGGK ENC VS TDANGLWDD +CQSMNSVICEPIND KNGFHITSVKMKFDTAVKYCR+KKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGG+NENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYH+S+SKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNE+LTYLNWNIRQPNGGKKENCIQGLYFSDGTWN+VKCDMKNKVICELKVEKL
Sbjct:  496 FVEYGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVICEPMEKSPADPEICKSFLELCYNSKIRKICQITCKFWQSMTTKKISVTTSKSLDNISDKEFYDKYCSVRFLANLYQKICGWMEKEMTTVAPVVQKLKDTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMAFNDAVNYCKKRNMVLINIENESSNKIVIQLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYKKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSMKPDGGKLENCVVSFTDANGLWDDDYCQSMNSVICEPINDMKNGFHITSVKMKFDTAVKYCRDKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGQNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHMSESKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNEALTYLNWNIRQPNGGKKENCIQGLYFSDGTWNNVKCDMKNKVICELKVEKL 1315          

HSP 2 Score: 520.005 bits (1338), Expect = 5.263e-165
Identity = 313/854 (36.65%), Postives = 457/854 (53.51%), Query Frame = -3
Query:  201 VEYGYLINEEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCFHKNMVICEPMEKSPADPEICKSF--LELCYNSKIRKICQNTCKFWQSTTTRKIPVSTSKSLDNISDKEFYDKYC------------------SVRY----------------LANLYQKICGWMEKEMTTVAPVV-QKLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE--PMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRI-NGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDAL-WNDEKCGSLNSVICQPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 2639
            VE+GY +N+E M Y+ A+ +C  + + ++TI +  INK+VF+IAV YNLG YWI GND   EGSW+DSRN  LQ+K W  GEP G R+ENCIHGL Y N  WND+ C     VIC   EK+  + E         + YNS +     N CK  +         + +K + +I+ K    +Y                    ++Y                +  L+     W +   T    V+ +K    VEFGYH  +E+M Y SAV YC  Q+M +V I N   NK V D+++++N+  YWINGND  KEG W+DS NN L Y NW   EP G ++ENCIQ L Y++G WND+ C+  N+VIC   P+  T   Y +   +MT+N AV++CK++NM L+ I N   NK V  +  K     YW++GNDN  EG W+++    + YKNW   EP G R+ENC+ GL    GLWND++C++   VICQ  + KK       +  + E ++  AA +FC  +N+R++ I N   N      A+  NL  +WI G D + EG+WVD ++  L +K WY  EP+GG+ ENC   L   N  W+D +C   N VICEP+  +     I        + ++ C N K+  +     Q+  + +    T  +        DN  + ++ D   ++                      N YQ    W +++  ++  V+ +        YH ++ K  YK  VKYC ++ M+LV I ++  NK V+DL+L+  +  +WINGND+  EG+WVD++N  L+Y NW+ ++P+GGK+ENCIQ L ++DG WNDV+CD  N VICE
Sbjct:    9 VEFGYHLNKEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKGQRQENCIHGLFYPNGLWNDIPCTMSYAVIC---EKTKQNVEFGYHLNKERMNYNSAV-----NYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNVEFGYHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVICLKFPIIKTDYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSK-KKSQFVEYGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVICEPMEKSPADPEICK------SFLELCYNSKIRKIC----QITCKFWQSMTTKKISVTTSKSLDNISDKEFYDKYCSVR------------------FLANLYQKICGWMEKEMTTVAPVVQKLKDTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE 825          

