SMED30004593

Overview
NameSMED30004593
Smed IDSMED30004593
Length (bp)3643
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30004593 (SMED30004593) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30004593 (SMED30004593) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30004593 (SMED30004593) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30004593 (SMED30004593) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004593

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30004593h1SMcG0022441 SmedASXL_002930SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30004593h1SMcG0022441 SmedASXL_000277SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30004593h1SMcG0022441 SmedASXL_007182SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30004593h1SMcG0022441 SmedASXL_007183SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30004593h1SMcG0022441 SmedASXL_000277SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30004593h1SMcG0022441 dd_Smed_v4_19022_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004593h1SMcG0022441 dd_Smed_v4_19022_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004593h1SMcG0022441 dd_Smed_v4_21084_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004593h1SMcG0022441 Contig40637uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004593h1SMcG0022441 Contig40637newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30004593h1SMcG0022441 dd_Smed_v4_15248_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004593h1SMcG0022441 dd_Smed_v4_15248_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004593h1SMcG0022441 dd_Smed_v4_15248_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004593h1SMcG0022441 dd_Smed_v4_15248_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30004593h1SMcG0022441 dd_Smed_v6_19022_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30004593h1SMcG0022441 dd_Smed_v4_19022_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30004593h1SMcG0022441 dd_Smed_v4_21084_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004593h1SMcG0022441 SMED_34045_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30004593h1SMcG0022441 SMED_34045_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30004593 vs. Planmine SMEST
Match: SMESG000009948.1 (SMESG000009948.1)

