Dynamin 2

Overview
NameDynamin 2
Smed IDSMED30004594
Length (bp)2671
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynamin 2 (SMED30004594) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynamin 2 (SMED30004594) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynamin 2 (SMED30004594) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynamin 2 (SMED30004594) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004594

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30004594h1SMcG0006746 PL05013A2E07smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30004594h1SMcG0006746 dd_Smed_v4_2583_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30004594h1SMcG0006746 dd_Smed_v4_2583_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004594h1SMcG0006746 dd_Smed_v4_2583_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004594h1SMcG0006746 dd_Smed_v4_2583_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004594h1SMcG0006746 dd_Smed_v4_2583_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynamin 2 vs. Ensembl Human
Match: DNM3 (dynamin 3 [Source:HGNC Symbol;Acc:HGNC:29125])

HSP 1 Score: 959.518 bits (2479), Expect = 0.000e+0
Identity = 469/798 (58.77%), Postives = 615/798 (77.07%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNPVK--NMGNQIIRKGWLSLATATSLTKKNE-FWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPET----NDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW-------PKANGFTESR--VNPRRVSAASNRAP-PAIPGSKPNNMLP 2474
            N EME+LIPLVN+LQDAF+  G S  ++LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL+ S  E AEFLH +GKKFTDFD+VR EIE ETDRVTG NKG+SSIPINL+VYSPHVLNLTLIDLPGITKVPVGDQP DIE QIR MI++FIT EN +ILAV+PAN+DLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR++LEN+LLPLRRGY+G+VNRSQKDI+G+KDI+ AM  ERKFF SHP+Y H+A++MGT +LQKVLNQQL NHIRDTLP+ RNK+Q QL++IE +VE +KN KP DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG KIN++FHE FP+EI K +F+EK+LR+EI  AIKNIHG+RTGLFTPDMAFEAIVK QI  L+ PS+K +D V+ EL++ +++   K++++PRL +  ER V   +R ++ +TKDQ+ +LI IQ+SYINTNHEDFIGF NA +++    K   +GNQ+IRKGWL+++    +   ++ +WF+L AESL+WYKD++E EKK+++ L+NL+++D +      K   +L+N + + NV+KD++ L+LA   + ++DSWKA+ LRAGVYP+     NDE+G+  +   D  LERQVE +RNLV SY++II     D +PK + H +I+ V++F+N++L++ L S E+ + LMEES E  QRR+++LR+Y+ALK  L II ++ TATVS PAPPPV + W       P  +  T+ R  ++       S R P PAIP   P++  P
Sbjct:    3 NREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKLQGQLLSIEHEVEAYKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGAKINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKLKGPSLKSVDLVIQELINTVKKCTKKLANFPRLCEETERIVANHIREREGKTKDQVLLLIDIQVSYINTNHEDFIGFANAQQRSSQVHKKTTVGNQVIRKGWLTISNIGIMKGGSKGYWFVLTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFALFNTEQR-NVYKDYRFLELACDSQEDVDSWKASLLRAGVYPDKSVAENDENGQAENFSMDPQLERQVETIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESAEQAQRRDEMLRMYQALKEALGIIGDISTATVSTPAPPPVDDSWIQHSRRSPPPSPTTQRRPTLSAPLARPTSGRGPAPAIPSPGPHSGAP 799          
BLAST of Dynamin 2 vs. Ensembl Human
Match: DNM3 (dynamin 3 [Source:HGNC Symbol;Acc:HGNC:29125])

HSP 1 Score: 957.977 bits (2475), Expect = 0.000e+0
Identity = 469/802 (58.48%), Postives = 615/802 (76.68%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNPVK--NMGNQIIRKGWLSLATATSLTKKNE-FWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPET--------NDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW-------PKANGFTESR--VNPRRVSAASNRAP-PAIPGSKPNNMLP 2474
            N EME+LIPLVN+LQDAF+  G S  ++LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL+ S  E AEFLH +GKKFTDFD+VR EIE ETDRVTG NKG+SSIPINL+VYSPHVLNLTLIDLPGITKVPVGDQP DIE QIR MI++FIT EN +ILAV+PAN+DLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR++LEN+LLPLRRGY+G+VNRSQKDI+G+KDI+ AM  ERKFF SHP+Y H+A++MGT +LQKVLNQQL NHIRDTLP+ RNK+Q QL++IE +VE +KN KP DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG KIN++FHE FP+EI K +F+EK+LR+EI  AIKNIHG+RTGLFTPDMAFEAIVK QI  L+ PS+K +D V+ EL++ +++   K++++PRL +  ER V   +R ++ +TKDQ+ +LI IQ+SYINTNHEDFIGF NA +++    K   +GNQ+IRKGWL+++    +   ++ +WF+L AESL+WYKD++E EKK+++ L+NL+++D +      K   +L+N + + NV+KD++ L+LA   + ++DSWKA+ LRAGVYP+         NDE+G+  +   D  LERQVE +RNLV SY++II     D +PK + H +I+ V++F+N++L++ L S E+ + LMEES E  QRR+++LR+Y+ALK  L II ++ TATVS PAPPPV + W       P  +  T+ R  ++       S R P PAIP   P++  P
Sbjct:    3 NREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKLQGQLLSIEHEVEAYKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGAKINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKLKGPSLKSVDLVIQELINTVKKCTKKLANFPRLCEETERIVANHIREREGKTKDQVLLLIDIQVSYINTNHEDFIGFANAQQRSSQVHKKTTVGNQVIRKGWLTISNIGIMKGGSKGYWFVLTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFALFNTEQR-NVYKDYRFLELACDSQEDVDSWKASLLRAGVYPDKSVGNNKAENDENGQAENFSMDPQLERQVETIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESAEQAQRRDEMLRMYQALKEALGIIGDISTATVSTPAPPPVDDSWIQHSRRSPPPSPTTQRRPTLSAPLARPTSGRGPAPAIPSPGPHSGAP 803          
BLAST of Dynamin 2 vs. Ensembl Human
Match: DNM1 (dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972])

HSP 1 Score: 954.125 bits (2465), Expect = 0.000e+0
Identity = 457/788 (57.99%), Postives = 602/788 (76.40%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQIIRKGWLSLATATSLTKKN-EFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE---------TNDEDGEENH-EPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNPRRVSAASNRAPPAIPGSK 2456
            N  ME LIPLVN+LQDAF+  G +  +DLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL+N+ TE AEFLH +GKKFTDF++VR EIE ETDRVTG NKG+S +PINL+VYSPHVLNLTL+DLPG+TKVPVGDQP DIE QIR M+++F+T EN +ILAVSPANSDLANSDALK+AK+VDPQG RTIGVITKLDLMD+GTDAR++LEN+LLPLRRGYIG+VNRSQKDI+G+KDI  A+  ERKFF SHPSY H+A++MGT YLQKVLNQQL NHIRDTLP LRNK+Q+QL++IEK+VEE+KN +P DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK+LR+EI  AIKNIHG+RTGLFTPDMAFE IVK Q+K + EP +KC+D V+SEL+  +R+   K+  YPRL++ +ER V   +R ++ RTK+Q+ +LI I+L+Y+NTNHEDFIGF NA ++++  N  K  GNQ+IRKGWL++     +   + E+WF+L AE+L+WYKD++E EKK++++++NL+L+D +      K   +L+N + + NV+KD++ L+LA   +  +DSWKA+FLRAGVYPE           +E+G ++     D  LERQVE +RNLV SY+ I+     D +PK + H +I+  +EF+ ++L++ L S  + + LMEES E  QRR+++LR+Y ALK  L II ++ T TVS P PPPV + W +       R +P        RA PA+P ++
Sbjct:    3 NRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQR-NVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRA-PAVPPAR 788          
BLAST of Dynamin 2 vs. Ensembl Human
Match: DNM3 (dynamin 3 [Source:HGNC Symbol;Acc:HGNC:29125])

HSP 1 Score: 951.429 bits (2458), Expect = 0.000e+0
Identity = 469/808 (58.04%), Postives = 615/808 (76.11%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNPVK--NMGNQ----------IIRKGWLSLATATSLTKKNE-FWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPET----NDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW-------PKANGFTESR--VNPRRVSAASNRAP-PAIPGSKPNNMLP 2474
            N EME+LIPLVN+LQDAF+  G S  ++LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL+ S  E AEFLH +GKKFTDFD+VR EIE ETDRVTG NKG+SSIPINL+VYSPHVLNLTLIDLPGITKVPVGDQP DIE QIR MI++FIT EN +ILAV+PAN+DLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR++LEN+LLPLRRGY+G+VNRSQKDI+G+KDI+ AM  ERKFF SHP+Y H+A++MGT +LQKVLNQQL NHIRDTLP+ RNK+Q QL++IE +VE +KN KP DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG KIN++FHE FP+EI K +F+EK+LR+EI  AIKNIHG+RTGLFTPDMAFEAIVK QI  L+ PS+K +D V+ EL++ +++   K++++PRL +  ER V   +R ++ +TKDQ+ +LI IQ+SYINTNHEDFIGF NA +++    K   +GNQ          +IRKGWL+++    +   ++ +WF+L AESL+WYKD++E EKK+++ L+NL+++D +      K   +L+N + + NV+KD++ L+LA   + ++DSWKA+ LRAGVYP+     NDE+G+  +   D  LERQVE +RNLV SY++II     D +PK + H +I+ V++F+N++L++ L S E+ + LMEES E  QRR+++LR+Y+ALK  L II ++ TATVS PAPPPV + W       P  +  T+ R  ++       S R P PAIP   P++  P
Sbjct:    3 NREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKLQGQLLSIEHEVEAYKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGAKINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKLKGPSLKSVDLVIQELINTVKKCTKKLANFPRLCEETERIVANHIREREGKTKDQVLLLIDIQVSYINTNHEDFIGFANAQQRSSQVHKKTTVGNQGTNLPPSRQIVIRKGWLTISNIGIMKGGSKGYWFVLTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFALFNTEQR-NVYKDYRFLELACDSQEDVDSWKASLLRAGVYPDKSVAENDENGQAENFSMDPQLERQVETIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESAEQAQRRDEMLRMYQALKEALGIIGDISTATVSTPAPPPVDDSWIQHSRRSPPPSPTTQRRPTLSAPLARPTSGRGPAPAIPSPGPHSGAP 809          
BLAST of Dynamin 2 vs. Ensembl Human
Match: DNM1 (dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972])

HSP 1 Score: 949.888 bits (2454), Expect = 0.000e+0
Identity = 459/792 (57.95%), Postives = 604/792 (76.26%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQ----IIRKGWLSLATATSLTKKN-EFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE---------TNDEDGEENH-EPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNPRRVSAASNRAPPAIPGSK 2456
            N  ME LIPLVN+LQDAF+  G +  +DLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL+N+ TE AEFLH +GKKFTDF++VR EIE ETDRVTG NKG+S +PINL+VYSPHVLNLTL+DLPG+TKVPVGDQP DIE QIR M+++F+T EN +ILAVSPANSDLANSDALK+AK+VDPQG RTIGVITKLDLMD+GTDAR++LEN+LLPLRRGYIG+VNRSQKDI+G+KDI  A+  ERKFF SHPSY H+A++MGT YLQKVLNQQL NHIRDTLP LRNK+Q+QL++IEK+VEE+KN +P DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK+LR+EI  AIKNIHG+RTGLFTPD+AFEA VK Q++ L+EPS+KC+D VVSEL   IR+ + K+  YPRL++ +ER V   +R ++ RTK+Q+ +LI I+L+Y+NTNHEDFIGF NA ++++  N  K  GNQ    +IRKGWL++     +   + E+WF+L AE+L+WYKD++E EKK++++++NL+L+D +      K   +L+N + + NV+KD++ L+LA   +  +DSWKA+FLRAGVYPE           +E+G ++     D  LERQVE +RNLV SY+ I+     D +PK + H +I+  +EF+ ++L++ L S  + + LMEES E  QRR+++LR+Y ALK  L II ++ T TVS P PPPV + W +       R +P        RA PA+P ++
Sbjct:    3 NRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTATIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQR-NVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRA-PAVPPAR 792          
BLAST of Dynamin 2 vs. Ensembl Celegans
Match: dyn-1 (Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055])

HSP 1 Score: 877.856 bits (2267), Expect = 0.000e+0
Identity = 429/759 (56.52%), Postives = 568/759 (74.84%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEG-AGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD---NPVKNMGNQIIRKGWLSLATATSLTKKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPETN----DEDGEENHEPK-DSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPP-PVVNEWPKANG 2378
            N  M+ LIP++N++QDAF+  G S S +LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP ILQLI    E AEFLH +G +F DFD VR+EIE ETDRVTG+NKG+S  PINL+V+SP+VLNLTLIDLPG+TKVPVGDQP DIE+QIR MIL FI  E  +ILAV+PANSDLA SDALK+AK+VDPQGLRTIGV+TKLDLMD+GTDAREILEN+L  LRRGY+G+VNR QKDI GRKDIR A++ ERKFF SHPSY HMA+++GT YLQ  LNQQL NHIRDTLP+LR+ +Q ++  +EKDV E+KN +P DP  K K+L+    +F  D ++ +EG + +   T++L+GG +IN+LFHE FP+EI K + DEK++RKEI  AI+NIHG+R GLFTPDMAFEAI K QI  L+EPS+KC+D VV+EL ++IR+ A  ++ YPRL+D +ER V+  +R ++   K QI +++  +L+Y+NTNHEDFIGF+NA+ KA    +  KN+GNQ+IRKGWLSL+  + +    + WF+L ++SL+WYKD++E EKK+++ L+ ++LKD +        + +L+  D K N++KD+K L+L   +   +D+WKA+FLRAGVYPE      DE  +E  +   D  LERQVE +RNLV SY+ II     D +PKAV H ++++  EF+ ++L++ L    + D LMEES    Q+RE++LR+Y A K  L+IIS V  +T+ +  PP P+ +  P  +G
Sbjct:    5 NQGMQALIPVINRVQDAFSQLGTSVSFELPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLIQDRNEYAEFLHKKGHRFVDFDAVRKEIEDETDRVTGQNKGISPHPINLRVFSPNVLNLTLIDLPGLTKVPVGDQPADIEQQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMDEGTDAREILENKLFTLRRGYVGVVNRGQKDIVGRKDIRAALDAERKFFISHPSYRHMADRLGTSYLQHTLNQQLTNHIRDTLPTLRDSLQKKMFAMEKDVAEYKNYQPNDPGRKTKALLQMVTQFNADIERSIEGSSAKLVSTNELSGGARINRLFHERFPFEIVKMEIDEKEMRKEIQYAIRNIHGIRVGLFTPDMAFEAIAKKQITRLKEPSLKCVDLVVNELANVIRQCADTMARYPRLRDELERIVVSHMREREQIAKQQIGLIVDYELAYMNTNHEDFIGFSNAEAKASQGQSAKKNLGNQVIRKGWLSLSNVSFVRGSKDNWFVLMSDSLSWYKDDEEKEKKYMLPLDGVKLKDIEGGFMSRNHKFALFYPDGK-NIYKDYKQLELGCTNLDEIDAWKASFLRAGVYPEKQKAQEDESQQEMEDTSIDPQLERQVETIRNLVDSYMRIITKTIKDLVPKAVMHLIVNQTGEFMKDELLAHLYQCGDTDALMEESQIEAQKREEMLRMYHACKEALRIISEVNMSTLGDQPPPLPMSDYRPHPSG 762          
BLAST of Dynamin 2 vs. Ensembl Celegans
Match: dyn-1 (Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055])

HSP 1 Score: 877.856 bits (2267), Expect = 0.000e+0
Identity = 429/759 (56.52%), Postives = 568/759 (74.84%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEG-AGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD---NPVKNMGNQIIRKGWLSLATATSLTKKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPETN----DEDGEENHEPK-DSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPP-PVVNEWPKANG 2378
            N  M+ LIP++N++QDAF+  G S S +LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP ILQLI    E AEFLH +G +F DFD VR+EIE ETDRVTG+NKG+S  PINL+V+SP+VLNLTLIDLPG+TKVPVGDQP DIE+QIR MIL FI  E  +ILAV+PANSDLA SDALK+AK+VDPQGLRTIGV+TKLDLMD+GTDAREILEN+L  LRRGY+G+VNR QKDI GRKDIR A++ ERKFF SHPSY HMA+++GT YLQ  LNQQL NHIRDTLP+LR+ +Q ++  +EKDV E+KN +P DP  K K+L+    +F  D ++ +EG + +   T++L+GG +IN+LFHE FP+EI K + DEK++RKEI  AI+NIHG+R GLFTPDMAFEAI K QI  L+EPS+KC+D VV+EL ++IR+ A  ++ YPRL+D +ER V+  +R ++   K QI +++  +L+Y+NTNHEDFIGF+NA+ KA    +  KN+GNQ+IRKGWLSL+  + +    + WF+L ++SL+WYKD++E EKK+++ L+ ++LKD +        + +L+  D K N++KD+K L+L   +   +D+WKA+FLRAGVYPE      DE  +E  +   D  LERQVE +RNLV SY+ II     D +PKAV H ++++  EF+ ++L++ L    + D LMEES    Q+RE++LR+Y A K  L+IIS V  +T+ +  PP P+ +  P  +G
Sbjct:    5 NQGMQALIPVINRVQDAFSQLGTSVSFELPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLIQDRNEYAEFLHKKGHRFVDFDAVRKEIEDETDRVTGQNKGISPHPINLRVFSPNVLNLTLIDLPGLTKVPVGDQPADIEQQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMDEGTDAREILENKLFTLRRGYVGVVNRGQKDIVGRKDIRAALDAERKFFISHPSYRHMADRLGTSYLQHTLNQQLTNHIRDTLPTLRDSLQKKMFAMEKDVAEYKNYQPNDPGRKTKALLQMVTQFNADIERSIEGSSAKLVSTNELSGGARINRLFHERFPFEIVKMEIDEKEMRKEIQYAIRNIHGIRVGLFTPDMAFEAIAKKQITRLKEPSLKCVDLVVNELANVIRQCADTMARYPRLRDELERIVVSHMREREQIAKQQIGLIVDYELAYMNTNHEDFIGFSNAEAKASQGQSAKKNLGNQVIRKGWLSLSNVSFVRGSKDNWFVLMSDSLSWYKDDEEKEKKYMLPLDGVKLKDIEGGFMSRNHKFALFYPDGK-NIYKDYKQLELGCTNLDEIDAWKASFLRAGVYPEKQKAQEDESQQEMEDTSIDPQLERQVETIRNLVDSYMRIITKTIKDLVPKAVMHLIVNQTGEFMKDELLAHLYQCGDTDALMEESQIEAQKREEMLRMYHACKEALRIISEVNMSTLGDQPPPLPMSDYRPHPSG 762          
BLAST of Dynamin 2 vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 429.098 bits (1102), Expect = 1.981e-138
Identity = 234/513 (45.61%), Postives = 332/513 (64.72%), Query Frame = 3
Query:  141 MEKLIPLVNQLQDAF-TLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTES----------------AEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSA----TKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFN 1616
            ME LIP+VN+LQD F TL      I LPQI VVGSQSAGKSSVLEN VGRDFLPRG+GIVTRRP ILQL +   +                 A F H   K FTDFD VR+EIE ETDRVTG NKG+S +PI+LK+YS  V++L+L+DLPGITK+PVGDQP +IEEQIR MIL +I+N ++IILAV+PAN D A S+ +K+A++VD  G RT+ V+TKLDLMD+GTDA ++L  +++P++ G IG+VNRSQ++I   K I  A++DE+ F      Y  +A++ GT YL K LN  L++HIR+ LP+L+ ++       + D+  F   +P +   K ++L+    RF   +   +EG  R+ +T +L GG +I  +FH+ F   +   +  E   + +I TAI+N  G R  LF P+++FE +VK QI+ LEEPS++C++ V  E+  +++        ++  +PRL D I   V   ++ +   T + ++ L+ I+L+YINT H +F   N
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFM--QKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIMNAQCQSDLVAFG--EPVED--KNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHPEFTEAN 507          

HSP 2 Score: 55.8398 bits (133), Expect = 1.211e-7
Identity = 31/90 (34.44%), Postives = 52/90 (57.78%), Query Frame = 3
Query: 2043 ERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNV 2312
            +R V I+  L+ +Y  I+R    D +PKA+   L++ VR+ L ++L+  L   + +D L+ E+ ++ QRR D L   +AL+    IIS V
Sbjct:  610 QRDVAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYKPDEMDDLLAETEDMAQRRRDTLETMKALQQASVIISEV 699          
BLAST of Dynamin 2 vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 429.098 bits (1102), Expect = 1.981e-138
Identity = 234/513 (45.61%), Postives = 332/513 (64.72%), Query Frame = 3
Query:  141 MEKLIPLVNQLQDAF-TLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTES----------------AEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSA----TKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFN 1616
            ME LIP+VN+LQD F TL      I LPQI VVGSQSAGKSSVLEN VGRDFLPRG+GIVTRRP ILQL +   +                 A F H   K FTDFD VR+EIE ETDRVTG NKG+S +PI+LK+YS  V++L+L+DLPGITK+PVGDQP +IEEQIR MIL +I+N ++IILAV+PAN D A S+ +K+A++VD  G RT+ V+TKLDLMD+GTDA ++L  +++P++ G IG+VNRSQ++I   K I  A++DE+ F      Y  +A++ GT YL K LN  L++HIR+ LP+L+ ++       + D+  F   +P +   K ++L+    RF   +   +EG  R+ +T +L GG +I  +FH+ F   +   +  E   + +I TAI+N  G R  LF P+++FE +VK QI+ LEEPS++C++ V  E+  +++        ++  +PRL D I   V   ++ +   T + ++ L+ I+L+YINT H +F   N
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFM--QKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIMNAQCQSDLVAFG--EPVED--KNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHPEFTEAN 507          

HSP 2 Score: 55.8398 bits (133), Expect = 1.211e-7
Identity = 31/90 (34.44%), Postives = 52/90 (57.78%), Query Frame = 3
Query: 2043 ERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNV 2312
            +R V I+  L+ +Y  I+R    D +PKA+   L++ VR+ L ++L+  L   + +D L+ E+ ++ QRR D L   +AL+    IIS V
Sbjct:  610 QRDVAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYKPDEMDDLLAETEDMAQRRRDTLETMKALQQASVIISEV 699          
BLAST of Dynamin 2 vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 429.098 bits (1102), Expect = 1.981e-138
Identity = 234/513 (45.61%), Postives = 332/513 (64.72%), Query Frame = 3
Query:  141 MEKLIPLVNQLQDAF-TLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTES----------------AEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSA----TKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFN 1616
            ME LIP+VN+LQD F TL      I LPQI VVGSQSAGKSSVLEN VGRDFLPRG+GIVTRRP ILQL +   +                 A F H   K FTDFD VR+EIE ETDRVTG NKG+S +PI+LK+YS  V++L+L+DLPGITK+PVGDQP +IEEQIR MIL +I+N ++IILAV+PAN D A S+ +K+A++VD  G RT+ V+TKLDLMD+GTDA ++L  +++P++ G IG+VNRSQ++I   K I  A++DE+ F      Y  +A++ GT YL K LN  L++HIR+ LP+L+ ++       + D+  F   +P +   K ++L+    RF   +   +EG  R+ +T +L GG +I  +FH+ F   +   +  E   + +I TAI+N  G R  LF P+++FE +VK QI+ LEEPS++C++ V  E+  +++        ++  +PRL D I   V   ++ +   T + ++ L+ I+L+YINT H +F   N
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFM--QKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIMNAQCQSDLVAFG--EPVED--KNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKPTNELVENLVAIELAYINTKHPEFTEAN 507          