HSP 3 Score: 396.741 bits (1018), Expect = 3.432e-119
Identity = 205/492 (41.67%), Postives = 296/492 (60.16%), Query Frame = -3
Query:  201 VICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRNMVLINIENEXXXXXXXXXXXXXXKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYRKENCIQGLRI-NGLWNDVTCDSLGEVICQPIQNKKRPSSNSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGLWDDAHCQSMNSVICE-PINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQ--PIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICE 1664
            ++  P ++    YH+ K++M +N A+NYCK + M ++ I + + NK V  +  K     YW+NGNDN  EG WL++ N  + YKNW   EP+G R+ENCI GL   NGLWND+ C     VIC+    K + +    ++ + E+MN  +A  +C  + M +V I +A+ N      A+K NL  +WI+G D A EGNW+D +   L YKNW S EP+G + ENC   L   NGLW+D  C    +VICE  I + + G+H+   +M +++AV YC  + ME+V I    +N +V+++++ FNLG+YWINGNDN KEG+W DS+ N L +K W   EP G R ENCI G  Y + LWND  C   N+VIC   PI      Y ++  K  Y   V +CK + M L+ I +   NK V+++A+K K+G +WI+GND   EG+WVD+    + Y NW   +PNG ++ENC+ GLY+  G WND+ C+  N VIC+
Sbjct:    1 MVLFPEQNVEFGYHLNKEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKGQRQENCIHGLFYPNGLWNDIPCTMSYAVICE----KTKQNVEFGYHLNKERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNVEFGYHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVICLKFPIIKTDYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQ 488          

HSP 4 Score: 254.218 bits (648), Expect = 1.457e-69
Identity = 119/138 (86.23%), Postives = 126/138 (91.30%), Query Frame = -2
Query: 2641 HLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKSI 3054
            H NAVIC+K PIIKTDYGYVVNLQKM Y  AVSFCKEQNMELLTI NG++NKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSK NP++Y+NWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPN+VICQK K K   
Sbjct:  359 HSNAVICLKFPIIKTDYGYVVNLQKMTYNRAVSFCKEQNMELLTIGNGVVNKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKWNPVRYKNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNTVICQKSKKKSQF 496          

HSP 5 Score: 240.736 bits (613), Expect = 4.619e-65
Identity = 114/254 (44.88%), Postives = 164/254 (64.57%), Query Frame = -3
Query:  183 VICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGRNENCITGNNYQDALWNDEKCGSLNSVIC----QPIKYGPSKYHISKSKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKNKVICELKVEKL 932
            ++  P  + + G+H+   KM +++A+ YC+ +KME+V I    +N QV++++V +NLG+YWINGNDN  EG W DS+ N L +K W   EPKG R ENCI G  Y + LWND  C    +VIC    Q +++G   YH++K + NY   V YCK +KM +V I D   NK V+D+A+K  LG +WINGND+A EG+W+D+    L Y NW   +PNG ++ENCI GL++ +G WND+ C M   VICE  ++ +
Sbjct:    1 MVLFPEQNVEFGYHLNKEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKGQRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTKQNVEFG---YHLNKERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEKTIQNV 251          

HSP 6 Score: 167.933 bits (424), Expect = 5.194e-42
Identity = 75/128 (58.59%), Postives = 102/128 (79.69%), Query Frame = -2
Query: 2662 AVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3045
            AVIC K+ I   ++GY +N ++M Y +AV++C  QNME++ I+N  INKRVF++AIK+ +G YWI+GNDN  EG W+DS++NP+QY+NWKSGEP+G+RQENC+ GL+Y  GLWNDI CN  N+VIC K
Sbjct:  241 AVICEKT-IQNVEFGYHLNKERMNYNSAVNYCNGQNMEMVIIRNATINKRVFDIAIKFNLGQYWINGNDNAKEGKWLDSRNNPLQYKNWKSGEPSGQRQENCIQGLFYSNGLWNDIPCNHSNAVICLK 367          