HSP 1 Score: 1006.9 bits (2602), Expect = 0.000e+0
Identity = 594/602 (98.67%), Postives = 597/602 (99.17%), Query Frame = 1
Query: 1606 DLQQNLDDKSSELDSIKSEIVESRKLSKSVRVNLESERDRLQKALTTRETQFSEEKAQLIVNLEKERHEKLKYKEHYEGVICKLENNMKIADELSKKEYDELNVEYNRLMEQLKGSQLGYARSVXXXXXXXXXXXXXXXVLINRLEELEPLENKIDXXXXXXXXXXXXXNALEKSVSARELKNLRLEIITNKEAITIMEKEKKELISKLMSLENKVKNQIQHINEVTVGRNEYKNRLNNLQDQIYNFESLDKTRLLKIENIEREIESIKSENVSLKSRYLKLREISETHLEKVNLSHEETVSNYIDRIGSLTRDVANFQEQIQLLTAEKNMFKEDNNALKRSLSEVTSQFNNLKTVLQEHTANEVRTKYSENNRYTRMSYWDARPQMSRYLPPMXXXXXXXXXXXXXXPKSKLRFESYVFNPYSCEDESDISLVREFTQSVPGCEKKTIKSDGNLSQISSSTKKKKEGIRHQIATRIRRSLHLD---GGGGSSELKFPEKNTHIEINPTXXXXXXXXXXXXXXXTSKPPALLRKKYAKSSQFNVIDLDEFRNRXXXXXXXXXXXXXXXXHENVLSVSNTPTLNAVSSTSVNSLFDRNPGANE 3402
            DLQQNLDDKSSELDSIKSEIVESRKLSKSVRVNLESERDRLQKALTTRETQFSEEK+QLIVNLEKERHEKLKYKEHYEGVICKLENNMKIADELSKKEYDELNVEYNRLMEQLKGSQLGYARSVEELKQKELEYQKEKEVLINRLEELEPLENKIDELELTTERLLKKLNALEKSVSARELKNLRLEIITNKEAITI+EKEKKELISKLMSLENKVKNQIQHINEVTVGRNEYKNRLNNLQDQIYNFESLDKTRLLKIENIEREIESIKSENVSLKSRYLKLREISETHLEKVNLSHEETVSNYIDRIGSLTRDVAN QEQ+QLLTAEKNMFKEDNNALKRSLSEVTSQFNNLKTVLQEHTANEVRTKYSENNRYTRMSYWDARPQMSRYLPPMNSLDTNSLSDLNLNPKSKLRFESYVFNPYSCEDESDISLVREFTQSVPGCEKKTIKSDGNLSQISSSTKKKKEGIRHQIATRIRRSLHLD   GGGGSSELKFPEKNTHIEINPTSSSIKSESIASSVKVTSKPPALLRKKYAKSSQFNVIDLDEFRNRKEKIILKSPSKSKKFKHENVLSVSNTPTLNAVSSTSVNSLFDRNPG NE
Sbjct: 1561 DLQQNLDDKSSELDSIKSEIVESRKLSKSVRVNLESERDRLQKALTTRETQFSEEKSQLIVNLEKERHEKLKYKEHYEGVICKLENNMKIADELSKKEYDELNVEYNRLMEQLKGSQLGYARSVEELKQKELEYQKEKEVLINRLEELEPLENKIDELELTTERLLKKLNALEKSVSARELKNLRLEIITNKEAITILEKEKKELISKLMSLENKVKNQIQHINEVTVGRNEYKNRLNNLQDQIYNFESLDKTRLLKIENIEREIESIKSENVSLKSRYLKLREISETHLEKVNLSHEETVSNYIDRIGSLTRDVANLQEQVQLLTAEKNMFKEDNNALKRSLSEVTSQFNNLKTVLQEHTANEVRTKYSENNRYTRMSYWDARPQMSRYLPPMNSLDTNSLSDLNLNPKSKLRFESYVFNPYSCEDESDISLVREFTQSVPGCEKKTIKSDGNLSQISSSTKKKKEGIRHQIATRIRRSLHLDGGGGGGGSSELKFPEKNTHIEINPTSSSIKSESIASSVKVTSKPPALLRKKYAKSSQFNVIDLDEFRNRKEKIILKSPSKSKKFKHENVLSVSNTPTLNAVSSTSVNSLFDRNPGENE 2162          

HSP 2 Score: 947.192 bits (2447), Expect = 0.000e+0
Identity = 501/514 (97.47%), Postives = 508/514 (98.83%), Query Frame = 3