HSP 2 Score: 55.8398 bits (133), Expect = 1.211e-7
Identity = 31/90 (34.44%), Postives = 52/90 (57.78%), Query Frame = 3
Query: 2043 ERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNV 2312
            +R V I+  L+ +Y  I+R    D +PKA+   L++ VR+ L ++L+  L   + +D L+ E+ ++ QRR D L   +AL+    IIS V
Sbjct:  610 QRDVAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQSELVRQLYKPDEMDDLLAETEDMAQRRRDTLETMKALQQASVIISEV 699          
BLAST of Dynamin 2 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0301596)

HSP 1 Score: 895.96 bits (2314), Expect = 0.000e+0
Identity = 443/809 (54.76%), Postives = 586/809 (72.44%), Query Frame = 3
Query:  141 MEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRD-TDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNP----VKNMGNQIIRKGWLSLATATSLTKKNE-FWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRM--FGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYP------ETNDEDGEEN-----HEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW-----------PKANGFTESRVNPRRVSAASNRAPPAIPGS-KPNNMLP 2474
            M+ LI +VN+LQDAFT  G+   +DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP ILQLIN  TE  EFLH++GKKF+ FD++R+EIE ETDRVTG NKG+S+IPINL+VYSPHVLNLTLIDLPG+TKV +GDQP DIE+QI++MI +FI  E  +ILAV+PAN+DLANSDALK+AK+VDPQG+RTIGVITKLDLMD+GTDAR+ILEN+LLPLRRGYIG+VNRSQKDIEGRKDI +A+  ERKFF SHPSY HMA+++GT YLQ+VLNQQL NHIRDTLP LR+K+Q Q++T+EK+VEEFK+ +P D S K K+++    +   DF++ +EG+G    +T++L+GG KIN++FHE   +EI K   DEK+LR+EI  AI+NIHG+R GLFTPDMAFEAIVK QI  L+EP +KC+D VV EL  ++R    K+S YPRL++  ER +   VR ++   K+QI +LI  +L+Y+NTNHEDFIGF NA  K++N      + +GNQ+IRKG + +     +   +  +WF+L +ES++WYKDE E EKKF++ L+ L+L+D +        +   +L++ D + NV+KD+K L+L+     +++SWKA+FLRAGVYP      E  DE+G+E          D  LERQVE +RNLV SY+ I+     D +PKA+   +I+  ++F+N +L++ L +  +   +MEES E   RRE++LR+Y A K  L+II +V  ATVS P PPPV N+W           P + G    +  P   S+   R PP  P + +P   +P
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTAKMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDFIGFANAQNKSENANKTGTRQLGNQVIRKGHMVIQNLGIMKGGSRPYWFVLTSESISWYKDEDEKEKKFMLPLDGLKLRDIEQGFMSMSRRVTFALFSPDGR-NVYKDYKQLELSCETVEDVESWKASFLRAGVYPEKQETQENGDEEGQEQKSASEESSSDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRREEMLRMYRACKDALQIIGDVSMATVSSPLPPPVKNDWLPSGLDNPRLSPPSPGGVRGKPGPPAQSSLGGRNPPLPPSTGRPAPAIP 808          
BLAST of Dynamin 2 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0301597)

HSP 1 Score: 894.804 bits (2311), Expect = 0.000e+0
Identity = 443/809 (54.76%), Postives = 586/809 (72.44%), Query Frame = 3
Query:  141 MEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRD-TDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNP----VKNMGNQIIRKGWLSLATATSLTKKNE-FWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRM--FGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYP------ETNDEDGEEN-----HEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW-----------PKANGFTESRVNPRRVSAASNRAPPAIPGS-KPNNMLP 2474
            M+ LI +VN+LQDAFT  G+   +DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP ILQLIN  TE  EFLH++GKKF+ FD++R+EIE ETDRVTG NKG+S+IPINL+VYSPHVLNLTLIDLPG+TKV +GDQP DIE+QI++MI +FI  E  +ILAV+PAN+DLANSDALK+AK+VDPQG+RTIGVITKLDLMD+GTDAR+ILEN+LLPLRRGYIG+VNRSQKDIEGRKDI +A+  ERKFF SHPSY HMA+++GT YLQ+VLNQQL NHIRDTLP LR+K+Q Q++T+EK+VEEFK+ +P D S K K+++    +   DF++ +EG+G    +T++L+GG KIN++FHE   +EI K   DEK+LR+EI  AI+NIHG+R GLFTPDMAFEAIVK QI  L+EP +KC+D VV EL  ++R    K+S YPRL++  ER +   VR ++   K+QI +LI  +L+Y+NTNHEDFIGF NA  K++N      + +GNQ+IRKG + +     +   +  +WF+L +ES++WYKDE E EKKF++ L+ L+L+D +        +   +L++ D + NV+KD+K L+L+     +++SWKA+FLRAGVYP      E  DE+G+E          D  LERQVE +RNLV SY+ I+     D +PKA+   +I+  ++F+N +L++ L +  +   +MEES E   RRE++LR+Y A K  L+II +V  ATVS P PPPV N+W           P + G    +  P   S+   R PP  P + +P   +P
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTAKMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDFIGFANAQNKSENANKTGTRQLGNQVIRKGHMVIQNLGIMKGGSRPYWFVLTSESISWYKDEDEKEKKFMLPLDGLKLRDIEQGFMSMSRRVTFALFSPDGR-NVYKDYKQLELSCETVEDVESWKASFLRAGVYPEKQETQENGDEEGQEQKSASEESSSDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRREEMLRMYRACKDALQIIGDVSMATVSSPLPPPVKNDWLPSGLDNPRLSPPSPGGVRGKPGPPAQSSLGGRNPPLPPSTGRPAPAIP 808          
BLAST of Dynamin 2 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0301595)

HSP 1 Score: 891.338 bits (2302), Expect = 0.000e+0
Identity = 441/803 (54.92%), Postives = 585/803 (72.85%), Query Frame = 3
Query:  141 MEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRD-TDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNP----VKNMGNQIIRKGWLSLATATSLTKKNE-FWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRM--FGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPETND--EDGE---ENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW-----------PKANGFTESRVNPRRVSAASNRAPPAIPGS-KPNNMLP 2474
            M+ LI +VN+LQDAFT  G+   +DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP ILQLIN  TE  EFLH++GKKF+ FD++R+EIE ETDRVTG NKG+S+IPINL+VYSPHVLNLTLIDLPG+TKV +GDQP DIE+QI++MI +FI  E  +ILAV+PAN+DLANSDALK+AK+VDPQG+RTIGVITKLDLMD+GTDAR+ILEN+LLPLRRGYIG+VNRSQKDIEGRKDI +A+  ERKFF SHPSY HMA+++GT YLQ+VLNQQL NHIRDTLP LR+K+Q Q++T+EK+VEEFK+ +P D S K K+++    +   DF++ +EG+G    +T++L+GG KIN++FHE   +EI K   DEK+LR+EI  AI+NIHG+R GLFTPDMAFEAIVK QI  L+EP +KC+D VV EL  ++R    K+S YPRL++  ER +   VR ++   K+QI +LI  +L+Y+NTNHEDFIGF NA  K++N      + +GNQ+IRKG + +     +   +  +WF+L +ES++WYKDE E EKKF++ L+ L+L+D +        +   +L++ D + NV+KD+K L+L+     +++SWKA+FLRAGVYPE  +  E+G+         D  LERQVE +RNLV SY+ I+     D +PKA+   +I+  ++F+N +L++ L +  +   +MEES E   RRE++LR+Y A K  L+II +V  ATVS P PPPV N+W           P + G    +  P   S+   R PP  P + +P   +P
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTAKMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDFIGFANAQNKSENANKTGTRQLGNQVIRKGHMVIQNLGIMKGGSRPYWFVLTSESISWYKDEDEKEKKFMLPLDGLKLRDIEQGFMSMSRRVTFALFSPDGR-NVYKDYKQLELSCETVEDVESWKASFLRAGVYPEKQETQENGDESASEESSSDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRREEMLRMYRACKDALQIIGDVSMATVSSPLPPPVKNDWLPSGLDNPRLSPPSPGGVRGKPGPPAQSSLGGRNPPLPPSTGRPAPAIP 802          
BLAST of Dynamin 2 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0301594)

HSP 1 Score: 891.338 bits (2302), Expect = 0.000e+0
Identity = 441/803 (54.92%), Postives = 585/803 (72.85%), Query Frame = 3
Query:  141 MEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRD-TDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNP----VKNMGNQIIRKGWLSLATATSLTKKNE-FWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRM--FGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPETND--EDGE---ENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW-----------PKANGFTESRVNPRRVSAASNRAPPAIPGS-KPNNMLP 2474
            M+ LI +VN+LQDAFT  G+   +DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP ILQLIN  TE  EFLH++GKKF+ FD++R+EIE ETDRVTG NKG+S+IPINL+VYSPHVLNLTLIDLPG+TKV +GDQP DIE+QI++MI +FI  E  +ILAV+PAN+DLANSDALK+AK+VDPQG+RTIGVITKLDLMD+GTDAR+ILEN+LLPLRRGYIG+VNRSQKDIEGRKDI +A+  ERKFF SHPSY HMA+++GT YLQ+VLNQQL NHIRDTLP LR+K+Q Q++T+EK+VEEFK+ +P D S K K+++    +   DF++ +EG+G    +T++L+GG KIN++FHE   +EI K   DEK+LR+EI  AI+NIHG+R GLFTPDMAFEAIVK QI  L+EP +KC+D VV EL  ++R    K+S YPRL++  ER +   VR ++   K+QI +LI  +L+Y+NTNHEDFIGF NA  K++N      + +GNQ+IRKG + +     +   +  +WF+L +ES++WYKDE E EKKF++ L+ L+L+D +        +   +L++ D + NV+KD+K L+L+     +++SWKA+FLRAGVYPE  +  E+G+         D  LERQVE +RNLV SY+ I+     D +PKA+   +I+  ++F+N +L++ L +  +   +MEES E   RRE++LR+Y A K  L+II +V  ATVS P PPPV N+W           P + G    +  P   S+   R PP  P + +P   +P
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTAKMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDFIGFANAQNKSENANKTGTRQLGNQVIRKGHMVIQNLGIMKGGSRPYWFVLTSESISWYKDEDEKEKKFMLPLDGLKLRDIEQGFMSMSRRVTFALFSPDGR-NVYKDYKQLELSCETVEDVESWKASFLRAGVYPEKQETQENGDESASEESSSDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRREEMLRMYRACKDALQIIGDVSMATVSSPLPPPVKNDWLPSGLDNPRLSPPSPGGVRGKPGPPAQSSLGGRNPPLPPSTGRPAPAIP 802          
BLAST of Dynamin 2 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074123)

HSP 1 Score: 891.338 bits (2302), Expect = 0.000e+0
Identity = 441/803 (54.92%), Postives = 585/803 (72.85%), Query Frame = 3
Query:  141 MEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRD-TDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNP----VKNMGNQIIRKGWLSLATATSLTKKNE-FWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRM--FGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPETND--EDGE---ENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW-----------PKANGFTESRVNPRRVSAASNRAPPAIPGS-KPNNMLP 2474
            M+ LI +VN+LQDAFT  G+   +DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP ILQLIN  TE  EFLH++GKKF+ FD++R+EIE ETDRVTG NKG+S+IPINL+VYSPHVLNLTLIDLPG+TKV +GDQP DIE+QI++MI +FI  E  +ILAV+PAN+DLANSDALK+AK+VDPQG+RTIGVITKLDLMD+GTDAR+ILEN+LLPLRRGYIG+VNRSQKDIEGRKDI +A+  ERKFF SHPSY HMA+++GT YLQ+VLNQQL NHIRDTLP LR+K+Q Q++T+EK+VEEFK+ +P D S K K+++    +   DF++ +EG+G    +T++L+GG KIN++FHE   +EI K   DEK+LR+EI  AI+NIHG+R GLFTPDMAFEAIVK QI  L+EP +KC+D VV EL  ++R    K+S YPRL++  ER +   VR ++   K+QI +LI  +L+Y+NTNHEDFIGF NA  K++N      + +GNQ+IRKG + +     +   +  +WF+L +ES++WYKDE E EKKF++ L+ L+L+D +        +   +L++ D + NV+KD+K L+L+     +++SWKA+FLRAGVYPE  +  E+G+         D  LERQVE +RNLV SY+ I+     D +PKA+   +I+  ++F+N +L++ L +  +   +MEES E   RRE++LR+Y A K  L+II +V  ATVS P PPPV N+W           P + G    +  P   S+   R PP  P + +P   +P
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVKMACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTAKMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDFIGFANAQNKSENANKTGTRQLGNQVIRKGHMVIQNLGIMKGGSRPYWFVLTSESISWYKDEDEKEKKFMLPLDGLKLRDIEQGFMSMSRRVTFALFSPDGR-NVYKDYKQLELSCETVEDVESWKASFLRAGVYPEKQETQENGDESASEESSSDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRREEMLRMYRACKDALQIIGDVSMATVSSPLPPPVKNDWLPSGLDNPRLSPPSPGGVRGKPGPPAQSSLGGRNPPLPPSTGRPAPAIP 802          
BLAST of Dynamin 2 vs. Ensembl Zebrafish
Match: dnm1a (dynamin 1a [Source:NCBI gene;Acc:100307098])

HSP 1 Score: 941.799 bits (2433), Expect = 0.000e+0
Identity = 453/760 (59.61%), Postives = 588/760 (77.37%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADN-PVKNMGNQ----IIRKGWLSLATATSLT-KKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE-----TNDEDGEENH-----EPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW 2363
            N  ME LIPLVN++QDAF+  G + ++DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP +LQLIN PTE AEFLH +GKKFTDFD+VR+EIE ETDRVTG+NKG+S +PINL+VYSP+VLNLTL+DLPG+TKVPVGDQP DIE QI+ M+++F+T EN ++LAVSPANSDLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR+ILEN+LLPLRRGYIG+VNRSQKDI+G+KDI  AM  ERKFF SHPSY H+A++MGT YLQK LNQQL NHIRDTLP LR K+Q+QL++IEK+VEE+KN +P DPS K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK+LRKEI  AIKNIHG+RTGLFTPD+AFEAIVK QI+ L  P +KCID VVSEL   IR+ + K++ YP L++ +ER V Q +R+++SRTK+Q+ +LI I+L+Y+NTNHEDFIGF NA +++     K  GNQ    +IRKGWL++     +     E+WF+L AESL+WYKD++E EKK+++ ++NL+ +D +      K   +L+N + + NV+KD++ L+LA   +  +D WKA+FLRAGVYPE       ++ GEEN         D  LERQVE +RNLV SY+ I+     D +PK + H +I+  +E++N +L++ L S  + + LMEES E  QRR+++LR+Y ALK  L II ++ T T+S   PPPV + W
Sbjct:    3 NRGMEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRVTGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIKDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAMAAERKFFLSHPSYRHLADRMGTPYLQKTLNQQLTNHIRDTLPGLRAKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFSVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDLAFEAIVKKQIQKLNGPCLKCIDMVVSELTSTIRKCSEKLAQYPMLREEMERIVTQHIRDRESRTKNQVLLLIDIELAYMNTNHEDFIGFANAQQRSSQIKKKAAGNQDEIMVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKFRDVEKGFMSSKHIFALFNTEQR-NVYKDYRQLELACESQEEVDGWKASFLRAGVYPERVVEKEKNDAGEENGSDGFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLIPKTIMHLMINNTKEYINAELLASLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALNIIGDISTTTISTSLPPPVDDSW 761          
BLAST of Dynamin 2 vs. Ensembl Zebrafish
Match: dnm1a (dynamin 1a [Source:NCBI gene;Acc:100307098])

HSP 1 Score: 941.028 bits (2431), Expect = 0.000e+0
Identity = 450/760 (59.21%), Postives = 588/760 (77.37%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADN-PVKNMGNQ----IIRKGWLSLATATSLT-KKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE-----TNDEDGEENH-----EPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW 2363
            N  ME LIPLVN++QDAF+  G + ++DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP +LQLIN PTE AEFLH +GKKFTDFD+VR+EIE ETDRVTG+NKG+S +PINL+VYSP+VLNLTL+DLPG+TKVPVGDQP DIE QI+ M+++F+T EN ++LAVSPANSDLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR+ILEN+LLPLRRGYIG+VNRSQKDI+G+KDI  AM  ERKFF SHPSY H+A++MGT YLQK LNQQL NHIRDTLP LR K+Q+QL++IEK+VEE+KN +P DPS K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK+LRKEI  AIKNIHG+RTGLFTPDMAFE IVK QI  ++EP  KC+D V+SEL++ +R+   K++ YP L++ +ER V Q +R+++SRTK+Q+ +LI I+L+Y+NTNHEDFIGF NA +++     K  GNQ    +IRKGWL++     +     E+WF+L AESL+WYKD++E EKK+++ ++NL+ +D +      K   +L+N + + NV+KD++ L+LA   +  +D WKA+FLRAGVYPE       ++ GEEN         D  LERQVE +RNLV SY+ I+     D +PK + H +I+  +E++N +L++ L S  + + LMEES E  QRR+++LR+Y ALK  L II ++ T T+S   PPPV + W
Sbjct:    3 NRGMEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRVTGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIKDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAMAAERKFFLSHPSYRHLADRMGTPYLQKTLNQQLTNHIRDTLPGLRAKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFSVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIGKIKEPCQKCVDMVISELVNTVRQCTKKLAQYPMLREEMERIVTQHIRDRESRTKNQVLLLIDIELAYMNTNHEDFIGFANAQQRSSQIKKKAAGNQDEIMVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKFRDVEKGFMSSKHIFALFNTEQR-NVYKDYRQLELACESQEEVDGWKASFLRAGVYPERVVEKEKNDAGEENGSDGFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLIPKTIMHLMINNTKEYINAELLASLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALNIIGDISTTTISTSLPPPVDDSW 761          
BLAST of Dynamin 2 vs. Ensembl Zebrafish
Match: dnm1b (dynamin 1b [Source:ZFIN;Acc:ZDB-GENE-100920-3])

HSP 1 Score: 939.102 bits (2426), Expect = 0.000e+0
Identity = 451/774 (58.27%), Postives = 597/774 (77.13%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQ----IIRKGWLSLATATSLT-KKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE--TNDEDGEENH--------EPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNP 2402
            N  ME LIPLVN++QDAF+  G + ++DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP +LQLIN PTE AEFLH +GKKFTDFD+VR+EIE ETDR+TG+NKG+S +PINL+VYSP+VLNLTL+DLPG+TKVPVGDQP DIE QIR M+++F+T EN ++LAVSPANSDLANSDALK+AK+VDPQG+RTIGVITKLDLMD+GTDAREILEN+LLPLRRGYIG+VNRSQKDI+G+KDI  AM  ERKFF +HPSY H+A++MGT YLQK LNQQL NHIRDTLP LRNK+Q+QL++IEK+VEE+K+ +P DPS K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK+LRKEI  AIKNIHG+RTGLFTPDMAFE IVK QI  ++EP  KC+D V++EL++ +R+   K++ YP L++ +ER V Q +R+++SRTK+Q+ +LI I+L+Y+NTNHEDFIGF NA +++   N  K  GNQ    +IRKGWL++     +     E+WF++ AE+L+WYKD++E EKK+++ L+NL+L+D +      K   +L+N + + NV+KD++ L+LA+  +  +DSWKA+FLRAGVYPE  T+ E  + +            D  LERQVE +RNLV SY+ I+     D +PK + H +I+  ++F++ +L++ L S  + + LMEES E  Q RE++LR+Y ALK  L II ++ T+TVS   PPPV + W +  G    R +P
Sbjct:    3 NRGMEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRITGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGMRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDITAAMSAERKFFLTHPSYRHLADRMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKHFRPDDPSRKTKALLQMVQQFAVDFEKCIEGSGDQVDTVELSGGARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIAKIKEPCQKCVDLVITELVNTVRQCTKKLAQYPMLREEMERIVTQHIRDRESRTKNQVMLLIDIELAYMNTNHEDFIGFANAQQRSSQMNKKKAAGNQDEIMVIRKGWLTINNIGIMKGGAKEYWFVMTAENLSWYKDDEEKEKKYMLPLDNLKLRDIEKSFMSSKHVFALFNTEQR-NVYKDYRQLELASDTQEEVDSWKASFLRAGVYPERITDKEKSDTSDESSSDGFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKDFIHAELLANLYSCGDQNTLMEESAEQAQHREEMLRMYHALKEALNIIGDISTSTVSTAMPPPVDDSWLQVQGGPSGRRSP 775          
BLAST of Dynamin 2 vs. Ensembl Zebrafish
Match: dnm1b (dynamin 1b [Source:ZFIN;Acc:ZDB-GENE-100920-3])

HSP 1 Score: 938.332 bits (2424), Expect = 0.000e+0
Identity = 450/775 (58.06%), Postives = 597/775 (77.03%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQ----IIRKGWLSLATATSLT-KKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE-TNDEDGEENH----------EPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNP 2402
            N  ME LIPLVN++QDAF+  G + ++DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP +LQLIN PTE AEFLH +GKKFTDFD+VR+EIE ETDR+TG+NKG+S +PINL+VYSP+VLNLTL+DLPG+TKVPVGDQP DIE QIR M+++F+T EN ++LAVSPANSDLANSDALK+AK+VDPQG+RTIGVITKLDLMD+GTDAREILEN+LLPLRRGYIG+VNRSQKDI+G+KDI  AM  ERKFF +HPSY H+A++MGT YLQK LNQQL NHIRDTLP LRNK+Q+QL++IEK+VEE+K+ +P DPS K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK+LRKEI  AIKNIHG+RTGLFTPDMAFE IVK QI  ++EP  KC+D V++EL++ +R+   K++ YP L++ +ER V Q +R+++SRTK+Q+ +LI I+L+Y+NTNHEDFIGF NA +++   N  K  GNQ    +IRKGWL++     +     E+WF++ AE+L+WYKD++E EKK+++ L+NL+L+D +      K   +L+N + + NV+KD++ L+LA+  +  +DSWKA+FLRAGVYPE   D++ + +              D  LERQVE +RNLV SY+ I+     D +PK + H +I+  ++F++ +L++ L S  + + LMEES E  Q RE++LR+Y ALK  L II ++ T+TVS   PPPV + W +  G    R +P
Sbjct:    3 NRGMEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRITGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGMRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDITAAMSAERKFFLTHPSYRHLADRMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKHFRPDDPSRKTKALLQMVQQFAVDFEKCIEGSGDQVDTVELSGGARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIAKIKEPCQKCVDLVITELVNTVRQCTKKLAQYPMLREEMERIVTQHIRDRESRTKNQVMLLIDIELAYMNTNHEDFIGFANAQQRSSQMNKKKAAGNQDEIMVIRKGWLTINNIGIMKGGAKEYWFVMTAENLSWYKDDEEKEKKYMLPLDNLKLRDIEKSFMSSKHVFALFNTEQR-NVYKDYRQLELASDTQEEVDSWKASFLRAGVYPERITDKEKQSDTSDESSSDGFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKDFIHAELLANLYSCGDQNTLMEESAEQAQHREEMLRMYHALKEALNIIGDISTSTVSTAMPPPVDDSWLQVQGGPSGRRSP 776          
BLAST of Dynamin 2 vs. Ensembl Zebrafish
Match: dnm2a (dynamin 2a [Source:ZFIN;Acc:ZDB-GENE-050913-84])