HSP 7 Score: 166.392 bits (420), Expect = 1.727e-41
Identity = 72/128 (56.25%), Postives = 102/128 (79.69%), Query Frame = -2
Query: 2662 AVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQK 3045
            AVIC K+     ++GY +N ++M Y +AV++CK Q ME++TI++  INK+VF++A+KY +G YWI+GND   EG W+DS++NP+QY+NWKSGEPNG+R+ENC+HGL+YP GLWNDI C    +VIC+K
Sbjct:  120 AVICEKTKQ-NVEFGYHLNKERMNYNSAVNYCKRQKMEMVTIRDATINKQVFDIAVKYNLGQYWINGNDMAKEGNWLDSRTNPLQYKNWKSGEPNGQRRENCIHGLFYPNGLWNDIPCTMSYAVICEK 246          

HSP 8 Score: 164.851 bits (416), Expect = 5.641e-41
Identity = 70/123 (56.91%), Postives = 98/123 (79.67%), Query Frame = -2
Query: 2656 PIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKK 3024
            P    ++GY +N +KM Y +A+++CK Q ME++TI +  INK+VF++A+KY +G YWI+GNDN +EG W+DS++NP+QY+NWKSGEP G+RQENC+HGL+YP GLWNDI C    +VIC+K K
Sbjct:    5 PEQNVEFGYHLNKEKMNYNSAINYCKMQKMEMVTISDATINKQVFDIAVKYNLGQYWINGNDNFIEGSWLDSRNNPLQYKNWKSGEPKGQRQENCIHGLFYPNGLWNDIPCTMSYAVICEKTK 127          

HSP 9 Score: 139.813 bits (351), Expect = 2.748e-33
Identity = 69/143 (48.25%), Postives = 90/143 (62.94%), Query Frame = -2
Query: 2635 NAVICMKSPIIK--TDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVIC---QKKKTKKSICR 3048
            N VIC KS       +YGY++  + + Y  AV FC E+N+ LLTIKN  INKR+FN+A+ Y +G YWI GND   EG WVDS++  +Q++ W  GEPNG R ENC+HGL Y    WND++C   N VIC   +K      IC+
Sbjct:  483 NTVICQKSKKKSQFVEYGYLITDENIHYDAAVKFCMEKNLRLLTIKNEKINKRIFNIAVYYNLGTYWIAGNDYSKEGSWVDSRNVSLQFKKWYQGEPNGGRNENCIHGLRYDNEFWNDVNCYERNIVICEPMEKSPADPEICK 625          

HSP 10 Score: 123.25 bits (308), Expect = 3.561e-28
Identity = 55/126 (43.65%), Postives = 82/126 (65.08%), Query Frame = -2
Query: 2665 SPIIK-----TDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQ 3027
            +P+++      ++GY    +KM Y +AV +C  Q+M L+TI N   NK V +++++Y I +YWI+GND   EG WVDS +N + Y NW   EP+G ++ENC+  L Y  G WND+ C+ PNSVIC+
Sbjct:  700 APVVQKLKDTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSLQYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSLVYADGFWNDVECDQPNSVICE 825          

HSP 11 Score: 118.242 bits (295), Expect = 1.340e-26
Identity = 55/129 (42.64%), Postives = 80/129 (62.02%), Query Frame = -2
Query: 2665 LNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQ 3051
            +N+VIC   PI     G+ +   KM + TAV +C+++ MEL+ I    +N +V+N+++ + +G YWI+GNDN  EG W DSK N + ++ W   EP G + ENC+ G  Y   LWND  C + NSVICQ
Sbjct: 1063 MNSVIC--EPINDMKNGFHITSVKMKFDTAVKYCRDKKMELVKIDGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKSEPKGGQNENCITGNNYQDALWNDEKCGSLNSVICQ 1189          

HSP 12 Score: 113.62 bits (283), Expect = 3.668e-25
Identity = 55/134 (41.04%), Postives = 82/134 (61.19%), Query Frame = -2
Query: 2650 LNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTK 3051
            LN+VIC   PI      Y ++  K  Y   V +CK + M L+ I +   NK V+++A+K K+G +WI+GND   EG+WVD+ +  + Y NW   +PNG ++ENC+ GLY+  G WN++ C+  N VIC+ K  K
Sbjct: 1183 LNSVIC--QPIKYGPSKYHMSESKRNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVANEGHWVDTDNEALTYLNWNIRQPNGGKKENCIQGLYFSDGTWNNVKCDMKNKVICELKVEK 1314          