Query:    3 KIIYEELILKGNLEEMIKQKDKEINIKCMELQIENEEKIKLENDLIRSKNEIVILGENNSVKIIELIDFHEKQQIESKGYLTKQVEEISNXXXXXXXXXXXXSKNNDTIIQLGKQLEEMTTKHHDVSVSVDYLKIIDDKYVELSKIHQELEWRFEKSIKENLDSISGKNIEIDEMKTEINRFMKLEHEWNRDSEEKNARLSNLQQEVITTRSTIECLRQKHSKLDEENLLVKENFSKINNEHYLDIVEKNKNIDELNCRLLALDHSNRLLEDSAKDYSEKIALFEAAVTNKTKEIDIVNEKFAASLVDIEELKSRLKSQIDSEHSKENKIENLATKCELLQREKINLKGSIVDLNFEIAEIRKSNELKQMTIDNARKESEIEIDSLQKTVSNLGSQLEALQLELKSIAREKEAKSHELNTANMSLVDFHSKIQNLEAIISEEMQNYEKVTEEYKQAERESNCYREKYNNLMKLKRDESLSYESQLKKLTEHINKTEEEHDNQIHQMEKSFNSKV 1544
            KIIY ELILKGNL+E+IKQKD+EINIKCMELQI NEEKIKLENDLIRSKNEIVILGENNSVKIIELIDFHEK+QIESKGYLTKQVEEISNLKLLIEEKEQEISKNNDTIIQLGKQLEEMTTKHHDVSV VDYLKIIDDKYVELSKI+QELEWRFEKSIKENLDSISGKNIEIDEMKTEINRFMKLE EWNRDSEEKNARLSNLQQEVITTRSTIECLRQKHSKLDEENLLVKENF+KINNEHYLDIVEKNKNIDELNCRLLALDHSNRLLEDSAKDYSEKIALFEAAVTNKTKEIDIVNEKFA SLVDIEELKSRLKSQIDSEHSKENKIENLATKCE LQREKINLKGSIVDLNFEIAEIRKSNELKQMTIDNARKESEIEIDSLQKTVSNLGSQLEALQLELKSIAREKEAKSHELNTANMSLVDFHSKIQNLEAIISEEMQNYEKVTEEYKQAERESNCYREKYNNLMKLKRDESLSYESQLKKLTEHINKTEEEHDNQIHQMEKSFNSK+
Sbjct: 1046 KIIYGELILKGNLDEIIKQKDEEINIKCMELQIINEEKIKLENDLIRSKNEIVILGENNSVKIIELIDFHEKKQIESKGYLTKQVEEISNLKLLIEEKEQEISKNNDTIIQLGKQLEEMTTKHHDVSVEVDYLKIIDDKYVELSKIYQELEWRFEKSIKENLDSISGKNIEIDEMKTEINRFMKLEQEWNRDSEEKNARLSNLQQEVITTRSTIECLRQKHSKLDEENLLVKENFNKINNEHYLDIVEKNKNIDELNCRLLALDHSNRLLEDSAKDYSEKIALFEAAVTNKTKEIDIVNEKFAVSLVDIEELKSRLKSQIDSEHSKENKIENLATKCEQLQREKINLKGSIVDLNFEIAEIRKSNELKQMTIDNARKESEIEIDSLQKTVSNLGSQLEALQLELKSIAREKEAKSHELNTANMSLVDFHSKIQNLEAIISEEMQNYEKVTEEYKQAERESNCYREKYNNLMKLKRDESLSYESQLKKLTEHINKTEEEHDNQIHQMEKSFNSKI 1559          

HSP 3 Score: 100.138 bits (248), Expect = 8.113e-21
Identity = 54/59 (91.53%), Postives = 55/59 (93.22%), Query Frame = 3
Query:   12 YEELILKGNLEEMIKQKDKEINIKCMELQIENEEKIKLENDLIRSKNEIVILGENNSVK 188
            YEELILK NLEEMIKQKDKEINIKCMELQIENEEKIKLENDLIRSKNEI +LGE NS K
Sbjct:  955 YEELILKENLEEMIKQKDKEINIKCMELQIENEEKIKLENDLIRSKNEIELLGERNSEK 1013          

HSP 4 Score: 89.3521 bits (220), Expect = 1.400e-17
Identity = 48/57 (84.21%), Postives = 53/57 (92.98%), Query Frame = 3
Query:    3 KIIYEELILKGNLEEMIKQKDKEINIKCMELQIENEEKIKLENDLIRSKNEIVILGE 173
            KIIYEEL LK NLEE+IKQKDKEINIKCMEL+I  +EKIKLENDLIR+KNEIVILG+
Sbjct:  858 KIIYEELKLKENLEEIIKQKDKEINIKCMELEIVIDEKIKLENDLIRTKNEIVILGD 914          
BLAST of SMED30004593 vs. Planmine SMEST
Match: SMESG000009948.1 (SMESG000009948.1)