HSP 1 Score: 928.702 bits (2399), Expect = 0.000e+0
Identity = 461/777 (59.33%), Postives = 595/777 (76.58%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKK-ADNPVKNMGNQIIRKGWLSLATATSLTKKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPETNDEDGEENHEPKDSM-----LERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNPRRVSAASNRAPPAI 2444
            N  ME+LIPL+N+LQDAF+  G S ++DLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP ILQL+N+  E AEFLH +G+KF DFD+VR+EIE ETDR+TG NKG+S IPINL+VYSP+VLNLTLIDLPG+TKV VGDQP DIE QIR MI++FIT E+ +ILAV+PAN DLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR+ILEN+LLPLRRGYIG+VNRSQKDI+GRKDIR A+  ERKFF SHPSY HMA +MGT +LQK LNQQL NHIRDTLP LR+K+Q+QL+++EK+VEE+KN +P DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K  FDEK+LR+EI  AIKN+HGVRTGLFTPD+AFEAIVK QI  L+EP +KCID V+ EL++  R+   K+SSYPRL++  ER V   VR ++ +TKDQ+ +LI  +LSYINTNHEDFIGF NA ++   N  + + NQ+IRKGWL+L  +       E+WF+L AESL+WYKDE+E EKK+++ L+NL+L+D +      K   +++N + + NV+KD + ++LA   + +MDSWKA+FLRAGVYPE +  + EE   P DS      LERQVE +RNLV SYI I+     D +PK + H +I+  ++F++++L++ L S  + + LMEES +  QRR+++LR+Y A+K  L II ++ T+T+S P PPPV + W      T  R  P   SA     PPA+
Sbjct:    3 NRGMEELIPLINKLQDAFSSIGQSCNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLVNNKAEYAEFLHCKGRKFVDFDEVRQEIEAETDRITGSNKGISPIPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPPDIEHQIRDMIMQFITRESCLILAVTPANMDLANSDALKVAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDIRAALAAERKFFLSHPSYRHMAERMGTPHLQKALNQQLTNHIRDTLPGLRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKCIEGSGDQVDTAELSGGARINRIFHERFPFELVKIVFDEKELRREISHAIKNVHGVRTGLFTPDLAFEAIVKKQIIKLKEPCLKCIDLVIQELINTFRQCTNKLSSYPRLREETERIVTTYVREREGKTKDQVLLLIDTELSYINTNHEDFIGFANAQQRNIVNKKRAIPNQVIRKGWLTLNISIMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKLRDVEKGFMSTKHIFAIFNTEQR-NVYKDLRQIELACDSQEDMDSWKASFLRAGVYPEKDQVESEE-AAPADSFSMDPQLERQVETIRNLVDSYIGIVNKTIRDLMPKTIMHLMINSAKDFIHSELLAYLYSSGDQNSLMEESADQAQRRDEMLRMYHAIKEALSIIGDISTSTISTPVPPPVNDSWIPETSPTPQRRPP--TSAPPPNRPPAV 775          
BLAST of Dynamin 2 vs. Ensembl Xenopus
Match: ei24 (etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-990260])

HSP 1 Score: 937.562 bits (2422), Expect = 0.000e+0
Identity = 454/782 (58.06%), Postives = 599/782 (76.60%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQIIRKGWLSLATATSLTKKN-EFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPETNDEDGEENHE----PKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNPRRVSAASNRAPPAIPGSK 2456
            N  ME+LIPLVN+LQDAF+  G + ++DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP +LQL+NS TE  EFLH +GKKFTDFD++R EIE ETDR TG NKG+S +PINL+VYSP+VLNLTL+DLPG+TKVPVGDQP DIE QIR M+++F+T EN ++LAVSPANSDLANSDALK+AK+VDP+GLRTIGVITKLDLMD+GTDAR++LEN+LLPLRRGYIG+VNRSQKDI+G+KDI+ A+  ERKFF SHPSY H+A++MGT YLQK LNQQL NHIRDTLP LRNK+Q+QL++IEK+VEE+KN +P DP+ K K+L+L   +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK+LR+EI  AIKNIHG+RTGLFTPDMAFE IVK QIK ++EP +KC+D V+SEL+  +R+   K+S YP L++ +ER V   +R ++ RTKDQ+ +LI I+LSY+NTNHEDFIGF NA +++   N  K  GNQ+IRKGWL++     +   + E+WF+L AE+L+WYKD++E EKK+++ L+NL+L+D +      K   +L+N + + NV+KD++ L+LA   +  +DSWKA+FLRAGVYPE   E  E   +      D  LERQVE +RNLV SY+ I+     D +PK + H +I   ++F+++DL++ L S  + + LMEES E  Q R+++L++Y ALK  L II ++ T T+S P PPPV + W +       R +P        RA PA+P ++
Sbjct:    3 NRGMEELIPLVNRLQDAFSSIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLVNSSTEYGEFLHCKGKKFTDFDEIRLEIEAETDRATGTNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPVDIEFQIRDMLMQFVTKENCLVLAVSPANSDLANSDALKIAKEVDPKGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDIQAALAAERKFFLSHPSYRHLADRMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLLMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQIKKIKEPCLKCVDMVISELIGTVRQCTKKLSQYPHLREEMERIVTTHIREREGRTKDQVMLLIDIELSYMNTNHEDFIGFANAQQRSSQTNKKKASGNQVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLPLDNLKLRDIEKGFMSSKHIFALFNTEQR-NVYKDYRQLELACETQEEVDSWKASFLRAGVYPERASESEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTIRDLMPKTIMHLMIINTKDFIHSDLLANLYSCGDQNTLMEESAEQAQHRDEMLKMYRALKEALCIIGDISTTTISTPMPPPVDDSWLQVQNMPTGRRSPTSSPTPQRRA-PAVPPTR 782          
BLAST of Dynamin 2 vs. Ensembl Xenopus
Match: ei24 (etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-990260])

HSP 1 Score: 932.554 bits (2409), Expect = 0.000e+0
Identity = 461/812 (56.77%), Postives = 607/812 (74.75%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQIIRKGWLSLATATSLTKKN-EFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE-TNDED----GEENHEPK-----DSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNP------------RRVSAASNRAP--PAIPGSKPNNMLPQPLI 2486
            N  ME+LIPLVN+LQDAF+  G + ++DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP +LQL+NS TE  EFLH +GKKFTDFD++R EIE ETDR TG NKG+S +PINL+VYSP+VLNLTL+DLPG+TKVPVGDQP DIE QIR M+++F+T EN ++LAVSPANSDLANSDALK+AK+VDP+GLRTIGVITKLDLMD+GTDAR++LEN+LLPLRRGYIG+VNRSQKDI+G+KDI+ A+  ERKFF SHPSY H+A++MGT YLQK LNQQL NHIRDTLP LRNK+Q+QL++IEK+VEE+KN +P DP+ K K+L+L   +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK+LR+EI  AIKNIHG+RTGLFTPDMAFE IVK QIK ++EP +KC+D V+SEL+  +R+   K+S YP L++ +ER V   +R ++ RTKDQ+ +LI I+LSY+NTNHEDFIGF NA +++   N  K  GNQ+IRKGWL++     +   + E+WF+L AE+L+WYKD++E EKK+++ L+NL+L+D +      K   +L+N + + NV+KD++ L+LA   +  +DSWKA+FLRAGVYPE   D+D     EEN         D  LERQVE +RNLV SY+ I+     D +PK + H +I   ++F+++DL++ L S  + + LMEES E  Q R+++L++Y ALK  L II ++ T T+S P PPPV + W +       R +P                +    AP  P+ PG+ P+   P P I
Sbjct:    3 NRGMEELIPLVNRLQDAFSSIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLVNSSTEYGEFLHCKGKKFTDFDEIRLEIEAETDRATGTNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPVDIEFQIRDMLMQFVTKENCLVLAVSPANSDLANSDALKIAKEVDPKGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDIQAALAAERKFFLSHPSYRHLADRMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLLMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQIKKIKEPCLKCVDMVISELIGTVRQCTKKLSQYPHLREEMERIVTTHIREREGRTKDQVMLLIDIELSYMNTNHEDFIGFANAQQRSSQTNKKKASGNQVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLPLDNLKLRDIEKGFMSSKHIFALFNTEQR-NVYKDYRQLELACETQEEVDSWKASFLRAGVYPERAGDKDKASESEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTIRDLMPKTIMHLMIINTKDFIHSDLLANLYSCGDQNTLMEESAEQAQHRDEMLKMYRALKEALCIIGDISTTTISTPMPPPVDDSWLQVQNMPTGRRSPTSSPTPGPAPGPPPPGSTLGSAPPVPSRPGASPDPFGPPPQI 813          
BLAST of Dynamin 2 vs. Ensembl Xenopus
Match: dcbld2 (discoidin, CUB and LCCL domain containing 2 [Source:Xenbase;Acc:XB-GENE-958816])

HSP 1 Score: 927.161 bits (2395), Expect = 0.000e+0
Identity = 462/792 (58.33%), Postives = 608/792 (76.77%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQIIRKGWLSLATATSLTKKN-EFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPETNDEDGEENHEPKDSM---LERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPK-ANGFTESRVNPRRVSAA-SNRAPPAIPGSKPN-NMLPQP 2480
            N  ME+LIPLVN+LQDAF+  G + ++DLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP ILQLI S TE AEFLH + KKFTDFD+V +EIE ETDRVTG NKG+S +PINL+VYSP+VLNLTLIDLPGITKVPVGDQPHDIE QI+ MIL+FI+ ++ +ILAV+P N+DLANSDALKMAK+VDPQGLRTIGVITKLDLMD+GTDA++ILEN+LLPLRRGYIG+VNRSQKDI+G+KDI+ A+  ERKFF SHP Y H+A +MGT +LQK LNQQL NHIR+TLP+LRNK+Q+QL+++EK+VEE+KN +P DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK LR+EI  AIKNIHGVRTGLFTPDMAFEAIVK Q+  L+EP +KC+D V+ EL++ +R+   K+ SYP+L++  ER V   +R ++ +TKDQI +LI I+LSYINTNHEDFIGF NA +++   N  + + NQ+IR+GWL++   + +   + E+WFIL AESL+WYKDE+E EKK+++ L+NL+++D +      K   +++N + + NV+KD + ++LA   + ++DSWKA+FLRAGVYPE +  + EE  E   SM   LERQVE +RNLV SYI I+     D +PK + H +I+  ++F++++L++ L S  + + LMEES +  QRRED+LR+Y ALK  LKII ++ T+T + P PPPV + W + +N      V  R VS       PPA+ G  P   ++P P
Sbjct:    3 NRGMEELIPLVNKLQDAFSSIGQACNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVWQEIEAETDRVTGTNKGISPVPINLRVYSPNVLNLTLIDLPGITKVPVGDQPHDIEYQIKDMILQFISRDSCLILAVTPGNTDLANSDALKMAKEVDPQGLRTIGVITKLDLMDEGTDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDIKAALGAERKFFLSHPGYRHIAERMGTPHLQKTLNQQLTNHIRETLPALRNKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDMAFEAIVKKQVVKLKEPCLKCVDMVIQELINTVRQCTAKLLSYPKLREETERIVTTYIREREGKTKDQILLLIDIELSYINTNHEDFIGFANAQQRSSQLNKKRAVPNQVIRRGWLTINNISIMKGGSKEYWFILTAESLSWYKDEEEKEKKYMLPLDNLKIRDIEKGFMSTKHIFAIFNTEQR-NVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQREEEETQENTFSMDPQLERQVETIRNLVDSYICIVNKSIRDLMPKTIMHLMINNSKDFIHSELLAYLYSSADQNSLMEESADQAQRREDMLRMYHALKEALKIIGDISTSTATTPVPPPVDDTWLQNSNSGHSPTVQRRPVSTVLPPSRPPAVRGPTPGPPLIPVP 793          
BLAST of Dynamin 2 vs. Ensembl Xenopus
Match: dcbld2 (discoidin, CUB and LCCL domain containing 2 [Source:Xenbase;Acc:XB-GENE-958816])

HSP 1 Score: 925.235 bits (2390), Expect = 0.000e+0
Identity = 461/798 (57.77%), Postives = 609/798 (76.32%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQIIRKGWLSLATATSLTKKN-EFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPETN---------DEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPK-ANGFTESRVNPRRVSAA-SNRAPPAIPGSKPN-NMLPQP 2480
            N  ME+LIPLVN+LQDAF+  G + ++DLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP ILQLI S TE AEFLH + KKFTDFD+V +EIE ETDRVTG NKG+S +PINL+VYSP+VLNLTLIDLPGITKVPVGDQPHDIE QI+ MIL+FI+ ++ +ILAV+P N+DLANSDALKMAK+VDPQGLRTIGVITKLDLMD+GTDA++ILEN+LLPLRRGYIG+VNRSQKDI+G+KDI+ A+  ERKFF SHP Y H+A +MGT +LQK LNQQL NHIR+TLP+LRNK+Q+QL+++EK+VEE+KN +P DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK LR+EI  AIKNIHGVRTGLFTPDMAFEAIVK Q+  L+EP +KC+D V+ EL++ +R+   K+ SYP+L++  ER V   +R ++ +TKDQI +LI I+LSYINTNHEDFIGF NA +++   N  + + NQ+IR+GWL++   + +   + E+WFIL AESL+WYKDE+E EKK+++ L+NL+++D +      K   +++N + + NV+KD + ++LA   + ++DSWKA+FLRAGVYPE +         +E+ +EN    D  LERQVE +RNLV SYI I+     D +PK + H +I+  ++F++++L++ L S  + + LMEES +  QRRED+LR+Y ALK  LKII ++ T+T + P PPPV + W + +N      V  R VS       PPA+ G  P   ++P P
Sbjct:    3 NRGMEELIPLVNKLQDAFSSIGQACNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVWQEIEAETDRVTGTNKGISPVPINLRVYSPNVLNLTLIDLPGITKVPVGDQPHDIEYQIKDMILQFISRDSCLILAVTPGNTDLANSDALKMAKEVDPQGLRTIGVITKLDLMDEGTDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDIKAALGAERKFFLSHPGYRHIAERMGTPHLQKTLNQQLTNHIRETLPALRNKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDMAFEAIVKKQVVKLKEPCLKCVDMVIQELINTVRQCTAKLLSYPKLREETERIVTTYIREREGKTKDQILLLIDIELSYINTNHEDFIGFANAQQRSSQLNKKRAVPNQVIRRGWLTINNISIMKGGSKEYWFILTAESLSWYKDEEEKEKKYMLPLDNLKIRDIEKGFMSTKHIFAIFNTEQR-NVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQLTGSNAREEEETQENTFSMDPQLERQVETIRNLVDSYICIVNKSIRDLMPKTIMHLMINNSKDFIHSELLAYLYSSADQNSLMEESADQAQRREDMLRMYHALKEALKIIGDISTSTATTPVPPPVDDTWLQNSNSGHSPTVQRRPVSTVLPPSRPPAVRGPTPGPPLIPVP 799          
BLAST of Dynamin 2 vs. Ensembl Xenopus
Match: dcbld2 (discoidin, CUB and LCCL domain containing 2 [Source:Xenbase;Acc:XB-GENE-958816])

HSP 1 Score: 924.85 bits (2389), Expect = 0.000e+0
Identity = 461/795 (57.99%), Postives = 609/795 (76.60%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQIIRKGWLSLATATSLTKKN-EFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE------TNDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPK-ANGFTESRVNPRRVSAA-SNRAPPAIPGSKPN-NMLPQP 2480
            N  ME+LIPLVN+LQDAF+  G + ++DLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP ILQLI S TE AEFLH + KKFTDFD+V +EIE ETDRVTG NKG+S +PINL+VYSP+VLNLTLIDLPGITKVPVGDQPHDIE QI+ MIL+FI+ ++ +ILAV+P N+DLANSDALKMAK+VDPQGLRTIGVITKLDLMD+GTDA++ILEN+LLPLRRGYIG+VNRSQKDI+G+KDI+ A+  ERKFF SHP Y H+A +MGT +LQK LNQQL NHIR+TLP+LRNK+Q+QL+++EK+VEE+KN +P DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK LR+EI  AIKNIHGVRTGLFTPDMAFEAIVK Q+  L+EP +KC+D V+ EL++ +R+   K+ SYP+L++  ER V   +R ++ +TKDQI +LI I+LSYINTNHEDFIGF NA +++   N  + + NQ+IR+GWL++   + +   + E+WFIL AESL+WYKDE+E EKK+++ L+NL+++D +      K   +++N + + NV+KD + ++LA   + ++DSWKA+FLRAGVYPE      + +E+ +EN    D  LERQVE +RNLV SYI I+     D +PK + H +I+  ++F++++L++ L S  + + LMEES +  QRRED+LR+Y ALK  LKII ++ T+T + P PPPV + W + +N      V  R VS       PPA+ G  P   ++P P
Sbjct:    3 NRGMEELIPLVNKLQDAFSSIGQACNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVWQEIEAETDRVTGTNKGISPVPINLRVYSPNVLNLTLIDLPGITKVPVGDQPHDIEYQIKDMILQFISRDSCLILAVTPGNTDLANSDALKMAKEVDPQGLRTIGVITKLDLMDEGTDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDIKAALGAERKFFLSHPGYRHIAERMGTPHLQKTLNQQLTNHIRETLPALRNKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDMAFEAIVKKQVVKLKEPCLKCVDMVIQELINTVRQCTAKLLSYPKLREETERIVTTYIREREGKTKDQILLLIDIELSYINTNHEDFIGFANAQQRSSQLNKKRAVPNQVIRRGWLTINNISIMKGGSKEYWFILTAESLSWYKDEEEKEKKYMLPLDNLKIRDIEKGFMSTKHIFAIFNTEQR-NVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQVIPSEEEETQENTFSMDPQLERQVETIRNLVDSYICIVNKSIRDLMPKTIMHLMINNSKDFIHSELLAYLYSSADQNSLMEESADQAQRREDMLRMYHALKEALKIIGDISTSTATTPVPPPVDDTWLQNSNSEKPEDVQRRPVSTVLPPSRPPAVRGPTPGPPLIPVP 796          
BLAST of Dynamin 2 vs. Ensembl Mouse
Match: Dnm3 (dynamin 3 [Source:MGI Symbol;Acc:MGI:1341299])

HSP 1 Score: 957.977 bits (2475), Expect = 0.000e+0
Identity = 471/801 (58.80%), Postives = 616/801 (76.90%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNPVK--NMGNQIIRKGWLSLATATSLTKKNE-FWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPET----NDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW-------PKANGFTESRVN-----PRRVSAASNRAP-PAIPGSKPNNMLP 2474
            N EME+LIPLVN+LQDAF+  G S  ++LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL+ S  E AEFLH +GKKFTDFD+VR EIE ETDRVTG NKG+SSIPINL+VYSPHVLNLTLIDLPGITKVPVGDQP DIE QIR MI++FIT EN +ILAV+PAN+DLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR++LEN+LLPLRRGY+G+VNRSQKDI+G+KDI+ AM  ERKFF SHP+Y H+A++MGT +LQKVLNQQL NHIRDTLP+ RNK+Q QL++IE +VE FKN KP DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG KIN++FHE FP+EI K +F+EK+LR+EI  AIKNIHG+RTGLFTPDMAFEAIVK QI  L+ PS+K +D V+ EL++ +++   +++++PRL +  ER V   +R ++ +TKDQ+ +LI IQ+SYINTNHEDFIGF NA +++    K   +GNQ+IRKGWL+++    +   ++ +WF+L AESL+WYKD++E EKK+++ L+NL+++D +      K   +L+N + + NV+KD++ L+LA   + ++DSWKA+ LRAGVYP+     NDE+G+  +   D  LERQVE +RNLV SY++II     D +PK + H +I+ V++F+N++L++ L S E+ + LMEES E  QRR+++LR+Y+ALK  L II ++ TATVS PAPPPV + W       P  +  T+ R+      PR     S R P PAIP   P++  P
Sbjct:    3 NREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVTSKAEYAEFLHCKGKKFTDFDEVRHEIEAETDRVTGMNKGISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIRDMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKLQGQLLSIEHEVEAFKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGAKINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKLKGPSLKSVDLVMQELINTVKKCTKRLANFPRLCEETERIVANHIREREGKTKDQVLLLIDIQVSYINTNHEDFIGFANAQQRSSQVHKKSTIGNQVIRKGWLTVSNIGIMKGGSKGYWFVLTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKGFMSSKHVFALFNTEQR-NVYKDYRFLELACDSQEDVDSWKASLLRAGVYPDKSVTENDENGQAENFSMDPQLERQVETIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESAEQAQRRDEMLRMYQALKEALAIIGDINTATVSTPAPPPVDDSWLQHSRRSPPPSPTTQRRLTISAPLPR---PTSGRGPAPAIPSPGPHSGAP 799          
BLAST of Dynamin 2 vs. Ensembl Mouse
Match: Dnm3 (dynamin 3 [Source:MGI Symbol;Acc:MGI:1341299])

