Ras-related protein Rab-27A

Overview
NameRas-related protein Rab-27A
Smed IDSMED30004590
Length (bp)1249
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-related protein Rab-27A (SMED30004590) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-related protein Rab-27A (SMED30004590) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-related protein Rab-27A (SMED30004590) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-related protein Rab-27A (SMED30004590) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004590

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30004590SMESG000023446.1 dd_Smed_v4_2678_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30004590SMESG000023446.1 dd_Smed_v4_2678_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004590SMESG000023446.1 dd_Smed_v4_2678_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30004590SMESG000023446.1 dd_Smed_v4_2678_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-related protein Rab-27A vs. Ensembl Human
Match: RAB27B (RAB27B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9767])

HSP 1 Score: 262.307 bits (669), Expect = 6.727e-86
Identity = 129/218 (59.17%), Postives = 164/218 (75.23%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQ-PEKKCGC 760
            DYDYLIKLLALGDS VGKT+ LY+YTD  FNP+F +TVG+DFR+KR+V  + +  +G  G+  K+HLQLWDTAGQERFRSL T F RDAMGFLL+FDLT+++S  N R W+  L A+AYCE PD+VL+GNKADL +QR V+  QA  +A + G+ Y ETSAATG NVE  +  LLD++M R+E+ V K ++   DTV  G +SGN + E+ PEKKC C
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNA-QGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQI--PDTVN-GGNSGNLDGEKPPEKKCIC 218          
BLAST of Ras-related protein Rab-27A vs. Ensembl Human
Match: RAB27A (RAB27A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9766])

HSP 1 Score: 261.922 bits (668), Expect = 1.087e-85
Identity = 125/218 (57.34%), Postives = 160/218 (73.39%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEK-KCGC 760
            DYDYLIK LALGDS VGKTS+LYQYTDG FN +F +TVG+DFR+KR+V  +    DG  G+ Q++HLQLWDTAGQERFRSL T F RDAMGFLL+FDLTNE+S  N R W+  L  HAYCE PD+VL GNK+DL +QRVV  E+A  +A++ G+ Y ETSAA G N+   + +LLD++M R+E+ V K+ + +G     G +S +  +E+ EK  CGC
Sbjct:    5 DYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRAS-GPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC 221          
BLAST of Ras-related protein Rab-27A vs. Ensembl Human
Match: RAB27A (RAB27A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9766])

HSP 1 Score: 261.922 bits (668), Expect = 1.087e-85
Identity = 125/218 (57.34%), Postives = 160/218 (73.39%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEK-KCGC 760
            DYDYLIK LALGDS VGKTS+LYQYTDG FN +F +TVG+DFR+KR+V  +    DG  G+ Q++HLQLWDTAGQERFRSL T F RDAMGFLL+FDLTNE+S  N R W+  L  HAYCE PD+VL GNK+DL +QRVV  E+A  +A++ G+ Y ETSAA G N+   + +LLD++M R+E+ V K+ + +G     G +S +  +E+ EK  CGC
Sbjct:    5 DYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRAS-GPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC 221          
BLAST of Ras-related protein Rab-27A vs. Ensembl Human
Match: RAB27A (RAB27A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9766])

HSP 1 Score: 261.922 bits (668), Expect = 1.087e-85
Identity = 125/218 (57.34%), Postives = 160/218 (73.39%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEK-KCGC 760
            DYDYLIK LALGDS VGKTS+LYQYTDG FN +F +TVG+DFR+KR+V  +    DG  G+ Q++HLQLWDTAGQERFRSL T F RDAMGFLL+FDLTNE+S  N R W+  L  HAYCE PD+VL GNK+DL +QRVV  E+A  +A++ G+ Y ETSAA G N+   + +LLD++M R+E+ V K+ + +G     G +S +  +E+ EK  CGC
Sbjct:    5 DYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRAS-GPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC 221          
BLAST of Ras-related protein Rab-27A vs. Ensembl Human
Match: RAB27A (RAB27A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9766])

HSP 1 Score: 261.922 bits (668), Expect = 1.087e-85
Identity = 125/218 (57.34%), Postives = 160/218 (73.39%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEK-KCGC 760
            DYDYLIK LALGDS VGKTS+LYQYTDG FN +F +TVG+DFR+KR+V  +    DG  G+ Q++HLQLWDTAGQERFRSL T F RDAMGFLL+FDLTNE+S  N R W+  L  HAYCE PD+VL GNK+DL +QRVV  E+A  +A++ G+ Y ETSAA G N+   + +LLD++M R+E+ V K+ + +G     G +S +  +E+ EK  CGC
Sbjct:    5 DYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRAS-GPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC 221          
BLAST of Ras-related protein Rab-27A vs. Ensembl Celegans
Match: aex-6 (Rab27 [Source:UniProtKB/TrEMBL;Acc:G5EBS5])