HSP 1 Score: 1006.51 bits (2601), Expect = 0.000e+0
Identity = 594/602 (98.67%), Postives = 597/602 (99.17%), Query Frame = 1
Query: 1606 DLQQNLDDKSSELDSIKSEIVESRKLSKSVRVNLESERDRLQKALTTRETQFSEEKAQLIVNLEKERHEKLKYKEHYEGVICKLENNMKIADELSKKEYDELNVEYNRLMEQLKGSQLGYARSVXXXXXXXXXXXXXXXVLINRLEELEPLENKIDXXXXXXXXXXXXXNALEKSVSARELKNLRLEIITNKEAITIMEKEKKELISKLMSLENKVKNQIQHINEVTVGRNEYKNRLNNLQDQIYNFESLDKTRLLKIENIEREIESIKSENVSLKSRYLKLREISETHLEKVNLSHEETVSNYIDRIGSLTRDVANFQEQIQLLTAEKNMFKEDNNALKRSLSEVTSQFNNLKTVLQEHTANEVRTKYSENNRYTRMSYWDARPQMSRYLPPMXXXXXXXXXXXXXXPKSKLRFESYVFNPYSCEDESDISLVREFTQSVPGCEKKTIKSDGNLSQISSSTKKKKEGIRHQIATRIRRSLHLD---GGGGSSELKFPEKNTHIEINPTXXXXXXXXXXXXXXXTSKPPALLRKKYAKSSQFNVIDLDEFRNRXXXXXXXXXXXXXXXXHENVLSVSNTPTLNAVSSTSVNSLFDRNPGANE 3402
            DLQQNLDDKSSELDSIKSEIVESRKLSKSVRVNLESERDRLQKALTTRETQFSEEK+QLIVNLEKERHEKLKYKEHYEGVICKLENNMKIADELSKKEYDELNVEYNRLMEQLKGSQLGYARSVEELKQKELEYQKEKEVLINRLEELEPLENKIDELELTTERLLKKLNALEKSVSARELKNLRLEIITNKEAITI+EKEKKELISKLMSLENKVKNQIQHINEVTVGRNEYKNRLNNLQDQIYNFESLDKTRLLKIENIEREIESIKSENVSLKSRYLKLREISETHLEKVNLSHEETVSNYIDRIGSLTRDVAN QEQ+QLLTAEKNMFKEDNNALKRSLSEVTSQFNNLKTVLQEHTANEVRTKYSENNRYTRMSYWDARPQMSRYLPPMNSLDTNSLSDLNLNPKSKLRFESYVFNPYSCEDESDISLVREFTQSVPGCEKKTIKSDGNLSQISSSTKKKKEGIRHQIATRIRRSLHLD   GGGGSSELKFPEKNTHIEINPTSSSIKSESIASSVKVTSKPPALLRKKYAKSSQFNVIDLDEFRNRKEKIILKSPSKSKKFKHENVLSVSNTPTLNAVSSTSVNSLFDRNPG NE
Sbjct: 1563 DLQQNLDDKSSELDSIKSEIVESRKLSKSVRVNLESERDRLQKALTTRETQFSEEKSQLIVNLEKERHEKLKYKEHYEGVICKLENNMKIADELSKKEYDELNVEYNRLMEQLKGSQLGYARSVEELKQKELEYQKEKEVLINRLEELEPLENKIDELELTTERLLKKLNALEKSVSARELKNLRLEIITNKEAITILEKEKKELISKLMSLENKVKNQIQHINEVTVGRNEYKNRLNNLQDQIYNFESLDKTRLLKIENIEREIESIKSENVSLKSRYLKLREISETHLEKVNLSHEETVSNYIDRIGSLTRDVANLQEQVQLLTAEKNMFKEDNNALKRSLSEVTSQFNNLKTVLQEHTANEVRTKYSENNRYTRMSYWDARPQMSRYLPPMNSLDTNSLSDLNLNPKSKLRFESYVFNPYSCEDESDISLVREFTQSVPGCEKKTIKSDGNLSQISSSTKKKKEGIRHQIATRIRRSLHLDGGGGGGGSSELKFPEKNTHIEINPTSSSIKSESIASSVKVTSKPPALLRKKYAKSSQFNVIDLDEFRNRKEKIILKSPSKSKKFKHENVLSVSNTPTLNAVSSTSVNSLFDRNPGENE 2164          

HSP 2 Score: 947.192 bits (2447), Expect = 0.000e+0
Identity = 501/514 (97.47%), Postives = 508/514 (98.83%), Query Frame = 3