HSP 13 Score: 105.531 bits (262), Expect = 1.268e-22
Identity = 54/134 (40.30%), Postives = 82/134 (61.19%), Query Frame = -2
Query: 2647 NAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKK 3048
            N+VIC   P+  T   Y +   +MA+  AV++CK++NM L+ I+N   NK V  +  K     YW++GNDN  EG W+++ +  + Y+NW   EP G ++ENC+ GL    GLWND++C++   VICQ  + KK
Sbjct:  820 NSVIC--EPMRHTTNKYHIGKDRMAFNDAVNYCKKRNMVLINIENESSNKIVIQLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISYKNWHPKEPQGYKKENCIQGLRI-NGLWNDVTCDSLGEVICQPIQNKK 950          

HSP 14 Score: 91.6633 bits (226), Expect = 1.850e-18
Identity = 44/107 (41.12%), Postives = 60/107 (56.07%), Query Frame = -2
Query: 2665 QKMAYTTAVSFCKEQNMELLTIKNGIINKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGKRQENCVHGLYYPAGLWNDISCNTPNSVICQ 2985
            +KM    A  FC  +NM ++ I N   N      AIK  + Y+WIDG D+  EG WVD +   + Y+NW S +P+G + ENCV       GLW+D  C + NSVIC+
Sbjct:  963 EKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSYFWIDGTDSANEGNWVDYQDQKLSYKNWYSMKPDGGKLENCVVSFTDANGLWDDDYCQSMNSVICE 1069          
The following BLAST results are available for this feature:
BLAST of SMED30004599 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MRC12.588e-2722.53mannose receptor C-type 1 [Source:HGNC Symbol;Acc:... [more]
MRC21.793e-1821.50mannose receptor C type 2 [Source:HGNC Symbol;Acc:... [more]
CLEC3B8.550e-1536.75C-type lectin domain family 3 member B [Source:HGN... [more]
CLEC3B5.277e-1436.75C-type lectin domain family 3 member B [Source:HGN... [more]
CLEC3A1.083e-1329.63C-type lectin domain family 3 member A [Source:HGN... [more]
back to top
BLAST of SMED30004599 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y38H6C.83.793e-729.69pep chromosome:WBcel235:V:20514637:20515706:1 gene... [more]
clec-535.877e-628.10C-type LECtin [Source:UniProtKB/TrEMBL;Acc:P91429... [more]
back to top
BLAST of SMED30004599 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tfc1.085e-1131.62gene:FBgn0035199 transcript:FBtr0072661[more]
tfc1.085e-1131.62gene:FBgn0035199 transcript:FBtr0072660[more]
tfc9.711e-1131.62gene:FBgn0035199 transcript:FBtr0072659[more]
CG121112.999e-630.37gene:FBgn0030050 transcript:FBtr0331726[more]
CG121112.999e-630.37gene:FBgn0030050 transcript:FBtr0071232[more]
back to top
BLAST of SMED30004599 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-11o15.72.458e-3322.85si:dkey-11o15.7 [Source:ZFIN;Acc:ZDB-GENE-091204-3... [more]
mrc1a1.051e-2822.50mannose receptor, C type 1a [Source:ZFIN;Acc:ZDB-G... [more]
si:dkey-11o15.75.592e-2621.65si:dkey-11o15.7 [Source:ZFIN;Acc:ZDB-GENE-091204-3... [more]