HSP 1 Score: 956.051 bits (2470), Expect = 0.000e+0
Identity = 471/805 (58.51%), Postives = 616/805 (76.52%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNPVK--NMGNQIIRKGWLSLATATSLTKKNE-FWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPET--------NDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW-------PKANGFTESRVN-----PRRVSAASNRAP-PAIPGSKPNNMLP 2474
            N EME+LIPLVN+LQDAF+  G S  ++LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL+ S  E AEFLH +GKKFTDFD+VR EIE ETDRVTG NKG+SSIPINL+VYSPHVLNLTLIDLPGITKVPVGDQP DIE QIR MI++FIT EN +ILAV+PAN+DLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR++LEN+LLPLRRGY+G+VNRSQKDI+G+KDI+ AM  ERKFF SHP+Y H+A++MGT +LQKVLNQQL NHIRDTLP+ RNK+Q QL++IE +VE FKN KP DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG KIN++FHE FP+EI K +F+EK+LR+EI  AIKNIHG+RTGLFTPDMAFEAIVK QI  L+ PS+K +D V+ EL++ +++   +++++PRL +  ER V   +R ++ +TKDQ+ +LI IQ+SYINTNHEDFIGF NA +++    K   +GNQ+IRKGWL+++    +   ++ +WF+L AESL+WYKD++E EKK+++ L+NL+++D +      K   +L+N + + NV+KD++ L+LA   + ++DSWKA+ LRAGVYP+         NDE+G+  +   D  LERQVE +RNLV SY++II     D +PK + H +I+ V++F+N++L++ L S E+ + LMEES E  QRR+++LR+Y+ALK  L II ++ TATVS PAPPPV + W       P  +  T+ R+      PR     S R P PAIP   P++  P
Sbjct:    3 NREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVTSKAEYAEFLHCKGKKFTDFDEVRHEIEAETDRVTGMNKGISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIRDMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKLQGQLLSIEHEVEAFKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGAKINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKLKGPSLKSVDLVMQELINTVKKCTKRLANFPRLCEETERIVANHIREREGKTKDQVLLLIDIQVSYINTNHEDFIGFANAQQRSSQVHKKSTIGNQVIRKGWLTVSNIGIMKGGSKGYWFVLTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKGFMSSKHVFALFNTEQR-NVYKDYRFLELACDSQEDVDSWKASLLRAGVYPDKSVGKRKTENDENGQAENFSMDPQLERQVETIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESAEQAQRRDEMLRMYQALKEALAIIGDINTATVSTPAPPPVDDSWLQHSRRSPPPSPTTQRRLTISAPLPR---PTSGRGPAPAIPSPGPHSGAP 803          
BLAST of Dynamin 2 vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 952.97 bits (2462), Expect = 0.000e+0
Identity = 457/788 (57.99%), Postives = 602/788 (76.40%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQIIRKGWLSLATATSLTKKN-EFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE---------TNDEDGEENH-EPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNPRRVSAASNRAPPAIPGSK 2456
            N  ME LIPLVN+LQDAF+  G +  +DLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL+NS TE AEFLH +GKKFTDF++VR EIE ETDRVTG NKG+S +PINL+VYSPHVLNLTL+DLPG+TKVPVGDQP DIE QIR M+++F+T EN +ILAVSPANSDLANSDALK+AK+VDPQG RTIGVITKLDLMD+GTDAR++LEN+LLPLRRGYIG+VNRSQKDI+G+KDI  A+  ERKFF SHPSY H+A++MGT YLQKVLNQQL NHIRDTLP LRNK+Q+QL++IEK+V+E+KN +P DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK+LR+EI  AIKNIHG+RTGLFTPDMAFE IVK Q+K + EP +KC+D V+SEL+  +R+   K+  YPRL++ +ER V   +R ++ RTK+Q+ +LI I+L+Y+NTNHEDFIGF NA ++++  N  K  GNQ+IRKGWL++     +   + E+WF+L AE+L+WYKD++E EKK++++++NL+L+D +      K   +L+N + + NV+KD++ L+LA   +  +DSWKA+FLRAGVYPE           +E+G ++     D  LERQVE +RNLV SY+ I+     D +PK + H +I+  +EF+ ++L++ L S  + + LMEES E  QRR+++LR+Y ALK  L II ++ T TVS P PPPV + W +       R +P        RA PA+P ++
Sbjct:    3 NRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQR-NVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRA-PAVPPAR 788          
BLAST of Dynamin 2 vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 949.888 bits (2454), Expect = 0.000e+0
Identity = 459/792 (57.95%), Postives = 604/792 (76.26%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQ----IIRKGWLSLATATSLTKKN-EFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE---------TNDEDGEENH-EPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNPRRVSAASNRAPPAIPGSK 2456
            N  ME LIPLVN+LQDAF+  G +  +DLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL+NS TE AEFLH +GKKFTDF++VR EIE ETDRVTG NKG+S +PINL+VYSPHVLNLTL+DLPG+TKVPVGDQP DIE QIR M+++F+T EN +ILAVSPANSDLANSDALK+AK+VDPQG RTIGVITKLDLMD+GTDAR++LEN+LLPLRRGYIG+VNRSQKDI+G+KDI  A+  ERKFF SHPSY H+A++MGT YLQKVLNQQL NHIRDTLP LRNK+Q+QL++IEK+V+E+KN +P DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK+LR+EI  AIKNIHG+RTGLFTPD+AFEA VK Q++ L+EPS+KC+D VVSEL   IR+ + K+  YPRL++ +ER V   +R ++ RTK+Q+ +LI I+L+Y+NTNHEDFIGF NA ++++  N  K  GNQ    +IRKGWL++     +   + E+WF+L AE+L+WYKD++E EKK++++++NL+L+D +      K   +L+N + + NV+KD++ L+LA   +  +DSWKA+FLRAGVYPE           +E+G ++     D  LERQVE +RNLV SY+ I+     D +PK + H +I+  +EF+ ++L++ L S  + + LMEES E  QRR+++LR+Y ALK  L II ++ T TVS P PPPV + W +       R +P        RA PA+P ++
Sbjct:    3 NRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTSTIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQR-NVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRA-PAVPPAR 792          
BLAST of Dynamin 2 vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 949.118 bits (2452), Expect = 0.000e+0
Identity = 459/792 (57.95%), Postives = 604/792 (76.26%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQ----IIRKGWLSLATATSLTKKN-EFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE---------TNDEDGEENH-EPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNPRRVSAASNRAPPAIPGSK 2456
            N  ME LIPLVN+LQDAF+  G +  +DLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL+NS TE AEFLH +GKKFTDF++VR EIE ETDRVTG NKG+S +PINL+VYSPHVLNLTL+DLPG+TKVPVGDQP DIE QIR M+++F+T EN +ILAVSPANSDLANSDALK+AK+VDPQG RTIGVITKLDLMD+GTDAR++LEN+LLPLRRGYIG+VNRSQKDI+G+KDI  A+  ERKFF SHPSY H+A++MGT YLQKVLNQQL NHIRDTLP LRNK+Q+QL++IEK+V+E+KN +P DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK+LR+EI  AIKNIHG+RTGLFTPD+AFEA VK Q++ L+EPS+KC+D VVSEL   IR+ + K+  YPRL++ +ER V   +R ++ RTK+Q+ +LI I+L+Y+NTNHEDFIGF NA ++++  N  K  GNQ    +IRKGWL++     +   + E+WF+L AE+L+WYKD++E EKK++++++NL+L+D +      K   +L+N + + NV+KD++ L+LA   +  +DSWKA+FLRAGVYPE           +E+G ++     D  LERQVE +RNLV SY+ I+     D +PK + H +I+  +EF+ ++L++ L S  + + LMEES E  QRR+++LR+Y ALK  L II ++ T TVS P PPPV + W +       R +P        RA PA+P ++
Sbjct:    3 NRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTSTIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQR-NVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRA-PAVPPAR 792          
BLAST of Dynamin 2 vs. UniProt/SwissProt
Match: sp|Q8BZ98|DYN3_MOUSE (Dynamin-3 OS=Mus musculus OX=10090 GN=Dnm3 PE=1 SV=1)

HSP 1 Score: 956.051 bits (2470), Expect = 0.000e+0
Identity = 471/805 (58.51%), Postives = 616/805 (76.52%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNPVK--NMGNQIIRKGWLSLATATSLTKKNE-FWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPET--------NDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW-------PKANGFTESRVN-----PRRVSAASNRAP-PAIPGSKPNNMLP 2474
            N EME+LIPLVN+LQDAF+  G S  ++LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL+ S  E AEFLH +GKKFTDFD+VR EIE ETDRVTG NKG+SSIPINL+VYSPHVLNLTLIDLPGITKVPVGDQP DIE QIR MI++FIT EN +ILAV+PAN+DLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR++LEN+LLPLRRGY+G+VNRSQKDI+G+KDI+ AM  ERKFF SHP+Y H+A++MGT +LQKVLNQQL NHIRDTLP+ RNK+Q QL++IE +VE FKN KP DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG KIN++FHE FP+EI K +F+EK+LR+EI  AIKNIHG+RTGLFTPDMAFEAIVK QI  L+ PS+K +D V+ EL++ +++   +++++PRL +  ER V   +R ++ +TKDQ+ +LI IQ+SYINTNHEDFIGF NA +++    K   +GNQ+IRKGWL+++    +   ++ +WF+L AESL+WYKD++E EKK+++ L+NL+++D +      K   +L+N + + NV+KD++ L+LA   + ++DSWKA+ LRAGVYP+         NDE+G+  +   D  LERQVE +RNLV SY++II     D +PK + H +I+ V++F+N++L++ L S E+ + LMEES E  QRR+++LR+Y+ALK  L II ++ TATVS PAPPPV + W       P  +  T+ R+      PR     S R P PAIP   P++  P
Sbjct:    3 NREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVTSKAEYAEFLHCKGKKFTDFDEVRHEIEAETDRVTGMNKGISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIRDMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKLQGQLLSIEHEVEAFKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGAKINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKLKGPSLKSVDLVMQELINTVKKCTKRLANFPRLCEETERIVANHIREREGKTKDQVLLLIDIQVSYINTNHEDFIGFANAQQRSSQVHKKSTIGNQVIRKGWLTVSNIGIMKGGSKGYWFVLTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKGFMSSKHVFALFNTEQR-NVYKDYRFLELACDSQEDVDSWKASLLRAGVYPDKSVGSNKTENDENGQAENFSMDPQLERQVETIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESAEQAQRRDEMLRMYQALKEALAIIGDINTATVSTPAPPPVDDSWLQHSRRSPPPSPTTQRRLTISAPLPR---PTSGRGPAPAIPSPGPHSGAP 803          
BLAST of Dynamin 2 vs. UniProt/SwissProt
Match: sp|Q08877|DYN3_RAT (Dynamin-3 OS=Rattus norvegicus OX=10116 GN=Dnm3 PE=1 SV=2)

HSP 1 Score: 952.97 bits (2462), Expect = 0.000e+0
Identity = 470/811 (57.95%), Postives = 619/811 (76.33%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNPVK--NMGNQ----------IIRKGWLSLATATSLTKKNE-FWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPET----NDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW-------PKANGFTESRVN-----PRRVSAASNRAP-PAIPGSKPNNMLP 2474
            N EME+LIPLVN+LQDAF+  G S  ++LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL+ S  E AEFLH +GKKFTDFD+VR EIE ETDRVTG NKG+SS+PINL+VYSPHVLNLTLIDLPGITKVPVGDQP DIE QIR MI++FIT EN +ILAV+PAN+DLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR++LEN+LLPLRRGY+G+VNRSQKDI+G+KDI+ AM  ERKFF SHP+Y H+A++MGT +LQKVLNQQL NHIRDTLP+ RNK+Q QL++IE +VE FKN KP DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG KIN++FHE FP+EI K +F+EK+LR+EI  AIKNIHG+RTGLFTPDMAFEAIVK QI  L+ PS+K +D V+ EL++ +++   +++++PRL +  ER V   +R ++ +TKDQ+ +LI IQ+SYINTNHEDFIGF NA +++    K   +GNQ          +IRKGWL+++    +   ++ +WF+L AESL+WYKD++E EKK+++ L+NL+++D +      K   +L+N + + NV+KD+++L+LA   + ++DSWKA+ LRAGVYP+     NDE+G+  +   D  LERQVE +RNLV SY++II     D +PK + H +I+ V++F+N++L++ L S E+ + LMEES+E  QRR+++LR+Y+ALK  L II ++ T TVS PAPPPV + W       P  +  T+ R+      PR    AS+R P PAIP   P++  P
Sbjct:    3 NREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVTSKAEYAEFLHCKGKKFTDFDEVRHEIEAETDRVTGMNKGISSVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIRDMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKLQGQLLSIEHEVEAFKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGAKINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKLKGPSLKSVDLVMQELINTVKKCTKRLANFPRLCEETERIVANHIREREGKTKDQVLLLIDIQVSYINTNHEDFIGFANAQQRSSQVHKKSTIGNQGTNLPPSRQIVIRKGWLTVSNIGIMKGGSKGYWFVLTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKGFMSSKHVFALFNTEQR-NVYKDYRSLELACDSQEDVDSWKASLLRAGVYPDKSFTENDENGQAENFSMDPQLERQVETIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESVEQAQRRDEMLRMYQALKEALAIIGDINTVTVSTPAPPPVDDSWLQHSRRSPPPSPTTQRRLTLSAPLPR---PASSRGPAPAIPSPGPHSGAP 809          
BLAST of Dynamin 2 vs. UniProt/SwissProt
Match: sp|Q9UQ16|DYN3_HUMAN (Dynamin-3 OS=Homo sapiens OX=9606 GN=DNM3 PE=1 SV=4)

HSP 1 Score: 951.429 bits (2458), Expect = 0.000e+0
Identity = 469/808 (58.04%), Postives = 615/808 (76.11%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNPVK--NMGNQ----------IIRKGWLSLATATSLTKKNE-FWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPET----NDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW-------PKANGFTESR--VNPRRVSAASNRAP-PAIPGSKPNNMLP 2474
            N EME+LIPLVN+LQDAF+  G S  ++LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL+ S  E AEFLH +GKKFTDFD+VR EIE ETDRVTG NKG+SSIPINL+VYSPHVLNLTLIDLPGITKVPVGDQP DIE QIR MI++FIT EN +ILAV+PAN+DLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR++LEN+LLPLRRGY+G+VNRSQKDI+G+KDI+ AM  ERKFF SHP+Y H+A++MGT +LQKVLNQQL NHIRDTLP+ RNK+Q QL++IE +VE +KN KP DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG KIN++FHE FP+EI K +F+EK+LR+EI  AIKNIHG+RTGLFTPDMAFEAIVK QI  L+ PS+K +D V+ EL++ +++   K++++PRL +  ER V   +R ++ +TKDQ+ +LI IQ+SYINTNHEDFIGF NA +++    K   +GNQ          +IRKGWL+++    +   ++ +WF+L AESL+WYKD++E EKK+++ L+NL+++D +      K   +L+N + + NV+KD++ L+LA   + ++DSWKA+ LRAGVYP+     NDE+G+  +   D  LERQVE +RNLV SY++II     D +PK + H +I+ V++F+N++L++ L S E+ + LMEES E  QRR+++LR+Y+ALK  L II ++ TATVS PAPPPV + W       P  +  T+ R  ++       S R P PAIP   P++  P
Sbjct:    3 NREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKLQGQLLSIEHEVEAYKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGAKINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKLKGPSLKSVDLVIQELINTVKKCTKKLANFPRLCEETERIVANHIREREGKTKDQVLLLIDIQVSYINTNHEDFIGFANAQQRSSQVHKKTTVGNQGTNLPPSRQIVIRKGWLTISNIGIMKGGSKGYWFVLTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFALFNTEQR-NVYKDYRFLELACDSQEDVDSWKASLLRAGVYPDKSVAENDENGQAENFSMDPQLERQVETIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESAEQAQRRDEMLRMYQALKEALGIIGDISTATVSTPAPPPVDDSWIQHSRRSPPPSPTTQRRPTLSAPLARPTSGRGPAPAIPSPGPHSGAP 809          
BLAST of Dynamin 2 vs. UniProt/SwissProt
Match: sp|P21575|DYN1_RAT (Dynamin-1 OS=Rattus norvegicus OX=10116 GN=Dnm1 PE=1 SV=2)

HSP 1 Score: 949.888 bits (2454), Expect = 0.000e+0
Identity = 459/792 (57.95%), Postives = 604/792 (76.26%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQ----IIRKGWLSLATATSLTKKN-EFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE---------TNDEDGEENH-EPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNPRRVSAASNRAPPAIPGSK 2456
            N  ME LIPLVN+LQDAF+  G +  +DLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL+NS TE AEFLH +GKKFTDF++VR EIE ETDRVTG NKG+S +PINL+VYSPHVLNLTL+DLPG+TKVPVGDQP DIE QIR M+++F+T EN +ILAVSPANSDLANSDALK+AK+VDPQG RTIGVITKLDLMD+GTDAR++LEN+LLPLRRGYIG+VNRSQKDI+G+KDI  A+  ERKFF SHPSY H+A++MGT YLQKVLNQQL NHIRDTLP LRNK+Q+QL++IEK+V+E+KN +P DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK+LR+EI  AIKNIHG+RTGLFTPD+AFEA VK Q++ L+EPS+KC+D VVSEL   IR+ + K+  YPRL++ +ER V   +R ++ RTK+Q+ +LI I+L+Y+NTNHEDFIGF NA ++++  N  K  GNQ    +IRKGWL++     +   + E+WF+L AE+L+WYKD++E EKK++++++NL+L+D +      K   +L+N + + NV+KD++ L+LA   +  +DSWKA+FLRAGVYPE           +E+G ++     D  LERQVE +RNLV SY+ I+     D +PK + H +I+  +EF+ ++L++ L S  + + LMEES E  QRR+++LR+Y ALK  L II ++ T TVS P PPPV + W +       R +P        RA PA+P ++
Sbjct:    3 NRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTSTIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQR-NVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRA-PAVPPAR 792          
BLAST of Dynamin 2 vs. UniProt/SwissProt
Match: sp|Q08DF4|DYN1_BOVIN (Dynamin-1 OS=Bos taurus OX=9913 GN=DNM1 PE=2 SV=1)

HSP 1 Score: 948.732 bits (2451), Expect = 0.000e+0
Identity = 459/792 (57.95%), Postives = 604/792 (76.26%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQ----IIRKGWLSLATATSLTKKN-EFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE---------TNDEDGEENH-EPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNPRRVSAASNRAPPAIPGSK 2456
            N  ME LIPLVN+LQDAF+  G +  +DLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL+N+ TE AEFLH +GKKFTDF++VR EIE ETDRVTG NKG+S +PINL+VYSPHVLNLTL+DLPG+TKVPVGDQP DIE QIR M+++F+T EN +ILAVSPANSDLANSDALK+AK+VDPQG RTIGVITKLDLMD+GTDAR++LEN+LLPLRRGYIG+VNRSQKDI+G+KDI  A+  ERKFF SHPSY H+A++MGT YLQKVLNQQL NHIRDTLP LRNK+Q+QL++IEK+VEE+KN +P DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK+LR+EI  AIKNIHG+RTGLFTPD+AFEA VK Q++ L+EPS+KC+D VVSEL   IR+ + K+  YPRL++ +ER V   +R ++ RTK+Q+ +LI I+L+Y+NTNHEDFIGF NA ++++  N  K  GNQ    +IRKGWL++     +   + E+WF+L AE+L+WYKD++E EKK++++++NL+L+D +      K   +L+N + + NV+KD++ L+LA   +  +DSWKA+FLRAGVYPE           +E+G ++     D  LERQVE +RNLV SY+ I+     D +PK + H +I+  +EF+ ++L++ L S  + + LMEES E  QRR+++LR+Y ALK  L II ++ T TVS P PPPV + W +       R +P        RA PA+P ++
Sbjct:    3 NRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTATIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKASGNQDEILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQR-NVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPTGRRSPTSSPTPQRRA-PAVPPAR 792          
BLAST of Dynamin 2 vs. TrEMBL
Match: A0A4W6FJ53 (Uncharacterized protein OS=Lates calcarifer OX=8187 GN=LOC108894323 PE=3 SV=1)

HSP 1 Score: 964.526 bits (2492), Expect = 0.000e+0
Identity = 457/760 (60.13%), Postives = 600/760 (78.95%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQIIRKGWLSLATATSLT-KKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPETNDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNP 2402
            N  ME+LIPLVNQLQDAF+  G + ++DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP +LQLIN PTE AEFLH +GKKFTDFD+VR+EIE ETDRVTG NKG+S +PINL+VYSP+VLNLTL+DLPG+TKVPVGDQP DIE QIR M+L+F+T +N ++LAVSPANSDLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR+ILEN+LLPLRRGYIG+VNRSQKDI+G+KDI  A++ ERKFF SHPSY H+A++MGT YLQK+LNQQL NHIRDTLP LR+K+Q+QL++IEK+VEE+KN +P DPS K K+L+    +F  DF+K +EG+G   DT +L+GG KIN++FHE FP+E+ K + DEK LRKEI  AIKNIHG+RTGLFTPDMAFE IVK QI  ++EP  KC+D V+SEL++ +R+   K++ YP L++ +ER V Q +R+++SRTKDQ+ +LI I+L+Y+NTNHEDFIGF NA +K+   +  K  GNQ+IRKGWL++     +     E+WF+L AE+L+WYKD++E EKK+++ ++NL+LKD +      K   +L+N +++ NV+KD++ L+LA+  +  +DSWKA+FLRAGVYPE  + + E+     D  LERQVEIVRNLV SY++II     D +PK + H +++  +EF++ DL++ L S  + + LMEES E  Q R+++LR+Y AL+ GL II ++ T+T++   PPPV + W +  G    R +P
Sbjct:    3 NRGMEELIPLVNQLQDAFSSIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRVTGHNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIRDMLLQFVTKDNCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDITAALQAERKFFLSHPSYRHLADRMGTAYLQKILNQQLTNHIRDTLPGLRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFAVDFEKRIEGSGDQVDTYELSGGAKINRIFHERFPFELVKLESDEKTLRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIAQIKEPCQKCVDMVISELVNTVRQCTQKLAQYPMLREEMERIVTQHIRDRESRTKDQVMLLIDIELAYMNTNHEDFIGFANAQQKSSQMSKKKAAGNQVIRKGWLTINNIGIMKGGAKEYWFVLTAETLSWYKDDEEKEKKYMLPVDNLKLKDIEKSFMSSKHIFALFNTEHR-NVYKDYRQLELASESQEEVDSWKASFLRAGVYPEQEERETED----LDPQLERQVEIVRNLVDSYLSIIHRTVRDLIPKTIMHLMVNNTKEFIHADLLAQLYSCGDQNSLMEESQEQAQHRDEMLRMYHALRTGLSIIGDISTSTITTAMPPPVDDSWLQVTGMPSGRRSP 757          
BLAST of Dynamin 2 vs. TrEMBL
Match: A0A4W6FKT5 (Uncharacterized protein OS=Lates calcarifer OX=8187 GN=LOC108894323 PE=3 SV=1)