Query:    3 KIIYEELILKGNLEEMIKQKDKEINIKCMELQIENEEKIKLENDLIRSKNEIVILGENNSVKIIELIDFHEKQQIESKGYLTKQVEEISNXXXXXXXXXXXXSKNNDTIIQLGKQLEEMTTKHHDVSVSVDYLKIIDDKYVELSKIHQELEWRFEKSIKENLDSISGKNIEIDEMKTEINRFMKLEHEWNRDSEEKNARLSNLQQEVITTRSTIECLRQKHSKLDEENLLVKENFSKINNEHYLDIVEKNKNIDELNCRLLALDHSNRLLEDSAKDYSEKIALFEAAVTNKTKEIDIVNEKFAASLVDIEELKSRLKSQIDSEHSKENKIENLATKCELLQREKINLKGSIVDLNFEIAEIRKSNELKQMTIDNARKESEIEIDSLQKTVSNLGSQLEALQLELKSIAREKEAKSHELNTANMSLVDFHSKIQNLEAIISEEMQNYEKVTEEYKQAERESNCYREKYNNLMKLKRDESLSYESQLKKLTEHINKTEEEHDNQIHQMEKSFNSKV 1544
            KIIY ELILKGNL+E+IKQKD+EINIKCMELQI NEEKIKLENDLIRSKNEIVILGENNSVKIIELIDFHEK+QIESKGYLTKQVEEISNLKLLIEEKEQEISKNNDTIIQLGKQLEEMTTKHHDVSV VDYLKIIDDKYVELSKI+QELEWRFEKSIKENLDSISGKNIEIDEMKTEINRFMKLE EWNRDSEEKNARLSNLQQEVITTRSTIECLRQKHSKLDEENLLVKENF+KINNEHYLDIVEKNKNIDELNCRLLALDHSNRLLEDSAKDYSEKIALFEAAVTNKTKEIDIVNEKFA SLVDIEELKSRLKSQIDSEHSKENKIENLATKCE LQREKINLKGSIVDLNFEIAEIRKSNELKQMTIDNARKESEIEIDSLQKTVSNLGSQLEALQLELKSIAREKEAKSHELNTANMSLVDFHSKIQNLEAIISEEMQNYEKVTEEYKQAERESNCYREKYNNLMKLKRDESLSYESQLKKLTEHINKTEEEHDNQIHQMEKSFNSK+
Sbjct: 1048 KIIYGELILKGNLDEIIKQKDEEINIKCMELQIINEEKIKLENDLIRSKNEIVILGENNSVKIIELIDFHEKKQIESKGYLTKQVEEISNLKLLIEEKEQEISKNNDTIIQLGKQLEEMTTKHHDVSVEVDYLKIIDDKYVELSKIYQELEWRFEKSIKENLDSISGKNIEIDEMKTEINRFMKLEQEWNRDSEEKNARLSNLQQEVITTRSTIECLRQKHSKLDEENLLVKENFNKINNEHYLDIVEKNKNIDELNCRLLALDHSNRLLEDSAKDYSEKIALFEAAVTNKTKEIDIVNEKFAVSLVDIEELKSRLKSQIDSEHSKENKIENLATKCEQLQREKINLKGSIVDLNFEIAEIRKSNELKQMTIDNARKESEIEIDSLQKTVSNLGSQLEALQLELKSIAREKEAKSHELNTANMSLVDFHSKIQNLEAIISEEMQNYEKVTEEYKQAERESNCYREKYNNLMKLKRDESLSYESQLKKLTEHINKTEEEHDNQIHQMEKSFNSKI 1561          

HSP 3 Score: 100.138 bits (248), Expect = 8.115e-21
Identity = 54/59 (91.53%), Postives = 55/59 (93.22%), Query Frame = 3
Query:   12 YEELILKGNLEEMIKQKDKEINIKCMELQIENEEKIKLENDLIRSKNEIVILGENNSVK 188
            YEELILK NLEEMIKQKDKEINIKCMELQIENEEKIKLENDLIRSKNEI +LGE NS K
Sbjct:  957 YEELILKENLEEMIKQKDKEINIKCMELQIENEEKIKLENDLIRSKNEIELLGERNSEK 1015          

HSP 4 Score: 89.3521 bits (220), Expect = 1.400e-17
Identity = 48/57 (84.21%), Postives = 53/57 (92.98%), Query Frame = 3
Query:    3 KIIYEELILKGNLEEMIKQKDKEINIKCMELQIENEEKIKLENDLIRSKNEIVILGE 173
            KIIYEEL LK NLEE+IKQKDKEINIKCMEL+I  +EKIKLENDLIR+KNEIVILG+
Sbjct:  860 KIIYEELKLKENLEEIIKQKDKEINIKCMELEIVIDEKIKLENDLIRTKNEIVILGD 916          
The following BLAST results are available for this feature:
BLAST of SMED30004593 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004593 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004593 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004593 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004593 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004593 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004593 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004593 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004593 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004593 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004593 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004593 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004593 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004593 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000009948.18.113e-2198.67SMESG000009948.1[more]
SMESG000009948.18.115e-2198.67SMESG000009948.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004593 ID=SMED30004593|Name=SMED30004593|organism=Schmidtea mediterranea sexual|type=transcript|length=3643bp
ATAAAATTATATATGAAGAATTAATATTGAAAGGCAATTTGGAAGAAATG
ATAAAACAGAAAGATAAGGAGATAAATATAAAATGTATGGAATTGCAAAT
TGAAAACGAAGAAAAAATCAAATTGGAAAATGATCTAATCCGAAGTAAAA
ACGAAATAGTTATTTTAGGAGAAAATAATTCAGTGAAGATTATAGAATTA
ATAGATTTTCATGAAAAACAACAGATAGAAAGCAAGGGATATTTGACGAA
ACAAGTTGAAGAAATATCGAATCTGAAGCTATTAATTGAAGAGAAAGAAC
AAGAGATTAGTAAAAATAATGACACTATAATTCAATTAGGAAAACAGTTA
GAGGAAATGACAACTAAGCACCATGACGTTTCGGTTTCGGTTGATTATTT
GAAAATAATCGATGATAAATACGTAGAATTGTCCAAAATCCACCAGGAGC
TCGAATGGAGATTTGAGAAGTCTATAAAGGAAAATTTAGATTCAATTAGT
GGGAAAAATATTGAAATTGATGAAATGAAAACCGAAATAAATAGATTCAT
GAAACTGGAACATGAATGGAATCGCGACAGTGAAGAAAAGAATGCGAGAT
TGTCTAATTTACAGCAGGAAGTGATTACAACAAGATCAACGATCGAATGC
CTGAGACAGAAACACTCGAAACTGGACGAGGAAAATTTATTGGTGAAGGA
GAATTTCAGTAAAATTAATAATGAACACTACTTGGATATTGTGGAGAAGA
ACAAGAACATTGATGAATTGAACTGTAGATTATTGGCATTGGATCATTCT
AATCGATTGTTAGAAGATTCCGCTAAGGACTACTCGGAAAAGATAGCGCT
ATTTGAGGCTGCAGTCACCAATAAAACCAAGGAAATCGATATCGTGAATG
AGAAATTTGCTGCTTCCCTAGTGGATATTGAGGAGTTGAAATCAAGGCTC
AAATCTCAAATCGACAGTGAGCACTCAAAGGAGAACAAAATTGAAAACCT
TGCAACAAAATGTGAACTATTACAAAGGGAGAAAATCAATTTAAAAGGTT
CAATTGTCGATTTGAATTTTGAAATTGCGGAAATTAGGAAATCTAATGAA
CTAAAGCAAATGACAATTGATAATGCGCGCAAGGAATCAGAAATAGAAAT