mrc25.974e-2420.45mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GE... [more]
si:dkey-11o15.51.667e-2322.21si:dkey-11o15.5 [Source:ZFIN;Acc:ZDB-GENE-091204-1... [more]
back to top
BLAST of SMED30004599 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
orc33.676e-2823.89origin recognition complex subunit 3 [Source:Xenba... [more]
orc34.463e-2824.31origin recognition complex subunit 3 [Source:Xenba... [more]
orc38.948e-2823.75origin recognition complex subunit 3 [Source:Xenba... [more]
orc31.982e-2523.78origin recognition complex subunit 3 [Source:Xenba... [more]
orc31.983e-2523.78origin recognition complex subunit 3 [Source:Xenba... [more]
back to top
BLAST of SMED30004599 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mrc16.032e-2722.95mannose receptor, C type 1 [Source:MGI Symbol;Acc:... [more]
Mrc21.451e-1818.60mannose receptor, C type 2 [Source:MGI Symbol;Acc:... [more]
Mrc22.621e-1818.60mannose receptor, C type 2 [Source:MGI Symbol;Acc:... [more]
Clec3a3.638e-1329.32C-type lectin domain family 3, member a [Source:MG... [more]
Colec104.633e-1228.00collectin sub-family member 10 [Source:MGI Symbol;... [more]
back to top
BLAST of SMED30004599 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P22897|MRC1_HUMAN1.144e-2622.53Macrophage mannose receptor 1 OS=Homo sapiens OX=9... [more]
sp|Q61830|MRC1_MOUSE4.219e-2622.95Macrophage mannose receptor 1 OS=Mus musculus OX=1... [more]
sp|Q9UBG0|MRC2_HUMAN8.611e-1821.50C-type mannose receptor 2 OS=Homo sapiens OX=9606 ... [more]
sp|Q64449|MRC2_MOUSE1.834e-1718.60C-type mannose receptor 2 OS=Mus musculus OX=10090... [more]
sp|Q4TU93|MRC2_RAT8.528e-1718.45C-type mannose receptor 2 OS=Rattus norvegicus OX=... [more]
back to top
BLAST of SMED30004599 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q8WSX27.423e-14439.24Lectin 1 (Fragment) OS=Girardia tigrina OX=6162 GN... [more]
Q8WSX18.683e-10533.01Lectin 2a OS=Girardia tigrina OX=6162 GN=lec2a PE=... [more]
Q8WSX02.707e-10031.96Lectin 2b OS=Girardia tigrina OX=6162 GN=lec2b PE=... [more]
Q8WSW92.851e-10031.20Lectin 2c OS=Girardia tigrina OX=6162 GN=lec2c PE=... [more]
Q8WSW83.976e-8241.81Scarf3a OS=Girardia tigrina OX=6162 GN=scarf3a PE=... [more]
back to top
BLAST of SMED30004599 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000045912.17.737e-3120.30macrophage mannose receptor 1-like [Source:NCBI ge... [more]
mrc1a1.546e-2621.26mannose receptor C-type 1 [Source:NCBI gene;Acc:10... [more]
mrc1a1.842e-2621.12mannose receptor C-type 1 [Source:NCBI gene;Acc:10... [more]