HSP 1 Score: 961.444 bits (2484), Expect = 0.000e+0
Identity = 457/769 (59.43%), Postives = 599/769 (77.89%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQIIRKGWLSLATATSLT-KKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYP---------ETNDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNP 2402
            N  ME+LIPLVNQLQDAF+  G + ++DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP +LQLIN PTE AEFLH +GKKFTDFD+VR+EIE ETDRVTG NKG+S +PINL+VYSP+VLNLTL+DLPG+TKVPVGDQP DIE QIR M+L+F+T +N ++LAVSPANSDLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR+ILEN+LLPLRRGYIG+VNRSQKDI+G+KDI  A++ ERKFF SHPSY H+A++MGT YLQK+LNQQL NHIRDTLP LR+K+Q+QL++IEK+VEE+KN +P DPS K K+L+    +F  DF+K +EG+G   DT +L+GG KIN++FHE FP+E+ K + DEK LRKEI  AIKNIHG+RTGLFTPDMAFE IVK QI  ++EP  KC+D V+SEL++ +R+   K++ YP L++ +ER V Q +R+++SRTKDQ+ +LI I+L+Y+NTNHEDFIGF NA +K+   +  K  GNQ+IRKGWL++     +     E+WF+L AE+L+WYKD++E EKK+++ ++NL+LKD +      K   +L+N +++ NV+KD++ L+LA+  +  +DSWKA+FLRAGVYP         E  +  G+      D  LERQVEIVRNLV SY++II     D +PK + H +++  +EF++ DL++ L S  + + LMEES E  Q R+++LR+Y AL+ GL II ++ T+T++   PPPV + W +  G    R +P
Sbjct:    3 NRGMEELIPLVNQLQDAFSSIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRVTGHNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIRDMLLQFVTKDNCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDITAALQAERKFFLSHPSYRHLADRMGTAYLQKILNQQLTNHIRDTLPGLRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFAVDFEKRIEGSGDQVDTYELSGGAKINRIFHERFPFELVKLESDEKTLRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIAQIKEPCQKCVDMVISELVNTVRQCTQKLAQYPMLREEMERIVTQHIRDRESRTKDQVMLLIDIELAYMNTNHEDFIGFANAQQKSSQMSKKKAAGNQVIRKGWLTINNIGIMKGGAKEYWFVLTAETLSWYKDDEEKEKKYMLPVDNLKLKDIEKSFMSSKHIFALFNTEHR-NVYKDYRQLELASESQEEVDSWKASFLRAGVYPERSVDKEKVEVEESSGDGQIHSLDPQLERQVEIVRNLVDSYLSIIHRTVRDLIPKTIMHLMVNNTKEFIHADLLAQLYSCGDQNSLMEESQEQAQHRDEMLRMYHALRTGLSIIGDISTSTITTAMPPPVDDSWLQVTGMPSGRRSP 770          
BLAST of Dynamin 2 vs. TrEMBL
Match: A0A3Q3MNF5 (Uncharacterized protein OS=Mastacembelus armatus OX=205130 PE=3 SV=1)

HSP 1 Score: 961.059 bits (2483), Expect = 0.000e+0
Identity = 456/765 (59.61%), Postives = 598/765 (78.17%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQIIRKGWLSLATATSLT-KKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYP-----ETNDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNP 2402
            N  ME+LIPLVNQLQDAF+  G + ++DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP +LQLIN PTE AEFLH +GKKFTDFD+VR+EIE ETDRVTG NKG+S +PINL+VYSP+VLNLTL+DLPG+TKVPVGDQP DIE QI+ M+++F+T +N ++LAVSPANSDLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR+ILEN+LLPLRRGYIG+VNRSQKDI+G+KDI  A++ ERKFF SH +Y HMA++MGT YLQKVLNQQL NHIRDTLP LR+K+Q+QL++IEK+VEE+KN +P DPS K K+L+    +F  DF+K +EG+G   DT +L+GG KIN++FHE FP+E+ K + DEK LRKEI  AIKNIHG+RTGLFTPDMAFE IVK QI  ++EP  KC+D V+SEL++ +R+   K++ YP L++ +ER V Q +R+++SRTKDQ+ +LI I+L+Y+NTNHEDFIGF NA +K+   N  K  GNQ+IRKGWL++     +     E+WF+L AE+L+WYKD++E EKK+++ ++NL+LKD +      K   +L+N +++ NV+KD++ L+LA+  +  +DSWKA+FLRAGVYP     E  +  G+      D  LERQVEIVRNLV SY++II     D +PK + H +++  +EF+++DL++ L S  + + LMEES E  Q R+++LR+Y AL+ GL II ++ T T++   PPPV + W +  G    R +P
Sbjct:    3 NRGMEELIPLVNQLQDAFSSIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRVTGHNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIKDMLMQFVTKDNCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDISAALQAERKFFLSHSAYRHMADRMGTAYLQKVLNQQLTNHIRDTLPGLRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFAVDFEKRIEGSGDQVDTYELSGGAKINRIFHERFPFELVKLESDEKTLRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIAQIKEPCQKCVDMVISELVNTVRQCTQKLAQYPMLREEMERIVTQHIRDRESRTKDQVMLLIDIELAYMNTNHEDFIGFANAQQKSSQMNKKKATGNQVIRKGWLTINNIGIMKGGAKEYWFVLTAETLSWYKDDEEKEKKYMLPVDNLKLKDIEKSFMSSKHIFALFNTEHR-NVYKDYRQLELASESQEEVDSWKASFLRAGVYPERSVVEVEESSGDGQIHSLDPQLERQVEIVRNLVDSYLSIIHRTVRDLIPKTIMHLMVNNTKEFIHSDLLAQLYSCGDQNSLMEESQEQAQHRDEMLRMYHALREGLSIIGDISTTTITTAMPPPVDDSWLQVTGMPSGRRSP 766          
BLAST of Dynamin 2 vs. TrEMBL
Match: A0A4W6FLJ3 (Uncharacterized protein OS=Lates calcarifer OX=8187 GN=LOC108894323 PE=3 SV=1)

HSP 1 Score: 960.674 bits (2482), Expect = 0.000e+0
Identity = 455/759 (59.95%), Postives = 597/759 (78.66%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQIIRKGWLSLATATSLT-KKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYP-----ETNDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFT 2384
            N  ME+LIPLVNQLQDAF+  G + ++DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP +LQLIN PTE AEFLH +GKKFTDFD+VR+EIE ETDRVTG NKG+S +PINL+VYSP+VLNLTL+DLPG+TKVPVGDQP DIE QIR M+L+F+T +N ++LAVSPANSDLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR+ILEN+LLPLRRGYIG+VNRSQKDI+G+KDI  A++ ERKFF SHPSY H+A++MGT YLQK+LNQQL NHIRDTLP LR+K+Q+QL++IEK+VEE+KN +P DPS K K+L+    +F  DF+K +EG+G   DT +L+GG KIN++FHE FP+E+ K + DEK LRKEI  AIKNIHG+RTGLFTPDMAFE IVK QI  ++EP  KC+D V+SEL++ +R+   K++ YP L++ +ER V Q +R+++SRTKDQ+ +LI I+L+Y+NTNHEDFIGF NA +K+   +  K  GNQ+IRKGWL++     +     E+WF+L AE+L+WYKD++E EKK+++ ++NL+LKD +      K   +L+N +++ NV+KD++ L+LA+  +  +DSWKA+FLRAGVYP     E  +  G+      D  LERQVEIVRNLV SY++II     D +PK + H +++  +EF++ DL++ L S  + + LMEES E  Q R+++LR+Y AL+ GL II ++ T+T++   PPPV + W +  G +
Sbjct:    3 NRGMEELIPLVNQLQDAFSSIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRVTGHNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIRDMLLQFVTKDNCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDITAALQAERKFFLSHPSYRHLADRMGTAYLQKILNQQLTNHIRDTLPGLRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFAVDFEKRIEGSGDQVDTYELSGGAKINRIFHERFPFELVKLESDEKTLRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIAQIKEPCQKCVDMVISELVNTVRQCTQKLAQYPMLREEMERIVTQHIRDRESRTKDQVMLLIDIELAYMNTNHEDFIGFANAQQKSSQMSKKKAAGNQVIRKGWLTINNIGIMKGGAKEYWFVLTAETLSWYKDDEEKEKKYMLPVDNLKLKDIEKSFMSSKHIFALFNTEHR-NVYKDYRQLELASESQEEVDSWKASFLRAGVYPERSVVEVEESSGDGQIHSLDPQLERQVEIVRNLVDSYLSIIHRTVRDLIPKTIMHLMVNNTKEFIHADLLAQLYSCGDQNSLMEESQEQAQHRDEMLRMYHALRTGLSIIGDISTSTITTAMPPPVDDSWLQVTGMS 760          
BLAST of Dynamin 2 vs. TrEMBL
Match: A0A2K5QV25 (Dynamin 3 OS=Cebus capucinus imitator OX=1737458 GN=DNM3 PE=3 SV=1)

HSP 1 Score: 960.288 bits (2481), Expect = 0.000e+0
Identity = 469/797 (58.85%), Postives = 615/797 (77.16%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNPVK--NMGNQIIRKGWLSLATATSLTKKNE-FWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPET--------NDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW--PKANGFTESR--VNPRRVSAASNRAP-PAIPGSKPNNMLP 2474
            N EME+LIPLVN+LQDAF+  G S  ++LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL+ S  E AEFLH +GKKFTDFD+VR EIE ETDRVTG NKG+SSIPINL+VYSPHVLNLTLIDLPGITKVPVGDQP DIE QIR MI++FIT EN +ILAV+PAN+DLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR++LEN+LLPLRRGY+G+VNRSQKDI+G+KDI+ AM  ERKFF SHP+Y H+A++MGT +LQKVLNQQL NHIRDTLP+ RNK+Q QL++IE +VE +KN KP DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG KIN++FHE FP+EI K +F+EK+LR+EI  AIKNIHG+RTGLFTPDMAFEAIVK QI  L+ PS+K +D V+ EL++ +++   K++++PRL +  ER V   +R ++ +TKDQ+ +LI IQ+SYINTNHEDFIGF NA +++    K   +GNQ+IRKGWL+++    +   ++ +WF+L AESL+WYKD++E EKK+++ L+NL+++D +      K   +L+N + + NV+KD++ L+LA   + ++DSWKA+ LRAGVYP+         NDE+G+  +   D  LERQVE +RNLV SY++II     D +PK + H +I+ V++F+N++L++ L S E+ + LMEES E  QRR+++LR+Y+ALK  L II ++ TATVS PAPPPV + W  P  +  T+ R  ++       S R P PAIP   P++  P
Sbjct:    3 NREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVTSKAEYAEFLHCKGKKFTDFDEVRHEIEAETDRVTGMNKGISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKLQGQLLSIEHEVEAYKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGAKINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKLKGPSLKSVDLVIQELINTVKKCTKKLANFPRLCEETERIVANHIREREGKTKDQVLLLIDIQVSYINTNHEDFIGFANAQQRSSQVHKKTTIGNQVIRKGWLTISNIGIMKGGSKGYWFVLTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFALFNTEQR-NVYKDYRFLELACDSQEDVDSWKASLLRAGVYPDKSAGNNKAENDENGQAENFSMDPQLERQVETIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESAEQAQRRDEMLRMYQALKEALGIIGDISTATVSTPAPPPVDDSWISPPPSPTTQRRPTLSAPLTRPTSGRGPAPAIPSPGPHSGAP 798          
BLAST of Dynamin 2 vs. Ensembl Cavefish
Match: dnm1a (dynamin-1 [Source:NCBI gene;Acc:103024863])

HSP 1 Score: 946.036 bits (2444), Expect = 0.000e+0
Identity = 449/752 (59.71%), Postives = 586/752 (77.93%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQIIRKGWLSLATATSLT-KKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPETNDEDGEENHEPK-----DSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW 2363
            N  ME LIPLVN++QDAF+  G + ++DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP +LQLIN PTE AEFLH +GKKFTDFD+VR+EIE ETDRVTG+NKG+S +PINL+VYSP+VLNLTL+DLPG+TKVPVGDQP DIE QI+ M+++F+T EN ++LAVSPANSDLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR+ILEN+LLPLRRGYIG+VNRSQKDI+GRKDI  AM  ERKFF +HP Y H+A++MGT YLQK LNQQL NHIRDTLP LR+K+Q+QL++IEK+VEE+KN +P DPS K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK+LRKEI  AIKNIHG+RTGLFTPDMAFE IVK QI   +EP  KC+D V+SEL++ +R+   K++ YP L++ +ER V Q +R+++SRTKDQ+ +LI I+L+Y+NTNHEDFIGF NA +++   N  K  GNQ+IRKGWL++     +     E+WF+L AESL+WYKD++E EKK+++ ++NL+L+D +      K   +L+N + + NV+KD++ L+LA   + ++D WKA+FLRAGVY E   +  EEN         D  LERQVE +RNLV SY+ I+     D +PK + H +I+  +EF+N +L++ L S  + + LMEES E  Q R+++LR+Y AL+  L II ++ T T+S   PPPV + W
Sbjct:    3 NRGMEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRVTGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIKEMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDINAAMAAERKFFLTHPGYRHLADRMGTPYLQKTLNQQLTNHIRDTLPGLRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFSVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQILKNKEPCQKCVDMVISELVNTVRQCTKKLAQYPMLREEMERIVTQHIRDRESRTKDQVMLLIDIELAYMNTNHEDFIGFANAQQRSSQINKKKAPGNQVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKLRDVEKSFMSSKHIFALFNTEQR-NVYKDYRQLELACETQEDVDGWKASFLRAGVYAERVSDTSEENGSDSFMHSMDPQLERQVETIRNLVDSYMGIVNKTVRDLMPKTIMHLMINNTKEFINAELLAQLYSCGDQNTLMEESAEQAQHRDEMLRMYHALREALSIIGDISTTTISTALPPPVDDSW 753          
BLAST of Dynamin 2 vs. Ensembl Cavefish
Match: dnm1a (dynamin-1 [Source:NCBI gene;Acc:103024863])

HSP 1 Score: 944.495 bits (2440), Expect = 0.000e+0
Identity = 452/757 (59.71%), Postives = 592/757 (78.20%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQ----IIRKGWLSLATATSLT-KKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE-----TNDEDGEENH-EPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW 2363
            N  ME LIPLVN++QDAF+  G + ++DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP +LQLIN PTE AEFLH +GKKFTDFD+VR+EIE ETDRVTG+NKG+S +PINL+VYSP+VLNLTL+DLPG+TKVPVGDQP DIE QI+ M+++F+T EN ++LAVSPANSDLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR+ILEN+LLPLRRGYIG+VNRSQKDI+GRKDI  AM  ERKFF +HP Y H+A++MGT YLQK LNQQL NHIRDTLP LR+K+Q+QL++IEK+VEE+KN +P DPS K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK+LRKEI  AIKNIHG+RTGLFTPD+AFEAIVK QI+ L+ P +KCID VVSEL   IR+ + K++ YP L++ +ER V Q +R+++SRTKDQ+ +LI I+L+Y+NTNHEDFIGF NA +++   N  K  GNQ    +IRKGWL++     +     E+WF+L AESL+WYKD++E EKK+++ ++NL+L+D +      K   +L+N + + NV+KD++ L+LA   + ++D WKA+FLRAGVY E     T++E+G ++     D  LERQVE +RNLV SY+ I+     D +PK + H +I+  +EF+N +L++ L S  + + LMEES E  Q R+++LR+Y AL+  L II ++ T T+S   PPPV + W
Sbjct:    3 NRGMEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRVTGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIKEMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDINAAMAAERKFFLTHPGYRHLADRMGTPYLQKTLNQQLTNHIRDTLPGLRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFSVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDLAFEAIVKKQIQKLKSPVLKCIDMVVSELTSTIRKCSEKLAQYPMLREEMERIVTQHIRDRESRTKDQVMLLIDIELAYMNTNHEDFIGFANAQQRSSQINKKKAPGNQDEIMVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKLRDVEKSFMSSKHIFALFNTEQR-NVYKDYRQLELACETQEDVDGWKASFLRAGVYAERVVSDTSEENGSDSFMHSMDPQLERQVETIRNLVDSYMGIVNKTVRDLMPKTIMHLMINNTKEFINAELLAQLYSCGDQNTLMEESAEQAQHRDEMLRMYHALREALSIIGDISTTTISTALPPPVDDSW 758          
BLAST of Dynamin 2 vs. Ensembl Cavefish
Match: dnm1a (dynamin-1 [Source:NCBI gene;Acc:103024863])

HSP 1 Score: 942.569 bits (2435), Expect = 0.000e+0
Identity = 452/757 (59.71%), Postives = 592/757 (78.20%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQ----IIRKGWLSLATATSLT-KKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE-----TNDEDGEENH-EPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW 2363
            N  ME LIPLVN++QDAF+  G + ++DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP +LQLIN PTE AEFLH +GKKFTDFD+VR+EIE ETDRVTG+NKG+S +PINL+VYSP+VLNLTL+DLPG+TKVPVGDQP DIE QI+ M+++F+T EN ++LAVSPANSDLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR+ILEN+LLPLRRGYIG+VNRSQKDI+GRKDI  AM  ERKFF +HP Y H+A++MGT YLQK LNQQL NHIRDTLP LR+K+Q+QL++IEK+VEE+KN +P DPS K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK+LRKEI  AIKNIHG+RTGLFTPD+AFEAIVK QI+ L+ P +KCID VVSEL   IR+ + K++ YP L++ +ER V Q +R+++SRTKDQ+ +LI I+L+Y+NTNHEDFIGF NA +++   N  K  GNQ    +IRKGWL++     +     E+WF+L AESL+WYKD++E EKK+++ ++NL+L+D +      K   +L+N + + NV+KD++ L+LA   + ++D WKA+FLRAGVY E     T++E+G ++     D  LERQVE +RNLV SY+ I+     D +PK + H +I+  +EF+N +L++ L S  + + LMEES E  Q R+++LR+Y AL+  L II ++ T T+S   PPPV + W
Sbjct:    3 NRGMEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRVTGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIKEMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDINAAMAAERKFFLTHPGYRHLADRMGTPYLQKTLNQQLTNHIRDTLPGLRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFSVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDLAFEAIVKKQIQKLKSPVLKCIDMVVSELTSTIRKCSEKLAQYPMLREEMERIVTQHIRDRESRTKDQVMLLIDIELAYMNTNHEDFIGFANAQQRSSQINKKKAPGNQDEIMVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKLRDVEKSFMSSKHIFALFNTEQR-NVYKDYRQLELACETQEDVDGWKASFLRAGVYAERVVSDTSEENGSDSFMHSMDPQLERQVETIRNLVDSYMGIVNKTVRDLMPKTIMHLMINNTKEFINAELLAQLYSCGDQNTLMEESAEQAQHRDEMLRMYHALREALSIIGDISTTTISTALPPPVDDSW 758          
BLAST of Dynamin 2 vs. Ensembl Cavefish
Match: dnm1b (dynamin-1 [Source:NCBI gene;Acc:103047879])

HSP 1 Score: 941.799 bits (2433), Expect = 0.000e+0
Identity = 450/771 (58.37%), Postives = 594/771 (77.04%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQIIRKGWLSLATATSLT-KKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE-TNDEDGEENH----------EPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNP 2402
            N  ME LIPLVN+LQDAF+  G + ++DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP +LQLIN PTE AEFLH +GKKFTDFD+VR+EIE ETDR+TG+NKG+S +PINL+VYSPHVLNLTL+DLPG+TKVPVGDQP DIE QI+ M+++F+T EN ++LAVSPANSDLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR+ILEN+LLPLRRGYIG+VNRSQKDI+G+KDI  AM  ERKFF +HPSY H+A +MGT YLQK+LNQQL NHIRDTLP LRNK+Q+QL++IEK+VEE+KN +P DPS K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK+LRKEI  AIKNIHG+RTGLFTPDMAFE IVK QI  ++EP  KC+D V+SEL++ +R+   K++ YP L++ +ER V Q +R+++SRTK Q+ +LI ++L+Y+NTNHEDFIGF NA +++   +  K+ GN++IRKGWL++     +     E+WF+L AE+L+WYKD++E EKK+++ ++NL+L+D +      K   +L+N + + NV+KD++ L+LA   +  +DSWKA+FLRAGVYPE   D++ +                D  LERQVE +RNLV SY+ I+     D +PK + H +I+  +EF++ +L++ L S  + + LMEES E  Q R+++LR+Y ALK  L II ++ T TVS   PPPV + W +  G    R +P
Sbjct:    3 NRGMEDLIPLVNKLQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRITGQNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPSDIEFQIKDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDITAAMAAERKFFLTHPSYRHLAERMGTPYLQKILNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFAVDFEKCIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIAKIKEPCQKCVDLVISELVNTVRQCTKKLAQYPMLREEMERIVTQHIRDRESRTKGQVMLLIDVELAYMNTNHEDFIGFANAQQRSSQMSKKKDAGNKVIRKGWLTINNIGIMKGGAKEYWFVLTAETLSWYKDDEEKEKKYMLPVDNLKLRDIEKSFMSSKHIFALFNTEQR-NVYKDYRQLELACETQEEVDSWKASFLRAGVYPERIMDKEKQSEASEESSSESFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIHAELLAQLYSCGDQNTLMEESAEQAQHRDEMLRMYYALKEALNIIGDISTTTVSTSLPPPVDDSWLQVQGGPSGRRSP 772          
BLAST of Dynamin 2 vs. Ensembl Cavefish
Match: dnm1b (dynamin-1 [Source:NCBI gene;Acc:103047879])