CGATTCATTACAGAAGACGGTATCAAATCTTGGTAGTCAATTGGAGGCGT
TACAGTTAGAACTGAAGTCGATTGCCAGAGAAAAAGAAGCAAAATCTCAC
GAATTGAATACAGCTAATATGTCACTTGTTGATTTCCATTCTAAAATCCA
GAATCTCGAAGCCATTATAAGCGAAGAAATGCAAAACTATGAGAAAGTAA
CGGAAGAGTATAAACAAGCGGAACGAGAGTCCAATTGTTATCGTGAAAAA
TACAATAATCTAATGAAACTAAAGCGTGACGAATCATTGAGTTATGAAAG
CCAATTGAAGAAATTAACTGAACATATTAATAAAACGGAAGAGGAACATG
ATAACCAAATTCATCAAATGGAGAAATCTTTTAATTCCAAAGTAAAACTT
TCGGGATTTCCTTCTGCTTATTTCCTTTCTTCATTTCATTTCTTGATAGA
TCTTCGATTTGCAACAAAATCTTGATGATAAATCTTCGGAACTGGACTCG
ATAAAGAGTGAAATCGTCGAGAGTCGCAAACTCAGTAAATCGGTTCGTGT
GAATCTTGAATCGGAAAGAGATCGGTTACAGAAAGCACTAACGACACGTG
AAACGCAATTTTCAGAAGAAAAAGCCCAATTGATTGTAAATCTGGAAAAA
GAACGCCATGAGAAATTGAAATACAAGGAGCATTATGAAGGAGTTATTTG
TAAATTGGAAAATAATATGAAAATTGCTGACGAACTCAGTAAAAAGGAAT
ACGATGAATTGAATGTGGAATATAACAGGCTTATGGAACAGTTGAAGGGT
TCTCAATTGGGTTATGCGAGATCAGTCGAAGAGTTGAAACAAAAAGAATT
AGAGTATCAAAAAGAAAAGGAAGTTCTAATAAATCGTCTTGAAGAGCTAG
AACCGCTAGAAAATAAAATCGATGAATTAGAATTGACAACTGAGCGATTA
TTAAAAAAATTGAATGCCTTGGAAAAAAGTGTAAGTGCTAGGGAGTTAAA
AAATCTTAGATTGGAAATTATAACCAATAAAGAAGCAATTACGATAATGG
AAAAAGAAAAAAAGGAATTAATATCAAAACTTATGTCCTTGGAAAATAAA
GTGAAAAATCAAATTCAGCATATTAACGAAGTAACGGTCGGCAGGAATGA
GTATAAAAACAGATTGAACAATCTTCAAGATCAAATCTATAATTTCGAGT
CACTTGACAAAACGAGACTGTTGAAAATTGAAAATATTGAAAGAGAAATC
GAGTCGATCAAATCAGAAAACGTTTCTCTCAAGTCTCGGTATTTGAAGCT
GCGCGAAATTTCAGAAACTCATTTGGAAAAGGTCAATCTAAGTCATGAAG
AGACAGTTAGCAATTATATAGATCGAATTGGCTCCCTCACAAGAGATGTC
GCTAATTTCCAGGAACAAATACAATTATTGACAGCAGAAAAAAATATGTT
TAAAGAAGATAATAATGCTTTGAAGCGATCTCTATCGGAAGTTACCTCAC
AATTCAATAACCTTAAAACCGTTCTGCAGGAGCACACTGCAAATGAAGTT
CGAACCAAATACAGTGAAAATAACCGATACACCCGAATGAGTTACTGGGA
CGCTCGACCACAAATGTCCCGTTATTTACCCCCGATGAATTCCCTCGACA
CAAATTCTCTTTCTGATCTGAATTTAAATCCGAAATCCAAATTACGATTC
GAATCTTATGTTTTTAATCCCTATAGCTGTGAGGATGAATCTGATATAAG
TCTCGTTAGGGAGTTCACTCAATCAGTGCCAGGTTGCGAGAAGAAAACCA
TTAAAAGTGACGGGAATCTCTCCCAAATTTCATCATCAACTAAAAAGAAA
AAAGAAGGAATCCGTCATCAGATTGCCACTAGAATCCGTCGTAGTCTCCA
TTTGGACGGTGGCGGCGGCAGTTCTGAGTTGAAATTTCCCGAGAAAAATA
CCCACATCGAAATAAATCCCACTTCAAGCTCAATTAAATCCGAATCCATC
GCGTCCTCTGTAAAAGTCACGTCGAAACCGCCAGCGTTACTGAGGAAAAA
ATACGCCAAGTCCTCTCAATTCAATGTGATTGATCTTGATGAGTTTAGGA
ATCGGAAAGAGAAAATTATCCTCAAATCTCCAAGCAAATCGAAAAAGTTT
AAACACGAAAATGTGCTTTCTGTTTCGAATACTCCCACTTTGAATGCCGT