mrc25.896e-2619.63mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GE... [more]
si:dkey-11o15.56.168e-2623.32si:dkey-11o15.5 [Source:ZFIN;Acc:ZDB-GENE-091204-1... [more]
back to top
BLAST of SMED30004599 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mrc27.233e-1321.84mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000003237.14.752e-1028.95pep scaffold:Pmarinus_7.0:GL486820:4307:11265:1 ge... [more]
ENSPMAT00000009130.13.106e-624.84pep scaffold:Pmarinus_7.0:GL477920:28989:31537:1 g... [more]
back to top
BLAST of SMED30004599 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004599 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495091.457e-3522.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495122.108e-2123.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467783.849e-930.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317781.060e-826.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469633.727e-829.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30004599 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrc1a2.234e-2520.80mannose receptor C-type 1 [Source:NCBI gene;Acc:10... [more]
mrc1b3.927e-2421.11macrophage mannose receptor 1 [Source:NCBI gene;Ac... [more]
mrc26.769e-2118.49mannose receptor C type 2 [Source:NCBI gene;Acc:10... [more]
mrc1b9.593e-1919.31macrophage mannose receptor 1 [Source:NCBI gene;Ac... [more]
ENSORLT00000037766.12.526e-1330.25pep primary_assembly:ASM223467v1:21:6513805:652923... [more]
back to top
BLAST of SMED30004599 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053698.19.465e-162100.00SMESG000053698.1[more]
SMESG000053698.11.516e-155100.00SMESG000053698.1[more]
SMESG000053698.18.897e-132100.00SMESG000053698.1[more]
SMESG000053698.17.975e-150100.00SMESG000053698.1[more]
SMESG000053708.15.263e-16595.24SMESG000053708.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004599 ID=SMED30004599|Name=SMED30004599|organism=Schmidtea mediterranea sexual|type=transcript|length=3055bp
AAGATTAGAAGATATATATTTTAAAAATCGGCGTATTGATGACTCACAAA
AAGAATATTACACAAGGATAGGTCAGTTGATTAAAACAATTACAAATTGA
TTCCAAATAATAAAAAATCAATGAACTTTATTAAAAAATGTTTAATTTCA
AATGTTTCATTGGGTTAAGTTTCCTAAGTTTACAGCTTCTCCACTTTTAG
TTCGCATATCACTTTATTTTTCATATCGCATTTTACGTCATTCCAAGTCC
CATCTGAGAAATATAAGCCCTGAATGCAATTTTCTTTCTTACCACCATTC
GGTTGTCGGATGTTCCAATTTAAATAGGTCAGGGATTCATTGTCTGTGTC
TACCCAGTGGCCCTCATTCGCAACATCATTTCCATTAATCCAAAACGTTC
CCAACTTACTTTTAAGGGCCAAGTCATAAACAAATTTATTATCTTTATCA
TCTGTAATCTTGACCAGGCTCATCTTTTTGCTTTTACAATACTTTACTCC
ATCTTTGTAATTGCGCTTGGATTTGGATATGTGATATTTTGACGGCCCGT