HSP 1 Score: 937.562 bits (2422), Expect = 0.000e+0
Identity = 450/775 (58.06%), Postives = 594/775 (76.65%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQ----IIRKGWLSLATATSLT-KKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE-TNDEDGEENH----------EPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNP 2402
            N  ME LIPLVN+LQDAF+  G + ++DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP +LQLIN PTE AEFLH +GKKFTDFD+VR+EIE ETDR+TG+NKG+S +PINL+VYSPHVLNLTL+DLPG+TKVPVGDQP DIE QI+ M+++F+T EN ++LAVSPANSDLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR+ILEN+LLPLRRGYIG+VNRSQKDI+G+KDI  AM  ERKFF +HPSY H+A +MGT YLQK+LNQQL NHIRDTLP LRNK+Q+QL++IEK+VEE+KN +P DPS K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK+LRKEI  AIKNIHG+RTGLFTPDMAFE IVK QI  ++EP  KC+D V+SEL++ +R+   K++ YP L++ +ER V Q +R+++SRTK Q+ +LI ++L+Y+NTNHEDFIGF NA +++   +  K+ GN+    +IRKGWL++     +     E+WF+L AE+L+WYKD++E EKK+++ ++NL+L+D +      K   +L+N + + NV+KD++ L+LA   +  +DSWKA+FLRAGVYPE   D++ +                D  LERQVE +RNLV SY+ I+     D +PK + H +I+  +EF++ +L++ L S  + + LMEES E  Q R+++LR+Y ALK  L II ++ T TVS   PPPV + W +  G    R +P
Sbjct:    3 NRGMEDLIPLVNKLQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRITGQNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPSDIEFQIKDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDITAAMAAERKFFLTHPSYRHLAERMGTPYLQKILNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFAVDFEKCIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIAKIKEPCQKCVDLVISELVNTVRQCTKKLAQYPMLREEMERIVTQHIRDRESRTKGQVMLLIDVELAYMNTNHEDFIGFANAQQRSSQMSKKKDAGNKDEIMVIRKGWLTINNIGIMKGGAKEYWFVLTAETLSWYKDDEEKEKKYMLPVDNLKLRDIEKSFMSSKHIFALFNTEQR-NVYKDYRQLELACETQEEVDSWKASFLRAGVYPERIMDKEKQSEASEESSSESFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIHAELLAQLYSCGDQNTLMEESAEQAQHRDEMLRMYYALKEALNIIGDISTTTVSTSLPPPVDDSWLQVQGGPSGRRSP 776          
BLAST of Dynamin 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006976.1 (pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1 gene:ENSPMAG00000006300.1 transcript:ENSPMAT00000006976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 333/501 (66.47%), Postives = 415/501 (82.83%), Query Frame = 3
Query:  285 RDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNPV---KNMGNQIIRKGWLSLATATSLTKKN-EFWFILKAESLTWYKDEK 1775
            RDFLPRGSGIVTRRP ILQL+    E AEFLH +GKKFTDF++VR EIE ETDR+TG NKG+S IPINL+VYSPHVLNLTLIDLPG+TKVPVGDQP DIE QIR M+++F+T EN +ILAVSPAN+DLANSDALK+AK+VDPQGLRTIGVITKLDLMD GTDAR+ILEN+LLPLRRGYIG+VNRSQKDI+GRKDI  AM  ERKFF SHPSY HMA++MGT YLQK LNQQL NHIRDTLP+LRNK+Q Q++++EK+VEE+KN +P DP+ K K+L+    +F  DF+K +EG+G   DT +L+GG +IN++FHE FP+E+ K +FDEK+LR+EI  AI+NI+G+RTGLFTPD+AFEAIVK QI+ L+EP +KC+D VV EL ++IR+ + K+ SYPRL+D  +R V   +R ++ RTKDQ+ +LI IQL+Y+NTNHEDFIGF+NA ++   PV   K  GNQ+IRKGWL++     +   + E+WF+L AESL+WYKDE+
Sbjct:    1 RDFLPRGSGIVTRRPLILQLMFCKAEYAEFLHCKGKKFTDFEEVRAEIEAETDRLTGSNKGISPIPINLRVYSPHVLNLTLIDLPGMTKVPVGDQPVDIEYQIREMLMQFVTKENCLILAVSPANTDLANSDALKIAKEVDPQGLRTIGVITKLDLMDDGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDINAAMAAERKFFLSHPSYRHMADRMGTPYLQKTLNQQLTNHIRDTLPALRNKLQGQMLSMEKEVEEYKNFRPDDPTRKTKALLQMVQQFAFDFEKRIEGSGDQIDTVELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIRNINGIRTGLFTPDLAFEAIVKKQIQKLKEPCLKCVDLVVGELTNVIRKCSEKLGSYPRLRDDTDRIVTTYIREREGRTKDQVLLLIDIQLAYMNTNHEDFIGFSNAQQRTSQPVAKKKAPGNQVIRKGWLTINNIGIMKGGSKEYWFVLTAESLSWYKDEE 501          
BLAST of Dynamin 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002816.1 (pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-1 gene:ENSPMAG00000002541.1 transcript:ENSPMAT00000002816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 448.743 bits (1153), Expect = 9.246e-146
Identity = 241/537 (44.88%), Postives = 342/537 (63.69%), Query Frame = 3
Query:  141 MEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLIN-----------------------------SPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRR----SATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNPVKN 1652
            ME LIP++N+LQD F   G S SI LPQI VVG+QS+GKSSVLE+ VGRDFLPRG+GIVTRRP +LQL++                                E  +FLH + K ++DF+++R+EIE ET+R+TG NKG+SS  I+LK++SPHVLNLTL+DLPGITKVPVGDQP DIE+QIR +I++FI N N+IILAV+ AN+DLA S+ALK+A++VD  G RT+ VITKLDLMD GTDA +IL  R++P++ G IG+VNRSQ DI  +K I  AM+DE+ F      Y  +AN+ GT +L K LN+ L++HIRD LP L+ ++       +  +  + N  P D   K  +L+    +F  ++   +EG  +  +T +L GG +I  +FHE F   +   D        ++ TAI+N  G R  LF P+++FE +VK QIK LEEPS++C++ V  E+  II+     S  ++  +P+L DAI   V   +R +   + + +  L+ I+L+YINT H DF   +    + +N +++
Sbjct:    1 MEALIPVINKLQDVFNTVG-SESIQLPQIVVVGAQSSGKSSVLESLVGRDFLPRGTGIVTRRPLVLQLVHVIPDERIRPGGEENGTASTAARLILFAGVEAEEWGKFLHTKNKVYSDFNEIRQEIENETERITGTNKGISSEAIHLKIFSPHVLNLTLVDLPGITKVPVGDQPVDIEQQIRELIIKFIGNPNSIILAVTAANTDLATSEALKIAREVDTDGRRTLAVITKLDLMDAGTDAMDILTGRVIPVKLGIIGVVNRSQLDINTKKTILDAMQDEQSFM--QKKYPSLANRNGTKFLGKTLNRLLMHHIRDCLPELKTRVNVMAAQYQSLLGGYGN--PVDD--KNATLLQLVTKFAAEYCNTIEGTAKHIETSELCGGARICYIFHETFGRTLESVDPLGGLTTLDVLTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRRRLPVSNEMVHNLVAIELAYINTKHPDFADASMVSTQINNSLED 530          

HSP 2 Score: 55.4546 bits (132), Expect = 5.241e-8
Identity = 28/79 (35.44%), Postives = 50/79 (63.29%), Query Frame = 3
Query: 2043 ERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRRE---DLLRI 2270
            +R  E++  L+ SY  I+R    D +PKAV H L++ V++ L ++L+  L  Q+ +D L+ ES ++ QRR+   D+L++
Sbjct:  669 QRDCEVIEKLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDNLQSELVGQLYKQQLLDELLTESEDMAQRRKEASDMLKV 747          
BLAST of Dynamin 2 vs. Ensembl Sea Lamprey
Match: mxb (myxovirus (influenza) resistance B [Source:NCBI gene;Acc:360143])

HSP 1 Score: 231.876 bits (590), Expect = 5.124e-66
Identity = 160/491 (32.59%), Postives = 252/491 (51.32%), Query Frame = 3
Query:  147 KLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLR------GKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTD--AREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANK---MGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDM----AFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSY-PRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQ 1571
            K+ P ++ L D     G+   + LP +AV+G QS+GKSSVLE   G   LPRGSGIVTR P  L+L  +P      +  R        K    + V   +      +TG + G+S   I L+V S  V +LTLIDLPGI +V +  Q  DIE QI+ +I + I  + TI L V P N D+A ++ALKMA+ VDP G+RT+GV+TK DLMD+GT+  A  IL+N++ PL +GY+ +  RSQ+D+E  + + +A   E  FF  HP + H+ N      T  L   L ++L+++I+ TLP LR  +  +L     ++E      P D   K + +    MR+  D    V G  R   +  L     +  L  E F   +      +    +E+   I+     R+G   P      AFE + ++ ++ LE+P++  +    S+L D+  R A  +  + P     ++ +V  +V+ ++ + +  I  L +++
Sbjct:   26 KVRPYID-LIDTLRYLGVDQDVGLPAVAVIGDQSSGKSSVLEALSGVQ-LPRGSGIVTRCPLALKLKRAPGPWHGRIKYRVQGRTINTKLDTPESVGDAVLQAQSELTGDDLGVSKSLIELEVTSDSVPDLTLIDLPGIARVALAGQAVDIETQIKDLIRDHIGRQETINLVVIPCNVDIATTEALKMAQAVDPTGVRTLGVLTKPDLMDEGTERNALRILQNQVFPLSKGYVLVKCRSQRDVEAHQTLAEASRVEAAFFKKHPVFCHVHNGGKLTTTTVLAAKLTEELVDNIKRTLPKLRKDLAEKLREACAELESQGESIPDDARAKQQFINARVMRYNDD----VRGLARGEPSRNLPRNMMLYTLVREHFRTWLKDLKRAQDAWLEELDNLIREYIDNRSGRELPGFVSYHAFENLARVHVQRLEKPALNVLAVTCSKLSDVFMRLADDVFKFLPEFNRLVKAKVGAQVQGQEQKARVLIVTLFRME 510          
BLAST of Dynamin 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007915.1 (pep scaffold:Pmarinus_7.0:GL487011:231:8254:1 gene:ENSPMAG00000007153.1 transcript:ENSPMAT00000007915.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.897 bits (494), Expect = 4.092e-56
Identity = 106/302 (35.10%), Postives = 171/302 (56.62%), Query Frame = 3
Query:  714 GLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRR----SATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFI 1607
            G RT+ V++KLDLMD GTDA ++L  R++P++ G +G+VNRSQ DI   K +  ++ DE  F      Y  +AN+ GT  L K LN+ L++HIRD LP L+ ++   +   +  +  +  +   DPS    S++    +F  ++   +EG  +  +T +L GG +I  +FHE F   +            ++ TAI+N  G R  LF P+++FE +VK QIK LEEP ++C++ V  E+  I++     S  ++  +P+L DAI   V   +R +   T + +  L+ I+L+YINT H DF+
Sbjct:   10 GRRTLAVVSKLDLMDAGTDATDVLLGRVVPVKLGIVGVVNRSQLDINKNKSVSDSLRDEDVFLQR--KYPALANRSGTKNLAKTLNRLLMHHIRDCLPELKARVNMLVAQYQSLLSGYGEMV-DDPSATLLSIV---TKFASEYCHTIEGTSKHIETSELCGGARICYIFHETFGRTLESLHPLGGLTTMDVLTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPGLRCVELVHEEMQRIVQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPFTNEMVHNLVAIELAYINTKHPDFV 305          
BLAST of Dynamin 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002195.1 (pep scaffold:Pmarinus_7.0:GL484008:1783:12172:-1 gene:ENSPMAG00000001995.1 transcript:ENSPMAT00000002195.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.31 bits (412), Expect = 6.884e-45
Identity = 91/241 (37.76%), Postives = 143/241 (59.34%), Query Frame = 3
Query: 1773 KENEKKFIVTLENLRLKDSDSRMF-GPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE----------TNDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGF-TESRVNPRRVSAASNRAPPAIPGSKP 2459
            +E EKK+++ L+NL+L+D +   F   K   +++N + + NV+KD++ L+LA   +  +DSWKA+FLRAGVYPE          + D  G+      D  LERQVE +RNLV SY+ I+     D +PK + H +I+  ++F++++L++ L S  +   LMEES E  QRR+++LR+Y  LK  L II ++  +T + P PPPV + W + N   +  R+ P   S    R PP  P ++P
Sbjct:    1 QEKEKKYMLPLDNLQLRDMEKGGFMSSKHIFAIFNTEQR-NVYKDYRQLELACEGQEEVDSWKASFLRAGVYPERRAYVKQQSESEDSTGDNFGNSMDPQLERQVETIRNLVDSYMGIVSKNIRDLMPKTIMHLMINNTKDFIHSELLAHLYSSSDQTSLMEESAEQAQRRDEVLRMYHTLKDALSIIGDISMSTATTPLPPPVDDSWMQNNAAPSGPRIRP-PPSPTPVRRPPNFPLARP 239          
BLAST of Dynamin 2 vs. Ensembl Yeast
Match: DNM1 (Dynamin-related GTPase involved in mitochondrial organization; required for mitochondrial fission and inheritance; self assembles on the cytoplasmic face of mitochondrial tubules at sites where division will occur; participates in endocytosis and regulates peroxisome fission along with Vps1p; mutants in the human ortholog DNM1L, which mediates mitochondrial fission, peroxisomal division, autophagy, and mitophagy, are associated with slowly progressive infantile encephalopathy [Source:SGD;Acc:S000003924])

HSP 1 Score: 486.108 bits (1250), Expect = 1.472e-160
Identity = 290/771 (37.61%), Postives = 438/771 (56.81%), Query Frame = 3
Query:  141 MEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLIN-SPT-----------------------------------------ESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTM-RFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSAT-KISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNPVKNM--GNQIIRKGWLSLATATSLTKKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPETNDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVV 2315
            +E LIP VN+LQD    +GI  ++DLP +AVVGSQS+GKSS+LE  VGRDFLPRG+GIVTRRP +LQL N SP                                          E  EFLH+ GK+F DFD ++REIE ET R+ GK+KG+S IPINLKV+SPHVLNLTL+DLPGITKVP+G+QP DIE+QI+ +IL++I   N +ILAVSPAN DL NS++LK+A++VDPQG RTIGVITKLDLMD GT+A +IL  ++ PL+ G++G+VNRSQ+DI+  K + ++++ E  +F  HP Y  ++ K GT YL K+LNQ L++HIRD LP ++ K+ T +   E+++  +  +  T    +  SL+L  M +F  +F   ++G   D +T +L GG +I  +++ +F   +   D        ++ TAI+N  G R  LF P++AF+ +VK QIK L EPS +C++ V  ELM I  +  + +++ YP+L+  +   + + +R +   T+  ++ LI I  +YINTNH +F+   +A +  D+ +K     NQ + K  LS          N    I         K+   ++             D++S+    KF    + +D K     D      +    GN++ ++   L+   +   + +D E    P     E + E+++ L+ SY  IIR    D +PKAV   L++  ++ + N L++ L  +   + L+ E   + Q RE  ++     K    +ISN++
Sbjct:    4 LEDLIPTVNKLQDVMYDSGID-TLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWGEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFRKHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYGGVGATTNESR-ASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSLKSIDPTSNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEELMKICHKCGSAELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNFL---SATEAMDDIMKTRRKRNQELLKSKLSQQENGQTNGINGTSSISSNIDQDSAKNSDYDDDGI----------DAESKQTKDKFLNYFFGKDKKGQPVFDASDKKRSIAGDGNIEDFRN--LQISDFSLGDIDDLENAEPPLTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCLLVNYCKDSVQNRLVTKLYKETLFEELLVEDQTLAQDRELCVKSLGVYKKAATLISNIL 757          
BLAST of Dynamin 2 vs. Ensembl Yeast
Match: VPS1 (Dynamin-like GTPase required for vacuolar sorting; also involved in actin cytoskeleton organization, endocytosis, late Golgi-retention of some proteins, regulation of peroxisome biogenesis [Source:SGD;Acc:S000001709])

HSP 1 Score: 458.759 bits (1179), Expect = 1.231e-150
Identity = 252/542 (46.49%), Postives = 345/542 (63.65%), Query Frame = 3
Query:  144 EKLIPLVNQLQDAFT-LAGISGS-IDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLIN--------------------------------------------SPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKD-FDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRR--SATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNA 1622
            E LI  +N+LQDA   L G S S IDLPQI VVGSQS+GKSSVLEN VGRDFLPRG+GIVTRRP +LQLIN                                            +  E  EFLHL GKKF +FD++R+EI  ETD+VTG N G+SS+PINL++YSPHVL LTL+DLPG+TKVPVGDQP DIE QI+ M+L++I+  N IIL+V+ AN+DLANSD LK+A++VDP+G RTIGV+TK+DLMD+GTD  +IL  R++PLR GYI ++NR QKDIE +K IR+A+E+ERKFF +HPSYS  A+  GT YL K LN  L++HIR TLP ++ K++    T++K   E  N+ P         ++     F  ++   ++G  ++  + +L+GG +I+ +FHE F   +   D FD+ K   +I T + N  G    LF    AFE +VK QI+  EEPS++ +  V  EL+ ++++  S  K S YP L++AI  Q +Q +++    T + +  +IK + +YINT H D +  + A
Sbjct:    3 EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIVTRRPLVLQLINRRPKKSEHAKVNQTANELIDLNINDDDKKKDESGKHQNEGQSEDNKEEWGEFLHLPGKKFYNFDEIRKEIVKETDKVTGANSGISSVPINLRIYSPHVLTLTLVDLPGLTKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEHKKTIREALENERKFFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPEIKAKIEA---TLKKYQNELINLGPETMDSASSVVLSMITDFSNEYAGILDGEAKELSSQELSGGARISYVFHETFKNGVDSLDPFDQIK-DSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPSLRLVTLVFDELVRMLKQIISQPKYSRYPALREAISNQFIQFLKDATIPTNEFVVDIIKAEQTYINTAHPDLLKGSQA 540          
BLAST of Dynamin 2 vs. Ensembl Yeast
Match: MGM1 (Mitochondrial GTPase, present in complex with Ugo1p and Fzo1p; required for mitochondrial morphology, fusion, and genome maintenance; promotes membrane bending; exists as long and short form with different distributions; ratio of long to short forms is regulated by Psd1p; homolog of human OPA1 involved in autosomal dominant optic atrophy [Source:SGD;Acc:S000005737])

HSP 1 Score: 191.815 bits (486), Expect = 4.463e-51
Identity = 103/220 (46.82%), Postives = 147/220 (66.82%), Query Frame = 3
Query:  201 SGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTE---SAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDI 851
            S  + LP I V+GSQS+GKSSVLE+ VGR+FLP+GS +VTRRP  L L+N+P     +A+F  +R     DF +V+R + +E +     ++ +S  PI L + S  V +L+L+DLPG  +V   DQP +++ +IR +  +++T  N IILA+S A+ DLANS ALK +K  DP+GLRTIGVITKLDL+D    AR IL N+  PL  GY+G++ ++   I
Sbjct:  205 SAHLTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVNTPNSNNVTADFPSMRLYNIKDFKEVKRML-MELNMAVPTSEAVSEEPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPIELKTKIRDLCEKYLTAPN-IILAISAADVDLANSSALKASKAADPKGLRTIGVITKLDLVDP-EKARSILNNKKYPLSMGYVGVITKTPSSI 421          
BLAST of Dynamin 2 vs. Ensembl Nematostella
Match: EDO32191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVT4])

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 332/494 (67.21%), Postives = 409/494 (82.79%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGF 1613
            N  ME LIP+VN++QDAF   G S  IDLPQIAVVGSQSAGKSSVLENFVG+DFLPRGSGIVTRRP ILQL  S +E AEFLH R KKFTDF +V++EI  ETDRVTG NKG+S+IPINL+VYSP VL+LTL+DLPG+TKVPVGDQP DIE QIR M+LEFIT EN +ILAVSPANSDLANSDALK+A++VDPQG RTIGVITKLDLMD+GTDAR+ILENR+LPLRRGYIGIVNRSQ DI+GRKDIR A+  ERKFF S+PSY HMA+KMGT YLQKVLNQQL NHI+DTLP+LR+K+Q  L+ +EK+V+ ++N  P D S + K+L+     F  DF+K +EG+G   +T +L+GG KIN++FHE FPYE+ K +FDEK+LR+EI  AIKNIHG+R GLFTPDMAFEAIVK QI  L  P++KC+D V++EL  +I++ AT+++ YP L+D +ER V+  +R+ +  TK+Q++  I+++L+YINTNH DF+GF
Sbjct:    3 NKGMEDLIPIVNKIQDAFASIGYSSMIDLPQIAVVGSQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLQPSKSEYAEFLHCRNKKFTDFGEVQKEIVAETDRVTGGNKGISNIPINLRVYSPSVLSLTLVDLPGMTKVPVGDQPADIEFQIRSMLLEFITKENCLILAVSPANSDLANSDALKIAREVDPQGARTIGVITKLDLMDEGTDARDILENRVLPLRRGYIGIVNRSQADIDGRKDIRAALAAERKFFLSNPSYRHMADKMGTQYLQKVLNQQLTNHIKDTLPALRSKLQDNLLALEKEVKGYENYNPRDLSVRTKALMQMMQTFSADFEKAIEGSGDSINTVELSGGAKINRIFHERFPYELVKMEFDEKQLRREIMFAIKNIHGIRVGLFTPDMAFEAIVKRQIDKLRSPAIKCVDMVMTELTSVIQKCATQMAKYPLLRDQVERIVIDHIRSNEVTTKEQVQTFIELELAYINTNHPDFVGF 496          
BLAST of Dynamin 2 vs. Ensembl Nematostella
Match: EDO34895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN34])

HSP 1 Score: 469.159 bits (1206), Expect = 5.555e-154
Identity = 246/517 (47.58%), Postives = 340/517 (65.76%), Query Frame = 3
Query:  141 MEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLIN-------------------------SPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTM-RFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRS---ATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDF 1604
            ME+LIP++N+LQD F   G S SI LPQI VVG+QS+GKSSVLEN VGRDFLPRGSG+VTRRP ILQL++                          P E  +FLHL+ K F DF+ +R EIE ETDRVTG NKG+SS PINLK+YSP VLNLTL+DLPG+TKVPVGDQP DIE+QIR +IL++I+N N+IILAV+PAN DLA S+ALK+A++VDP G RT+ V TKLDLMD GTDA ++L  R++P++ G IG+VNRSQ DI  RK I  A+ DE  FF    +Y  +A++ GT YL K LN+ L++HIR+ LP L++++ +        ++ +      +P       +L  + RF   +   +EG   + +T +L GG +I  +FH++F   +   D  E    ++I TAI+N  G R  LF P+++FE +VK QI+ LEEPS++CI+ V  E+  II+ S     +I  +PRL ++I   ++  ++ +     + ++ L+ I+L+YINTNH DF
Sbjct:    1 MEQLIPVINKLQDVFNTVG-SESIQLPQIVVVGAQSSGKSSVLENLVGRDFLPRGSGVVTRRPLILQLVHVPPRAKEKKINELPDKKEAAEDHDAEPAEWGKFLHLKEKIFRDFNGIREEIERETDRVTGSNKGISSEPINLKIYSPKVLNLTLVDLPGVTKVPVGDQPLDIEQQIRHLILQYISNPNSIILAVTPANIDLATSEALKIAREVDPDGHRTLAVCTKLDLMDHGTDAMDVLYGRVIPVKLGIIGVVNRSQLDINNRKSIENALRDEADFFAR--NYPTVASRNGTPYLAKTLNKLLMHHIRNCLPELKSRVNSMTSQYHHLLQSYG-----EPVMDKGPYLLQMITRFAATYCSIIEGTAHEIETSELCGGARICYIFHDIFGRTLTIMDAMEGLSTRDILTAIRNATGPRPALFVPEISFELLVKRQIRRLEEPSLRCIELVHEEMQRIIQHSFDQVMEIKRFPRLHESIVDVIINLLQRRLMPCNEMVENLVAIELAYINTNHPDF 509          

HSP 2 Score: 48.9062 bits (115), Expect = 8.870e-6
Identity = 27/86 (31.40%), Postives = 51/86 (59.30%), Query Frame = 3
Query: 2055 EIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNV 2312
            +I+R L+ SY  I+R    D +PKA+   L++ V+E + ++L+  L   E  + L++ES  +  +R++   + +AL+   +IIS V
Sbjct:  627 DIIRKLIKSYFVIVRKSIQDSVPKAIMAFLVNYVKERIQSELVEKLYKSERFETLLQESEHMHIKRKEAAEMLKALQRAGQIISEV 712          
BLAST of Dynamin 2 vs. Ensembl Nematostella
Match: EDO43348 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ55])