TTCATCGACTTCGGTTAATTCTCTGTTCGATAGGAACCCTGGAGCAAATG
AAGATTTACAGGAAAATTCTCCAAGGCAACCTTATAAAATTGCTGAAGTA
GGTTTGCGCCCTTCTCCTTATACTCAGCGGCCAAAAACTCCGAAGCCCAA
TTCAATTATTAGAAGATTGATCCGAAAATCCAAAACCAAAACTCCAATAA
GCAAATGCAATTCTATCGAAAAAATGTTTTAATTTTGAGTTTTATAAGTT
TTCATATTCATTATGTTGATATCGTTATTTTCAATAATATATT
back to top

protein sequence of SMED30004593-orf-1

>SMED30004593-orf-1 ID=SMED30004593-orf-1|Name=SMED30004593-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=541bp
KIIYEELILKGNLEEMIKQKDKEINIKCMELQIENEEKIKLENDLIRSKN
EIVILGENNSVKIIELIDFHEKQQIESKGYLTKQVEEISNLKLLIEEKEQ
EISKNNDTIIQLGKQLEEMTTKHHDVSVSVDYLKIIDDKYVELSKIHQEL
EWRFEKSIKENLDSISGKNIEIDEMKTEINRFMKLEHEWNRDSEEKNARL
SNLQQEVITTRSTIECLRQKHSKLDEENLLVKENFSKINNEHYLDIVEKN
KNIDELNCRLLALDHSNRLLEDSAKDYSEKIALFEAAVTNKTKEIDIVNE
KFAASLVDIEELKSRLKSQIDSEHSKENKIENLATKCELLQREKINLKGS
IVDLNFEIAEIRKSNELKQMTIDNARKESEIEIDSLQKTVSNLGSQLEAL
QLELKSIAREKEAKSHELNTANMSLVDFHSKIQNLEAIISEEMQNYEKVT
EEYKQAERESNCYREKYNNLMKLKRDESLSYESQLKKLTEHINKTEEEHD
NQIHQMEKSFNSKVKLSGFPSAYFLSSFHFLIDLRFATKS*
back to top

protein sequence of SMED30004593-orf-2

>SMED30004593-orf-2 ID=SMED30004593-orf-2|Name=SMED30004593-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=572bp
MKIADELSKKEYDELNVEYNRLMEQLKGSQLGYARSVEELKQKELEYQKE
KEVLINRLEELEPLENKIDELELTTERLLKKLNALEKSVSARELKNLRLE
IITNKEAITIMEKEKKELISKLMSLENKVKNQIQHINEVTVGRNEYKNRL
NNLQDQIYNFESLDKTRLLKIENIEREIESIKSENVSLKSRYLKLREISE
THLEKVNLSHEETVSNYIDRIGSLTRDVANFQEQIQLLTAEKNMFKEDNN
ALKRSLSEVTSQFNNLKTVLQEHTANEVRTKYSENNRYTRMSYWDARPQM
SRYLPPMNSLDTNSLSDLNLNPKSKLRFESYVFNPYSCEDESDISLVREF
TQSVPGCEKKTIKSDGNLSQISSSTKKKKEGIRHQIATRIRRSLHLDGGG
GSSELKFPEKNTHIEINPTSSSIKSESIASSVKVTSKPPALLRKKYAKSS
QFNVIDLDEFRNRKEKIILKSPSKSKKFKHENVLSVSNTPTLNAVSSTSV
NSLFDRNPGANEDLQENSPRQPYKIAEVGLRPSPYTQRPKTPKPNSIIRR
LIRKSKTKTPISKCNSIEKMF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000419prepharyngeal region
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 31..51
NoneNo IPR availableCOILSCoilCoilcoord: 358..417
NoneNo IPR availableCOILSCoilCoilcoord: 81..115
NoneNo IPR availableCOILSCoilCoilcoord: 323..350
NoneNo IPR availableCOILSCoilCoilcoord: 478..505
NoneNo IPR availableCOILSCoilCoilcoord: 432..473
NoneNo IPR availableCOILSCoilCoilcoord: 186..220
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 360..469