ATTTAATTGGCTGGCAAATCACAGAATTCAAAGATCCACATTTTTCATCA
TTCCATAATGCATCTTGATAATTATTTCCAGTTATACAATTTTCATTTCG
ACCTCCTTTTGGCTCCGATTTATGCCATTTCTTGAACGACAAAAGGTTCT
GTTTCGAATCTTCCCATTGTCCTTCTTTTCGATTATCATTTCCATTTATC
CAATACCGACCCAGATTAAAAGTCACAGATAAGTTATAAACTTGATTGTT
CATTTGATCTCCATCTATTTTTACTAATTCCATTTTTTTATTGCGGCAAT
ATTTCACTGCTGTATCGAACTTCATCTTGACGGATGTGATATGGAAACCA
TTTTTCGTGTCATTTATGGGCTCACAAATCACAGAATTCATGGACTGGCA
ATGAGCATCGTCCCACAGTCCATTTGCATCGGTAAGACTTACTGCACAGT
TTTCAGTTTTACCCCCATCTGGTTCCGTTGAGTACCAATTTTTGTAACTC
AATTTTTGATCTTGATAATCTACCCAGTTTCCTTCGTTGGCGCTATCGGT
TCCATCAATCCAAAAATATGATAAATTTGATTTAATTGCGTAAGTCATTG
CTAGGTCATTTTTTGATGCGTTATCAATTTTAACTATTCGCATGTTTCGA
TTGGCGCAGAATTCCCGAGCCGCTAAATTATTCATTTTTTCTGTGGAGGA
ATAAAATAACGAGTTAGAACTAGGTCTTTTCTTATTTTGAATTGGCTGAC
AAATTACTTCTCCTAGAGAATCGCAAGTGACATCATTCCAAAGTCCGTTT
ATGCGAAGTCCTTGGATACAATTTTCTTTCCTGTACCCTTGCGGCTCTTT
CGGATGCCAGTTTTTGTATGAAATTTCTTCATTATCTGTATTTAGCCAGA
CACCTTCCTCCGAGTTATCATTACCATTAACCCAATAATCAAACTTAAGA
GATTTTTTCACTAATTTTTTCACTATTTTATTTGAGCTTTCATTTTCTAT
GTTGATCAAAACCATGTTTCGCTTTTTACAATAGTTTACAGCATCATTGA
AAGTCATTCTGTCTTTTCCGATATGATATTTATTTGTTGTGTGTCTCATC
GGTTCACAGATAACTGAATTTGGCTGGTCGCATTCCACATCATTCCAAAA
CCCATCGGCATAAACAAGTGACTGAATACAGTTTTCCCGCTTGCCACCAT
CCGGTTCCTGATAATGCCAATTCGTATACGACAGCTTGTTATTATTCGAA
TCAACCCAATTTCCTTCTTTGATCAAATCATTGCCGTTGATCCAATACCA
GTCTATGTTATACTGGAGAGACAAATCATGAACTAGTTTATTCGTTGCCT
CATTGTCAATTGTTACCAAATTCATGGATTGAGCAAGACAATATTTTACG
GCAGATTTGTATGTCATTTTTTCTCGTGTATAATGATAACCGAACTCCAC
TGTGTTTTTCAATTTTTGTACAACTGGTGCGACAGTTGTCATTTCTTTTT
CCATCCATCCGCAAATCTTTTGGTACAGATTCGCCAGGTAACGCACAGAA
CAGTATTTATCATAAAACTCCTTATCAGAAATATTATCTAAGGATTTTGA
AGTGGAAACTGGAATTTTTCTCGTTGTCGTTGATTGCCAGAATTTGCAAG
TATTTTGGCATATTTTTCTGATTTTTGAATTATAACACAACTCTAGGAAA
GATTTACAAATTTCTGGATCAGCAGGACTCTTTTCCATCGGTTCGCAGAT
TACCATGTTTTTATGAAAACAGTTGACATCATTCCAAAATTCATTATCAT
ACCGTAATCCGTGAATACAATTTTCTTTACGGCCTCCATTTGGCTCACCT
TGATACCATTTCTTGAATTGAAGAGAAACATTTCTGGAATCGACCCAGCT
TCCTTCTTTCGAATAATCATTTCCGGTAATCCAGTAAGTTCCCAAGTTAT
AATAAACTGCAATATTGAAAACTCTTTTATTAATTTTTTCATTCTTGATC
GTAAGTAAACGCAAATTCTTTTCCCCGCAAAATTTAACAGCTTCATCATA
AGTCATGATTTCCTCGTTGATAAGGTATCCGTATTCGACAAATTGACTTT
TTTGTTTTTTTTTTCTGACAGATGACTGAGTTGGGAGTATTGCAAGAAAT
ATCATTCCACAGGCCAGCTGGATAATATAAACCGTGAACACAGTTTTCCT
GACGTTTGCCATTGGGCTCACCAGATTTCCAATTTTGGTATTGCATTGGG
TTCGACTTAGAATCCACCCAGTATCCCTCCATCCCATTATCATTTCCATC
GATCCAATAGTATCCGATCTTATACTTGATCGCCATATTAAATACTCGTT
TATTAATAATACCATTTTTTATGGTTAACAATTCCATATTCTGTTCTTTA
CAAAAACTTACAGCTGTAGTGTAGGCCATTTTTTGTAGATTTACGACATA
TCCATAATCAGTTTTGATAATTGGAGATTTCATACAGATCACAGCATTCA
AATGA
back to top