HSP 1 Score: 211.075 bits (536), Expect = 5.827e-62
Identity = 106/240 (44.17%), Postives = 158/240 (65.83%), Query Frame = 3
Query: 1659 NQIIRKGWLSLATATSL----TKKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE---TNDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVN 2357
            NQIIRKGWL+++ A  +        E+WF+L AE+LTWYKDE+E E K+ + L+ +RL+D ++     +   +L+N D K N+FKDHK L+L+  ++  +DSWKA+FLRAGVYPE   + D+  +      D  +ERQVE +RNLV SYI I+     D +PK + + +I+ ++EF+  +L++ L S  NV  LMEES E  QRRE++L++Y + K  L+I+ ++ T T+S P PPPV N
Sbjct:   17 NQIIRKGWLTVSQAGFMKGVGMGSKEYWFVLTAETLTWYKDEEEKETKYQLRLDGVRLRDLEAGFMSKRVSFALFNPDTK-NLFKDHKQLELSADNQETVDSWKASFLRAGVYPERESSEDKSLQGEIGTLDPQMERQVETIRNLVDSYIRIVSKTIRDLVPKTIMYMIINNIKEFIAAELLAHLYSSGNVSDLMEESEEEAQRREEMLKMYHSTKEALQIVGDIDTHTISIPTPPPVDN 255          
BLAST of Dynamin 2 vs. Ensembl Nematostella
Match: EDO40359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7A7])

HSP 1 Score: 115.931 bits (289), Expect = 1.233e-26
Identity = 86/304 (28.29%), Postives = 144/304 (47.37%), Query Frame = 3
Query:  216 LPQIAVVGSQSAGKSSVLENFVGRDFLPRGSG-IVTRRPCILQLINSPTESAEF------LHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDA----REILENRLLPLRR-GYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSH---MANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKP 1082
            LP++ VVG QSAGK+SVLE        PRGSG ++TR P ++ L   P   A+F        L  +K  +   +R E+E+   R   + + +S   I++ V  P +  + L+DLPGI            +  I  +   ++ N N IIL +     D   S+   +   +DPQG RTI V+TK+DL ++   +    ++ILE  L P++  GY  +V  +    E  + I+ +   E  FF +   +      A++M T  L   ++Q     +R+++    +  + +   +E    E+KN  P
Sbjct:   29 LPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGQMMTRSPVMVTLSEGPNHIAQFKGNSRQFDLTQEK--ELKDLRHEVELRMKRSVKQGQTVSPEVISMTVKGPGLHRMVLVDLPGIIGTTTTGMAESTKSDILDISRRYMENPNAIILCIQDGAIDAERSNVTDLVSSMDPQGKRTIFVLTKVDLAEQNETSPSRIKQILEGNLFPMKALGYFAVVTGTGNTSESIETIKTS---EEGFFRTSKLFKSGVFKASQMTTQNLSFAVSQCFWKMVRESIEQQADAYKAKRFNLEA---EWKNHFP 324          
BLAST of Dynamin 2 vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 941.414 bits (2432), Expect = 0.000e+0
Identity = 449/758 (59.23%), Postives = 592/758 (78.10%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQIIRKGWLSLATATSLT-KKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE-TNDEDGEENH----------EPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW 2363
            N  ME LIP+VN++QDAFT  G + ++DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP +LQL+NSPTE AEFLH +GKKFTDFD+VR+EIE ETDRVTG NKG+S +PINL+VYSPHVLNLTL+DLPG+TKVPVGDQP DIE QIR M+L+F+T EN ++LAVSPANSDLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDA++ILEN+LLPLRRGYIG+VNRSQKDI+G+KDI  A+  ERKFF SHP+Y H+A++MGT YLQKVLN+QL NHIRDTLP+LR+K+Q+QL++IEK+VEE+KN +P DPS K K L+    +F  DFDK +EG+G   DT +L+GG KIN++FHE FP+E+ K +F+EK+LRKEI  AIKNIHG+RTGLFTPDMAFE IVK QI  ++EP  KC+D V+SEL+  +R+   K++ YP L++ +ER V Q +R+++  TK+Q+ +LI I+LSY+NTNHEDFIGF NA ++ +  N  K  GNQ+IRKGWL++     +     E+WF+L AESL+WYKD++E EKK+++ ++NL+L+D +      K   +L+N + + NV+KD++ L+LA   + ++D+WKA+FLRAGVYPE   +++G+ +              D  LERQVE +RNLV SY++I+     D +PK + H +I+  +EF+N +L++ L S  + + LMEES E  Q R+++LR+Y AL+  L+II ++ T TVS   PPPV + W
Sbjct:    3 NRGMEDLIPMVNRMQDAFTAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLMNSPTEHAEFLHCKGKKFTDFDEVRQEIEAETDRVTGANKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQFVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAIAAERKFFLSHPAYRHLADRMGTPYLQKVLNEQLTNHIRDTLPALRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKVLLQMVQQFSVDFDKCIEGSGDKIDTAELSGGAKINRIFHERFPFELVKMEFNEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIGKIKEPCTKCVDMVISELVSTVRQCTKKLAQYPLLREEMERIVTQHIRDRERDTKEQVLLLIDIELSYMNTNHEDFIGFANAQQRINQINKKKAAGNQVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKLRDVEKGFMSSKHIFALFNTEQR-NVYKDYRQLELACESQEDVDAWKASFLRAGVYPERVTEKEGKSDGGDDNDSDNLMHSMDPQLERQVETIRNLVDSYMSIVNKTVRDLMPKTIMHLMINNTKEFINAELLAQLYSCGDQNSLMEESQEQAQHRDEMLRMYHALREALRIIGDISTTTVSTANPPPVDDSW 759          
BLAST of Dynamin 2 vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 935.25 bits (2416), Expect = 0.000e+0
Identity = 449/762 (58.92%), Postives = 592/762 (77.69%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQ----IIRKGWLSLATATSLT-KKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE-TNDEDGEENH----------EPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW 2363
            N  ME LIP+VN++QDAFT  G + ++DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP +LQL+NSPTE AEFLH +GKKFTDFD+VR+EIE ETDRVTG NKG+S +PINL+VYSPHVLNLTL+DLPG+TKVPVGDQP DIE QIR M+L+F+T EN ++LAVSPANSDLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDA++ILEN+LLPLRRGYIG+VNRSQKDI+G+KDI  A+  ERKFF SHP+Y H+A++MGT YLQKVLN+QL NHIRDTLP+LR+K+Q+QL++IEK+VEE+KN +P DPS K K L+    +F  DFDK +EG+G   DT +L+GG KIN++FHE FP+E+ K +F+EK+LRKEI  AIKNIHG+RTGLFTPDMAFE IVK QI  ++EP  KC+D V+SEL+  +R+   K++ YP L++ +ER V Q +R+++  TK+Q+ +LI I+LSY+NTNHEDFIGF NA ++ +  N  K  GNQ    +IRKGWL++     +     E+WF+L AESL+WYKD++E EKK+++ ++NL+L+D +      K   +L+N + + NV+KD++ L+LA   + ++D+WKA+FLRAGVYPE   +++G+ +              D  LERQVE +RNLV SY++I+     D +PK + H +I+  +EF+N +L++ L S  + + LMEES E  Q R+++LR+Y AL+  L+II ++ T TVS   PPPV + W
Sbjct:    3 NRGMEDLIPMVNRMQDAFTAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLMNSPTEHAEFLHCKGKKFTDFDEVRQEIEAETDRVTGANKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQFVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAIAAERKFFLSHPAYRHLADRMGTPYLQKVLNEQLTNHIRDTLPALRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKVLLQMVQQFSVDFDKCIEGSGDKIDTAELSGGAKINRIFHERFPFELVKMEFNEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIGKIKEPCTKCVDMVISELVSTVRQCTKKLAQYPLLREEMERIVTQHIRDRERDTKEQVLLLIDIELSYMNTNHEDFIGFANAQQRINQINKKKAAGNQDEIMVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKLRDVEKGFMSSKHIFALFNTEQR-NVYKDYRQLELACESQEDVDAWKASFLRAGVYPERVTEKEGKSDGGDDNDSDNLMHSMDPQLERQVETIRNLVDSYMSIVNKTVRDLMPKTIMHLMINNTKEFINAELLAQLYSCGDQNSLMEESQEQAQHRDEMLRMYHALREALRIIGDISTTTVSTANPPPVDDSW 763          
BLAST of Dynamin 2 vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 931.398 bits (2406), Expect = 0.000e+0
Identity = 449/772 (58.16%), Postives = 592/772 (76.68%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQ--------------IIRKGWLSLATATSLT-KKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPE-TNDEDGEENH----------EPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW 2363
            N  ME LIP+VN++QDAFT  G + ++DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP +LQL+NSPTE AEFLH +GKKFTDFD+VR+EIE ETDRVTG NKG+S +PINL+VYSPHVLNLTL+DLPG+TKVPVGDQP DIE QIR M+L+F+T EN ++LAVSPANSDLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDA++ILEN+LLPLRRGYIG+VNRSQKDI+G+KDI  A+  ERKFF SHP+Y H+A++MGT YLQKVLN+QL NHIRDTLP+LR+K+Q+QL++IEK+VEE+KN +P DPS K K L+    +F  DFDK +EG+G   DT +L+GG KIN++FHE FP+E+ K +F+EK+LRKEI  AIKNIHG+RTGLFTPDMAFE IVK QI  ++EP  KC+D V+SEL+  +R+   K++ YP L++ +ER V Q +R+++  TK+Q+ +LI I+LSY+NTNHEDFIGF NA ++ +  N  K  GNQ              +IRKGWL++     +     E+WF+L AESL+WYKD++E EKK+++ ++NL+L+D +      K   +L+N + + NV+KD++ L+LA   + ++D+WKA+FLRAGVYPE   +++G+ +              D  LERQVE +RNLV SY++I+     D +PK + H +I+  +EF+N +L++ L S  + + LMEES E  Q R+++LR+Y AL+  L+II ++ T TVS   PPPV + W
Sbjct:    3 NRGMEDLIPMVNRMQDAFTAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLMNSPTEHAEFLHCKGKKFTDFDEVRQEIEAETDRVTGANKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQFVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAIAAERKFFLSHPAYRHLADRMGTPYLQKVLNEQLTNHIRDTLPALRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKVLLQMVQQFSVDFDKCIEGSGDKIDTAELSGGAKINRIFHERFPFELVKMEFNEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIGKIKEPCTKCVDMVISELVSTVRQCTKKLAQYPLLREEMERIVTQHIRDRERDTKEQVLLLIDIELSYMNTNHEDFIGFANAQQRINQINKKKAAGNQDEIMPERGVNDRFKVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKLRDVEKGFMSSKHIFALFNTEQR-NVYKDYRQLELACESQEDVDAWKASFLRAGVYPERVTEKEGKSDGGDDNDSDNLMHSMDPQLERQVETIRNLVDSYMSIVNKTVRDLMPKTIMHLMINNTKEFINAELLAQLYSCGDQNSLMEESQEQAQHRDEMLRMYHALREALRIIGDISTTTVSTANPPPVDDSW 773          
BLAST of Dynamin 2 vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 930.243 bits (2403), Expect = 0.000e+0
Identity = 450/767 (58.67%), Postives = 591/767 (77.05%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQ--------------IIRKGWLSLATATSLT-KKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPETNDEDGEENH------EPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEW 2363
            N  ME LIP+VN++QDAFT  G + ++DLPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRP +LQL+NSPTE AEFLH +GKKFTDFD+VR+EIE ETDRVTG NKG+S +PINL+VYSPHVLNLTL+DLPG+TKVPVGDQP DIE QIR M+L+F+T EN ++LAVSPANSDLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDA++ILEN+LLPLRRGYIG+VNRSQKDI+G+KDI  A+  ERKFF SHP+Y H+A++MGT YLQKVLN+QL NHIRDTLP+LR+K+Q+QL++IEK+VEE+KN +P DPS K K L+    +F  DFDK +EG+G   DT +L+GG KIN++FHE FP+E+ K +F+EK+LRKEI  AIKNIHG+RTGLFTPDMAFE IVK QI  ++EP  KC+D V+SEL+  +R+   K++ YP L++ +ER V Q +R+++  TK+Q+ +LI I+LSY+NTNHEDFIGF NA ++ +  N  K  GNQ              +IRKGWL++     +     E+WF+L AESL+WYKD++E EKK+++ ++NL+L+D +      K   +L+N + + NV+KD++ L+LA   + ++D+WKA+FLRAGVYPE    DG +++         D  LERQVE +RNLV SY++I+     D +PK + H +I+  +EF+N +L++ L S  + + LMEES E  Q R+++LR+Y AL+  L+II ++ T TVS   PPPV + W
Sbjct:    3 NRGMEDLIPMVNRMQDAFTAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLMNSPTEHAEFLHCKGKKFTDFDEVRQEIEAETDRVTGANKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQFVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAIAAERKFFLSHPAYRHLADRMGTPYLQKVLNEQLTNHIRDTLPALRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKVLLQMVQQFSVDFDKCIEGSGDKIDTAELSGGAKINRIFHERFPFELVKMEFNEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIGKIKEPCTKCVDMVISELVSTVRQCTKKLAQYPLLREEMERIVTQHIRDRERDTKEQVLLLIDIELSYMNTNHEDFIGFANAQQRINQINKKKAAGNQDEIMPERGVNDRFKVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKLRDVEKGFMSSKHIFALFNTEQR-NVYKDYRQLELACESQEDVDAWKASFLRAGVYPERVTSDGGDDNDSDNLMHSMDPQLERQVETIRNLVDSYMSIVNKTVRDLMPKTIMHLMINNTKEFINAELLAQLYSCGDQNSLMEESQEQAQHRDEMLRMYHALREALRIIGDISTTTVSTANPPPVDDSW 768          
BLAST of Dynamin 2 vs. Ensembl Medaka
Match: ENSORLT00000022076.2 (dynamin-1 [Source:NCBI gene;Acc:101154874])

HSP 1 Score: 927.932 bits (2397), Expect = 0.000e+0
Identity = 454/773 (58.73%), Postives = 599/773 (77.49%), Query Frame = 3
Query:  132 NIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKAD--NPVKNMGNQ----IIRKGWLSLATATSLT-KKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYP---------ETNDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNP 2402
            N  ME+LIPLVN+LQDAF+  G + S+DLPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL+  PTE AEFLH +GKKFTDFD+VR+EIE ETDR+TG NKG+S +PINL+VYSP+VLNLTL+DLPG+TKVPVGDQP DIE+QI+ M+L+F+T +N ++LAVSPANSDLANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAR+ILEN+LLPLRRGYIG+VNRSQKDI+G+KDI  A++ ERKFF SHP+Y H+A++MGT YLQK+LNQQL NHIRDTLP LR+K+Q+QL++IEK+VEE+KN +P DPS K K+L+    +F  DF+K +EG+G   DT +L+GG KIN++FHE FP+E+ K + DEK LRKEI  AIKNIHG+RTGLFTPDMAFE IVK QI  ++EP  KC+D V+ EL++ +R+   K++ YP L++ +ER V Q +R+++SRTKDQ+ +LI I+L+Y+NTNHEDFIGF NA +K+   +  K  GNQ    +IRKGWL++     +     E+WF+L AE+L+WYKD++E EKK+++ ++NL+LKD +      K   +L++ +++ NV+KD++ L+LA+  +  +DSWKA+FLRAGVYP         E  D + +      D  LERQVEIVRNLV SY++II     D +PK + H +++  +EF++ DL++ L S  + + LMEES E  QRR+++LR+Y AL+ GL II ++ T TV+  APPPV + W +  G    R +P
Sbjct:    3 NRGMEELIPLVNRLQDAFSAIGQNASLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVTCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRITGHNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPPDIEQQIKDMLLQFVTKDNCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDITAALQAERKFFLSHPAYRHLADRMGTAYLQKILNQQLTNHIRDTLPGLRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFAVDFEKRIEGSGDQVDTYELSGGAKINRIFHERFPFEMVKLESDEKTLRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIGQIKEPCQKCVDMVIGELVNTVRQCTQKLAQYPMLREEMERIVTQHIRDRESRTKDQVLLLIDIELAYVNTNHEDFIGFANAQQKSSQLSKKKAAGNQDEIMVIRKGWLTINNIGIMKGGAKEYWFVLTAETLSWYKDDEEKEKKYMLPVDNLKLKDIEKSFMSSKHIFALFSTEHR-NVYKDYRQLELASESQEEVDSWKASFLRAGVYPERSVDKEKAEAEDSNSDSQIHSLDPQLERQVEIVRNLVDSYLSIIHRTVRDLIPKTIMHLMVNNTKEFIHADLLAHLYSCGDQNTLMEESQEQAQRRDEMLRMYHALREGLNIIGDISTTTVTTTAPPPVDDSWLQVTGMPCGRRSP 774          
BLAST of Dynamin 2 vs. Planmine SMEST
Match: SMESG000027378.1 (SMESG000027378.1)

HSP 1 Score: 1353.96 bits (3503), Expect = 0.000e+0
Identity = 657/659 (99.70%), Postives = 657/659 (99.70%), Query Frame = 3
Query:  510 VLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNPVKNMGNQIIRKGWLSLATATSLTKKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPETNDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNPRRVSAASNRAPPAIPGSKPNNMLPQPLI 2486
            VLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKP DPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNPVKNMGNQIIRKGWLSLATATSLTKKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPETNDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKII NVVTATVSEPAPPPVVNEWPKANGFTESRVNPRRVSAASNRAPPAIPGSKPNNMLPQPLI
Sbjct:    4 VLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPNDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNPVKNMGNQIIRKGWLSLATATSLTKKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYPETNDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIIGNVVTATVSEPAPPPVVNEWPKANGFTESRVNPRRVSAASNRAPPAIPGSKPNNMLPQPLI 662          
BLAST of Dynamin 2 vs. Planmine SMEST
Match: SMESG000067156.1 (SMESG000067156.1)

HSP 1 Score: 971.074 bits (2509), Expect = 0.000e+0
Identity = 472/784 (60.20%), Postives = 606/784 (77.30%), Query Frame = 3
Query:  123 MAYNIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNPVKN-MGNQIIRKGWLSLATATSL-TKKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYP-----ETNDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNPRRVSAASNRAPPAIPGS 2453
            M  N  ME LIP+VN+LQDAF+  GI  ++DLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL  S +E AEF+H + KKFTDFD+VR+EIE ETDR+TG NKG+SS+PINL+VYSPHVLNLTLIDLPG+TKV VGDQP DIE+QIR MI+EFIT EN +ILAVSPANSD+ANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAREILEN+LLPLRRGYIG+VNRSQKDI+G+KDI+ A+  ERKFF SHPSY HMA++MGT YLQKVLNQQL NHIR+TLP LRN +Q+QL+++EK+V E++NI+P DPSYK K+L+L   +F  +F + ++G G + DT  L+GG  INK+FHE FPYE+ K + DEK+LR EI  AIKNIHG+RTGLFTPDMAFE IV+ QI  L+ P++KCID V+SEL+ ++     K+ ++PRL++ IER V Q+++ K+ RTKDQ+ ML+ IQLSY+NTNHEDFIGF NA++K+ +  KN +GNQIIRKGWL++     L +   +FWF+L  ++LTWYKDE+E E KF++ LE LR++D +S  +G K+  +L+N D+K NV+KD+K L+L    +  MD WKA+FLRAG+YP     E+N+ +  +N    D +LERQVE +RNLV SY+ II     D +PK + H ++++V++F   DL+ +L    +   LMEES E +Q+RE++LR+Y+A+K  L+IIS V T T+S P PPPV NEW  A             S++ N+ PP  PG 
Sbjct:    1 MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSK-NVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEA-DNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN-----------SSSFNQMPPPSPGG 771          
BLAST of Dynamin 2 vs. Planmine SMEST
Match: SMESG000067156.1 (SMESG000067156.1)

HSP 1 Score: 970.304 bits (2507), Expect = 0.000e+0
Identity = 472/784 (60.20%), Postives = 606/784 (77.30%), Query Frame = 3
Query:  123 MAYNIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNPVKN-MGNQIIRKGWLSLATATSL-TKKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYP-----ETNDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNPRRVSAASNRAPPAIPGS 2453
            M  N  ME LIP+VN+LQDAF+  GI  ++DLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL  S +E AEF+H + KKFTDFD+VR+EIE ETDR+TG NKG+SS+PINL+VYSPHVLNLTLIDLPG+TKV VGDQP DIE+QIR MI+EFIT EN +ILAVSPANSD+ANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAREILEN+LLPLRRGYIG+VNRSQKDI+G+KDI+ A+  ERKFF SHPSY HMA++MGT YLQKVLNQQL NHIR+TLP LRN +Q+QL+++EK+V E++NI+P DPSYK K+L+L   +F  +F + ++G G + DT  L+GG  INK+FHE FPYE+ K + DEK+LR EI  AIKNIHG+RTGLFTPDMAFE IV+ QI  L+ P++KCID V+SEL+ ++     K+ ++PRL++ IER V Q+++ K+ RTKDQ+ ML+ IQLSY+NTNHEDFIGF NA++K+ +  KN +GNQIIRKGWL++     L +   +FWF+L  ++LTWYKDE+E E KF++ LE LR++D +S  +G K+  +L+N D+K NV+KD+K L+L    +  MD WKA+FLRAG+YP     E+N+ +  +N    D +LERQVE +RNLV SY+ II     D +PK + H ++++V++F   DL+ +L    +   LMEES E +Q+RE++LR+Y+A+K  L+IIS V T T+S P PPPV NEW  A             S++ N+ PP  PG 
Sbjct:    1 MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSK-NVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEA-DNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN-----------SSSFNQMPPPSPGG 771          
BLAST of Dynamin 2 vs. Planmine SMEST
Match: SMESG000067156.1 (SMESG000067156.1)

HSP 1 Score: 970.304 bits (2507), Expect = 0.000e+0
Identity = 472/784 (60.20%), Postives = 606/784 (77.30%), Query Frame = 3
Query:  123 MAYNIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNPVKN-MGNQIIRKGWLSLATATSL-TKKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYP-----ETNDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNPRRVSAASNRAPPAIPGS 2453
            M  N  ME LIP+VN+LQDAF+  GI  ++DLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL  S +E AEF+H + KKFTDFD+VR+EIE ETDR+TG NKG+SS+PINL+VYSPHVLNLTLIDLPG+TKV VGDQP DIE+QIR MI+EFIT EN +ILAVSPANSD+ANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAREILEN+LLPLRRGYIG+VNRSQKDI+G+KDI+ A+  ERKFF SHPSY HMA++MGT YLQKVLNQQL NHIR+TLP LRN +Q+QL+++EK+V E++NI+P DPSYK K+L+L   +F  +F + ++G G + DT  L+GG  INK+FHE FPYE+ K + DEK+LR EI  AIKNIHG+RTGLFTPDMAFE IV+ QI  L+ P++KCID V+SEL+ ++     K+ ++PRL++ IER V Q+++ K+ RTKDQ+ ML+ IQLSY+NTNHEDFIGF NA++K+ +  KN +GNQIIRKGWL++     L +   +FWF+L  ++LTWYKDE+E E KF++ LE LR++D +S  +G K+  +L+N D+K NV+KD+K L+L    +  MD WKA+FLRAG+YP     E+N+ +  +N    D +LERQVE +RNLV SY+ II     D +PK + H ++++V++F   DL+ +L    +   LMEES E +Q+RE++LR+Y+A+K  L+IIS V T T+S P PPPV NEW  A             S++ N+ PP  PG 
Sbjct:    1 MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSK-NVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEA-DNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN-----------SSSFNQMPPPSPGG 771          
BLAST of Dynamin 2 vs. Planmine SMEST
Match: SMESG000067156.1 (SMESG000067156.1)

HSP 1 Score: 961.829 bits (2485), Expect = 0.000e+0
Identity = 472/796 (59.30%), Postives = 606/796 (76.13%), Query Frame = 3
Query:  123 MAYNIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRREIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQPHDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLRTIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIRKAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNKMQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGRDTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVRTGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSYPRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNADKKADNPVKN-MGNQ------------IIRKGWLSLATATSL-TKKNEFWFILKAESLTWYKDEKENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDLATHDKGNMDSWKAAFLRAGVYP-----ETNDEDGEENHEPKDSMLERQVEIVRNLVHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLMEESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKANGFTESRVNPRRVSAASNRAPPAIPGS 2453
            M  N  ME LIP+VN+LQDAF+  GI  ++DLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRP +LQL  S +E AEF+H + KKFTDFD+VR+EIE ETDR+TG NKG+SS+PINL+VYSPHVLNLTLIDLPG+TKV VGDQP DIE+QIR MI+EFIT EN +ILAVSPANSD+ANSDALK+AK+VDPQGLRTIGVITKLDLMD+GTDAREILEN+LLPLRRGYIG+VNRSQKDI+G+KDI+ A+  ERKFF SHPSY HMA++MGT YLQKVLNQQL NHIR+TLP LRN +Q+QL+++EK+V E++NI+P DPSYK K+L+L   +F  +F + ++G G + DT  L+GG  INK+FHE FPYE+ K + DEK+LR EI  AIKNIHG+RTGLFTPDMAFE IV+ QI  L+ P++KCID V+SEL+ ++     K+ ++PRL++ IER V Q+++ K+ RTKDQ+ ML+ IQLSY+NTNHEDFIGF NA++K+ +  KN +GNQ            IIRKGWL++     L +   +FWF+L  ++LTWYKDE+E E KF++ LE LR++D +S  +G K+  +L+N D+K NV+KD+K L+L    +  MD WKA+FLRAG+YP     E+N+ +  +N    D +LERQVE +RNLV SY+ II     D +PK + H ++++V++F   DL+ +L    +   LMEES E +Q+RE++LR+Y+A+K  L+IIS V T T+S P PPPV NEW  A             S++ N+ PP  PG 
Sbjct:    1 MEGNSGMEMLIPIVNKLQDAFSSIGIPINLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLNFSNSEYAEFIHCKNKKFTDFDEVRKEIEAETDRLTGSNKGISSVPINLRVYSPHVLNLTLIDLPGLTKVAVGDQPPDIEKQIRSMIMEFITLENCLILAVSPANSDIANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDIKLALASERKFFMSHPSYRHMADRMGTGYLQKVLNQQLTNHIRETLPQLRNNLQSQLLSMEKEVTEYRNIRPDDPSYKTKALLLTVQKFETEFCQAIDGTGSEIDTHTLSGGALINKIFHERFPYELVKIECDEKQLRTEISYAIKNIHGIRTGLFTPDMAFETIVRKQIDKLKGPTIKCIDLVISELIKVVHDCTAKMENFPRLREEIERIVTQQLKEKEVRTKDQLIMLVNIQLSYMNTNHEDFIGFANAEQKSSDSGKNKLGNQVSRNVTAPAFVPIIRKGWLTIQNIPVLRSGGRDFWFMLNTDTLTWYKDEEEKEVKFVLPLEGLRIRDVESGFWGKKYIFALFNPDSK-NVYKDYKQLELVAESQELMDCWKASFLRAGIYPVKQESESNNTEA-DNSIQGDPVLERQVETIRNLVESYMRIINKTQRDLVPKTIMHMIVNEVKQFFRGDLLPMLYQCGDPTTLMEESAEELQKREEMLRMYDAMKEALEIISEVSTGTISTPVPPPVTNEWLSAEN-----------SSSFNQMPPPSPGG 783          
The following BLAST results are available for this feature:
BLAST of Dynamin 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNM30.000e+058.77dynamin 3 [Source:HGNC Symbol;Acc:HGNC:29125][more]
DNM30.000e+058.48dynamin 3 [Source:HGNC Symbol;Acc:HGNC:29125][more]
DNM10.000e+057.99dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972][more]
DNM30.000e+058.04dynamin 3 [Source:HGNC Symbol;Acc:HGNC:29125][more]
DNM10.000e+057.95dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972][more]
back to top
BLAST of Dynamin 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyn-10.000e+056.52Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055][more]
dyn-10.000e+056.52Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055][more]
drp-11.981e-13845.61Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-11.981e-13845.61Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-11.981e-13845.61Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Dynamin 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shi0.000e+054.76gene:FBgn0003392 transcript:FBtr0301596[more]
shi0.000e+054.76gene:FBgn0003392 transcript:FBtr0301597[more]
shi0.000e+054.92gene:FBgn0003392 transcript:FBtr0301595[more]
shi0.000e+054.92gene:FBgn0003392 transcript:FBtr0301594[more]
shi0.000e+054.92gene:FBgn0003392 transcript:FBtr0074123[more]
back to top
BLAST of Dynamin 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnm1a0.000e+059.61dynamin 1a [Source:NCBI gene;Acc:100307098][more]
dnm1a0.000e+059.21dynamin 1a [Source:NCBI gene;Acc:100307098][more]
dnm1b0.000e+058.27dynamin 1b [Source:ZFIN;Acc:ZDB-GENE-100920-3][more]
dnm1b0.000e+058.06dynamin 1b [Source:ZFIN;Acc:ZDB-GENE-100920-3][more]
dnm2a0.000e+059.33dynamin 2a [Source:ZFIN;Acc:ZDB-GENE-050913-84][more]
back to top
BLAST of Dynamin 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ei240.000e+058.06etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-... [more]
ei240.000e+056.77etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-... [more]
dcbld20.000e+058.33discoidin, CUB and LCCL domain containing 2 [Sourc... [more]
dcbld20.000e+057.77discoidin, CUB and LCCL domain containing 2 [Sourc... [more]
dcbld20.000e+057.99discoidin, CUB and LCCL domain containing 2 [Sourc... [more]
back to top
BLAST of Dynamin 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnm30.000e+058.80dynamin 3 [Source:MGI Symbol;Acc:MGI:1341299][more]
Dnm30.000e+058.51dynamin 3 [Source:MGI Symbol;Acc:MGI:1341299][more]
Dnm10.000e+057.99dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
Dnm10.000e+057.95dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
Dnm10.000e+057.95dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
back to top
BLAST of Dynamin 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BZ98|DYN3_MOUSE0.000e+058.51Dynamin-3 OS=Mus musculus OX=10090 GN=Dnm3 PE=1 SV... [more]
sp|Q08877|DYN3_RAT0.000e+057.95Dynamin-3 OS=Rattus norvegicus OX=10116 GN=Dnm3 PE... [more]
sp|Q9UQ16|DYN3_HUMAN0.000e+058.04Dynamin-3 OS=Homo sapiens OX=9606 GN=DNM3 PE=1 SV=... [more]
sp|P21575|DYN1_RAT0.000e+057.95Dynamin-1 OS=Rattus norvegicus OX=10116 GN=Dnm1 PE... [more]
sp|Q08DF4|DYN1_BOVIN0.000e+057.95Dynamin-1 OS=Bos taurus OX=9913 GN=DNM1 PE=2 SV=1[more]
back to top
BLAST of Dynamin 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4W6FJ530.000e+060.13Uncharacterized protein OS=Lates calcarifer OX=818... [more]
A0A4W6FKT50.000e+059.43Uncharacterized protein OS=Lates calcarifer OX=818... [more]
A0A3Q3MNF50.000e+059.61Uncharacterized protein OS=Mastacembelus armatus O... [more]
A0A4W6FLJ30.000e+059.95Uncharacterized protein OS=Lates calcarifer OX=818... [more]
A0A2K5QV250.000e+058.85Dynamin 3 OS=Cebus capucinus imitator OX=1737458 G... [more]
back to top
BLAST of Dynamin 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnm1a0.000e+059.71dynamin-1 [Source:NCBI gene;Acc:103024863][more]
dnm1a0.000e+059.71dynamin-1 [Source:NCBI gene;Acc:103024863][more]
dnm1a0.000e+059.71dynamin-1 [Source:NCBI gene;Acc:103024863][more]
dnm1b0.000e+058.37dynamin-1 [Source:NCBI gene;Acc:103047879][more]
dnm1b0.000e+058.06dynamin-1 [Source:NCBI gene;Acc:103047879][more]
back to top
BLAST of Dynamin 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006976.10.000e+066.47pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1... [more]
ENSPMAT00000002816.19.246e-14644.88pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-... [more]
mxb5.124e-6632.59myxovirus (influenza) resistance B [Source:NCBI ge... [more]
ENSPMAT00000007915.14.092e-5635.10pep scaffold:Pmarinus_7.0:GL487011:231:8254:1 gene... [more]
ENSPMAT00000002195.16.884e-4537.76pep scaffold:Pmarinus_7.0:GL484008:1783:12172:-1 g... [more]
back to top
BLAST of Dynamin 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
DNM11.472e-16037.61Dynamin-related GTPase involved in mitochondrial o... [more]
VPS11.231e-15046.49Dynamin-like GTPase required for vacuolar sorting;... [more]
MGM14.463e-5146.82Mitochondrial GTPase, present in complex with Ugo1... [more]
back to top
BLAST of Dynamin 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO321910.000e+067.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348955.555e-15447.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433485.827e-6244.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403591.233e-2628.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynamin 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnm1a0.000e+059.23dynamin 1 [Source:NCBI gene;Acc:101157793][more]
dnm1a0.000e+058.92dynamin 1 [Source:NCBI gene;Acc:101157793][more]
dnm1a0.000e+058.16dynamin 1 [Source:NCBI gene;Acc:101157793][more]
dnm1a0.000e+058.67dynamin 1 [Source:NCBI gene;Acc:101157793][more]
ENSORLT00000022076.20.000e+058.73dynamin-1 [Source:NCBI gene;Acc:101154874][more]
back to top
BLAST of Dynamin 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027378.10.000e+099.70SMESG000027378.1[more]
SMESG000067156.10.000e+060.20SMESG000067156.1[more]
SMESG000067156.10.000e+060.20SMESG000067156.1[more]
SMESG000067156.10.000e+060.20SMESG000067156.1[more]
SMESG000067156.10.000e+059.30SMESG000067156.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004594 ID=SMED30004594|Name=Dynamin 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2671bp
GTCGAATTTTTTAAAATTAGGAAATTGAATTAAAACTTTTAGTTATTTAG
ATTTATTATATATATTTATAATATTATTAAATATTATTTACTGTATTGTA
AATTTATCACTAATTTTAAATAATGGCGTATAATATTGAAATGGAAAAGC
TTATACCTCTTGTAAATCAATTACAAGATGCTTTTACATTAGCTGGAATT
AGTGGTAGTATTGATTTACCTCAAATTGCAGTAGTTGGAAGTCAGAGTGC
TGGAAAAAGTAGTGTTTTGGAAAATTTCGTTGGCAGAGATTTTCTTCCAC
GTGGTAGTGGTATCGTAACTCGTAGGCCTTGTATTCTGCAATTAATTAAC
TCTCCTACAGAGAGTGCCGAATTTCTTCATTTACGCGGTAAAAAGTTCAC
AGATTTCGATCAAGTAAGGCGTGAAATTGAGGTTGAAACTGATCGAGTAA
CCGGTAAAAATAAAGGATTGTCGTCTATTCCAATCAACTTAAAGGTCTAT
TCTCCCCATGTGCTAAATCTCACTCTTATCGATTTACCTGGCATAACAAA
AGTGCCAGTTGGAGATCAACCCCATGATATTGAAGAACAAATCAGACGAA
TGATTTTGGAATTTATTACTAACGAAAATACCATTATCCTTGCAGTTTCT
CCTGCAAATTCAGATTTGGCGAATTCTGATGCCTTAAAAATGGCAAAAGA
TGTCGATCCGCAAGGGTTACGTACAATCGGAGTGATTACTAAACTAGATT
TAATGGACAAAGGGACTGATGCTCGTGAGATTTTGGAAAATAGGCTCTTG
CCATTGAGAAGAGGTTATATTGGTATTGTTAATAGAAGTCAGAAAGATAT
CGAAGGAAGAAAAGATATTAGAAAAGCGATGGAAGACGAAAGAAAATTCT
TTACGTCTCATCCAAGTTACAGTCACATGGCTAACAAAATGGGCACTCAT
TATTTGCAAAAAGTTCTCAACCAACAACTTATAAATCATATTCGTGACAC
TTTGCCTTCTTTACGAAATAAAATGCAAACTCAATTAATGACAATTGAAA
AAGATGTCGAGGAATTTAAAAACATAAAGCCCACTGATCCCAGTTATAAA
CCAAAATCTCTCATATTGCATACTATGAGGTTCTGTAAAGACTTTGACAA
AGAAGTCGAGGGTGCCGGCCGTGATACCGATACTGACCAGTTAACTGGAG
GAACCAAAATTAATAAACTTTTCCATGAGATGTTTCCTTATGAAATAGCA
AAGAAAGATTTTGATGAGAAAAAATTACGCAAAGAAATTGGAACAGCTAT
AAAAAATATTCACGGAGTTCGTACTGGTTTATTTACACCGGATATGGCAT
TTGAGGCCATCGTTAAATTGCAGATTAAAGATTTGGAAGAGCCGTCAGTG
AAATGCATTGACTCTGTTGTTAGTGAACTTATGGATATTATTAGAAGGAG
CGCAACAAAAATTTCAAGCTATCCTCGTTTACAAGATGCAATAGAGAGAC
AGGTTTTGCAAGAAGTCAGGAATAAGCAATCACGAACTAAGGATCAAATA
AAGATGCTTATCAAGATTCAGTTGTCATACATCAATACGAATCATGAAGA
TTTTATAGGATTTAATAATGCTGACAAAAAGGCCGATAATCCAGTGAAAA
ATATGGGCAATCAAATCATTCGAAAGGGATGGCTGTCATTGGCCACTGCT
ACATCTCTTACAAAGAAAAATGAATTCTGGTTTATTTTGAAAGCAGAATC
ACTTACTTGGTATAAAGACGAAAAAGAAAATGAGAAAAAGTTTATTGTTA
CTCTTGAAAATCTAAGATTGAAGGATTCTGATAGTCGTATGTTTGGACCA
AAATTTCAAATATCTCTTTATAATCGTGACAATAAAACTAATGTATTTAA
AGATCATAAAACTCTTGATTTGGCTACTCACGATAAAGGAAACATGGATT
CTTGGAAGGCGGCATTTTTACGAGCTGGAGTTTACCCCGAAACCAATGAT
GAAGATGGCGAAGAAAATCACGAGCCTAAAGATTCAATGCTTGAACGACA
AGTTGAAATCGTAAGAAACTTGGTTCATTCTTACATAACAATTATAAGGA
CAGAGCATTGCGATTATTTACCCAAGGCTGTTTCACATTGTCTAATTTCC
AAAGTCAGGGAATTCCTGAACAATGATTTGATATCCATTCTGCTGTCGCA
GGAAAATGTGGATCATTTAATGGAAGAATCAATTGAAGTAATTCAACGTC
GAGAAGATTTACTCAGAATTTATGAAGCTTTAAAGGCTGGCTTAAAAATT
ATAAGCAATGTTGTAACAGCTACTGTTAGTGAGCCTGCTCCTCCTCCAGT
TGTAAATGAATGGCCGAAGGCAAATGGTTTTACCGAATCAAGAGTAAACC
CCAGAAGAGTTAGTGCAGCATCTAACCGAGCGCCACCAGCAATTCCAGGT
AGCAAACCTAATAACATGCTCCCTCAACCTTTAATTCCATTGCGTCCTAA
CACTTCAAATCCAAATTTGTTAAGTAATAATGCTCCTCCAGTTCCCCCAA
GACCATCTTGAAACCAGAAGGATTATTTTATTGAAAATTTATTAACTCAG
ATAAAAACTAAATTTCTGTAACAATATTAACTTTTATTTATTTTCACTTC
TTTACTTGTTAATCATGAACG
back to top

protein sequence of SMED30004594-orf-1

>SMED30004594-orf-1 ID=SMED30004594-orf-1|Name=SMED30004594-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=813bp
MAYNIEMEKLIPLVNQLQDAFTLAGISGSIDLPQIAVVGSQSAGKSSVLE
NFVGRDFLPRGSGIVTRRPCILQLINSPTESAEFLHLRGKKFTDFDQVRR
EIEVETDRVTGKNKGLSSIPINLKVYSPHVLNLTLIDLPGITKVPVGDQP
HDIEEQIRRMILEFITNENTIILAVSPANSDLANSDALKMAKDVDPQGLR
TIGVITKLDLMDKGTDAREILENRLLPLRRGYIGIVNRSQKDIEGRKDIR
KAMEDERKFFTSHPSYSHMANKMGTHYLQKVLNQQLINHIRDTLPSLRNK
MQTQLMTIEKDVEEFKNIKPTDPSYKPKSLILHTMRFCKDFDKEVEGAGR
DTDTDQLTGGTKINKLFHEMFPYEIAKKDFDEKKLRKEIGTAIKNIHGVR
TGLFTPDMAFEAIVKLQIKDLEEPSVKCIDSVVSELMDIIRRSATKISSY
PRLQDAIERQVLQEVRNKQSRTKDQIKMLIKIQLSYINTNHEDFIGFNNA
DKKADNPVKNMGNQIIRKGWLSLATATSLTKKNEFWFILKAESLTWYKDE
KENEKKFIVTLENLRLKDSDSRMFGPKFQISLYNRDNKTNVFKDHKTLDL
ATHDKGNMDSWKAAFLRAGVYPETNDEDGEENHEPKDSMLERQVEIVRNL
VHSYITIIRTEHCDYLPKAVSHCLISKVREFLNNDLISILLSQENVDHLM
EESIEVIQRREDLLRIYEALKAGLKIISNVVTATVSEPAPPPVVNEWPKA
NGFTESRVNPRRVSAASNRAPPAIPGSKPNNMLPQPLIPLRPNTSNPNLL
SNNAPPVPPRPS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR022812Dynamin_SF
IPR003130GED
IPR001401Dynamin_GTPase
IPR001849PH_domain
IPR000375Dynamin_central
IPR027417P-loop_NTPase
IPR011993PH-like_dom_sf
IPR019762Dynamin_GTPase_CS
IPR020850GED_dom
IPR030381G_DYNAMIN_dom
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0005515protein binding
GO:0008017microtubule binding
GO:0008022protein C-terminus binding
GO:0016787hydrolase activity
GO:0019901protein kinase binding
GO:0031749D2 dopamine receptor binding
GO:0032403protein complex binding
GO:0042802identical protein binding
GO:0046983protein dimerization activity
GO:0050998nitric-oxide synthase binding
Vocabulary: biological process
TermDefinition
GO:0000266mitochondrial fission
GO:0002031G-protein coupled receptor internalization
GO:0003374dynamin family protein polymerization involved in mitochondrial fission
GO:0006897endocytosis
GO:0006898receptor-mediated endocytosis
GO:0007032endosome organization
GO:0007605sensory perception of sound
GO:0008344adult locomotory behavior
GO:0016185synaptic vesicle budding from presynaptic endocytic zone membrane
GO:0031623receptor internalization
GO:0051262protein tetramerization
GO:0051932synaptic transmission, GABAergic
GO:0061025membrane fusion
GO:0072583clathrin-dependent endocytosis
GO:1901998toxin transport
GO:1903423positive regulation of synaptic vesicle recycling
Vocabulary: cellular component
TermDefinition
GO:0001917photoreceptor inner segment
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005886plasma membrane
GO:0008021synaptic vesicle
GO:0030117membrane coat
GO:0031966mitochondrial membrane
GO:0043196varicosity
GO:0043209myelin sheath
GO:0043234protein complex
GO:0045202synapse
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 139..159
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..567
e-value: 3.6E-194
score: 648.6
NoneNo IPR availableGENE3DG3DSA:1.20.120.1240coord: 160..542
e-value: 3.6E-194
score: 648.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 596..653
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 628..642
NoneNo IPR availablePANTHERPTHR11566:SF54DYNAMIN-3coord: 1..598
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 355..462
IPR022812Dynamin superfamilyPRINTSPR00195DYNAMINcoord: 18..36
score: 64.66
coord: 37..53
score: 76.47
coord: 60..79
score: 46.33
IPR022812Dynamin superfamilyPFAMPF00350Dynamin_Ncoord: 1..48
e-value: 4.3E-11
score: 43.1
IPR022812Dynamin superfamilyPANTHERPTHR11566DYNAMINcoord: 1..598
IPR001401Dynamin, GTPase domainSMARTSM00053dynamin_3coord: 1..87
e-value: 4.1E-7
score: -8.0
IPR001401Dynamin, GTPase domainCDDcd08771DLP_1coord: 1..136
e-value: 9.11367E-61
score: 202.475
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 356..463
e-value: 3.9E-8
score: 43.0
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 357..457
e-value: 1.8E-7
score: 31.6
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 355..461
score: 11.281
IPR003130Dynamin GTPase effectorSMARTSM00302GED_2coord: 480..571
e-value: 2.2E-11
score: 53.8
IPR003130Dynamin GTPase effectorPFAMPF02212GEDcoord: 482..570
e-value: 1.2E-18
score: 67.1
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 338..482
e-value: 3.6E-194
score: 648.6
IPR000375Dynamin central domainPFAMPF01031Dynamin_Mcoord: 58..343
e-value: 1.4E-93
score: 313.3
IPR030381Dynamin-type guanine nucleotide-binding (G) domainPROSITEPS51718G_DYNAMIN_2coord: 1..136
score: 33.127
IPR020850GTPase effector domainPROSITEPS51388GEDcoord: 485..576
score: 21.413
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1..144