protein sequence of SMED30004599-orf-1

>SMED30004599-orf-1 ID=SMED30004599-orf-1|Name=SMED30004599-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=912bp
MVLLINEYLIWRSSIRSDTIGSMEMIMGWRDTGWILSRTQCNTKIGNLVS
PMANVRKTVFTVYIIQLACGMIFLAILPTQSSVRKKKQKSQFVEYGYLIN
EEIMTYDEAVKFCGEKNLRLLTIKNEKINKRVFNIAVYYNLGTYWITGND
YSKEGSWVDSRNVSLQFKKWYQGEPNGGRKENCIHGLRYDNEFWNDVNCF
HKNMVICEPMEKSPADPEICKSFLELCYNSKIRKICQNTCKFWQSTTTRK
IPVSTSKSLDNISDKEFYDKYCSVRYLANLYQKICGWMEKEMTTVAPVVQ
KLKNTVEFGYHYTREKMTYKSAVKYCLAQSMNLVTIDNEATNKLVHDLSL
QYNIDWYWINGNDLIKEGNWVDSNNNKLSYTNWHYQEPDGGKRENCIQSL
VYADGFWNDVECDQPNSVICEPMRHTTNKYHIGKDRMTFNDAVNYCKKRN
MVLINIENESSNKIVKKLVKKSLKFDYWVNGNDNSEEGVWLNTDNEEISY
KNWHPKEPQGYRKENCIQGLRINGLWNDVTCDSLGEVICQPIQNKKRPSS
NSLFYSSTEKMNNLAAREFCANRNMRIVKIDNASKNDLAMTYAIKSNLSY
FWIDGTDSANEGNWVDYQDQKLSYKNWYSTEPDGGKTENCAVSLTDANGL
WDDAHCQSMNSVICEPINDTKNGFHITSVKMKFDTAVKYCRNKKMELVKI
DGDQMNNQVYNLSVTFNLGRYWINGNDNRKEGQWEDSKQNLLSFKKWHKS
EPKGGRNENCITGNNYQDALWNDEKCGSLNSVICQPIKYGPSKYHISKSK
RNYKDGVKYCKSKKMSLVKITDDKDNKFVYDLALKSKLGTFWINGNDVAN
EGHWVDTDNESLTYLNWNIRQPNGGKKENCIQGLYFSDGTWNDVKCDMKN
KVICELKVEKL*
back to top

protein sequence of SMED30004599-orf-2

>SMED30004599-orf-2 ID=SMED30004599-orf-2|Name=SMED30004599-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=153bp
HLNAVICMKSPIIKTDYGYVVNLQKMAYTTAVSFCKEQNMELLTIKNGII
NKRVFNMAIKYKIGYYWIDGNDNGMEGYWVDSKSNPMQYQNWKSGEPNGK
RQENCVHGLYYPAGLWNDISCNTPNSVICQKKKTKKSICRIRIPYQRGNH
DL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR016186C-type_lectin-like/link_sf
IPR018378C-type_lectin_CS
IPR016187CTDL_fold
IPR001304C-type_lectin-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001304C-type lectin-likeSMARTSM00034CLECT_2coord: 7..130
e-value: 1.0E-18
score: 78.2
IPR001304C-type lectin-likePFAMPF00059Lectin_Ccoord: 25..131
e-value: 7.1E-15
score: 55.7
IPR001304C-type lectin-likePROSITEPS50041C_TYPE_LECTIN_2coord: 14..130
score: 16.704
IPR016186C-type lectin-like/link domain superfamilyGENE3DG3DSA:3.10.100.10coord: 3..132
e-value: 1.9E-28
score: 100.8
NoneNo IPR availablePANTHERPTHR22802C-TYPE LECTIN SUPERFAMILY MEMBERcoord: 24..134
NoneNo IPR availablePANTHERPTHR22802:SF358coord: 24..134
IPR018378C-type lectin, conserved sitePROSITEPS00615C_TYPE_LECTIN_1coord: 105..129
IPR016187C-type lectin foldSUPERFAMILYSSF56436C-type lectin-likecoord: 14..134