HSP 1 Score: 230.335 bits (586), Expect = 6.726e-74
Identity = 116/214 (54.21%), Postives = 151/214 (70.56%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKL---------LDGDTVRLGTSSGN 724
            DYDYLIK LALGDS VGKTS L++YTD  F  +F STVG+DF++K++V +S R      G+ Q++ LQLWDTAGQERFRSL T F RDAMGF+L+FD+TNE+S  N R+WL  L  HAYCE+PD+++ GNKADL N+R VS  +A+++A +LG+ Y ETSA T  NVE ++  LLD+VM RI++SV  + L         LDGD     +   N
Sbjct:    3 DYDYLIKFLALGDSGVGKTSFLHRYTDNTFTGQFISTVGIDFKEKKVVYKSSRGG--FGGRGQRVLLQLWDTAGQERFRSLTTAFFRDAMGFILIFDITNEQSFLNIRDWLSQLKVHAYCEQPDIIICGNKADLENRRQVSTARAKQLADQLGLPYFETSACTSTNVEKSVDCLLDLVMQRIQQSVETSSLPLSECRGVSLDGDPSAASSYCAN 214          
BLAST of Ras-related protein Rab-27A vs. Ensembl Celegans
Match: rab-3 (Ras-related protein Rab-3 [Source:UniProtKB/Swiss-Prot;Acc:Q94986])

HSP 1 Score: 167.933 bits (424), Expect = 1.035e-49
Identity = 82/220 (37.27%), Postives = 137/220 (62.27%), Query Frame = 2
Query:  101 PNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 760
            P+ ++DY+ KLL +G+S+VGKTS L++Y D  F   F STVG+DF+ K + R   R           + LQ+WDTAGQER+R++ T + R AMGF+L++D+TNE S  + ++W   +  +++ E   VVLVGNK D+ ++RVVS+++  ++A +LG+++ ETSA    NV+     L++++ D++ +S+ K+        +L  +     A+Q   +C C
Sbjct:   15 PDQNFDYMFKLLIIGNSSVGKTSFLFRYCDDSFTSAFVSTVGIDFKVKTVFRGDKR-----------VKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNSVQDWCTQIKTYSW-ENAQVVLVGNKCDMDSERVVSMDRGRQLADQLGLEFFETSAKENINVKAVFEKLVEIICDKMAESLDKDPQQQPKGQKLEANPTQKPAQQ---QCNC 219          
BLAST of Ras-related protein Rab-27A vs. Ensembl Celegans
Match: rab-3 (Ras-related protein Rab-3 [Source:UniProtKB/Swiss-Prot;Acc:Q94986])

HSP 1 Score: 168.318 bits (425), Expect = 1.240e-49
Identity = 82/220 (37.27%), Postives = 137/220 (62.27%), Query Frame = 2
Query:  101 PNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 760
            P+ ++DY+ KLL +G+S+VGKTS L++Y D  F   F STVG+DF+ K + R   R           + LQ+WDTAGQER+R++ T + R AMGF+L++D+TNE S  + ++W   +  +++ E   VVLVGNK D+ ++RVVS+++  ++A +LG+++ ETSA    NV+     L++++ D++ +S+ K+        +L  +     A+Q   +C C
Sbjct:   29 PDQNFDYMFKLLIIGNSSVGKTSFLFRYCDDSFTSAFVSTVGIDFKVKTVFRGDKR-----------VKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNSVQDWCTQIKTYSW-ENAQVVLVGNKCDMDSERVVSMDRGRQLADQLGLEFFETSAKENINVKAVFEKLVEIICDKMAESLDKDPQQQPKGQKLEANPTQKPAQQ---QCNC 233          
BLAST of Ras-related protein Rab-27A vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 155.606 bits (392), Expect = 5.074e-45
Identity = 76/184 (41.30%), Postives = 120/184 (65.22%), Query Frame = 2
Query:  113 YDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKS 664
            YDYL KLL +GDS VGKT +L++++D  FN  F ST+G+DF+ + I      + DG     +K+ LQ+WDTAGQERFR++ T + R AMG +LV+D+TNERS  N + W++ +  HA  +  + +++GNK D+  +R VS ++ E++A E G K++ETSA    N++     L   +  ++E++
Sbjct:    5 YDYLFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTI------ELDG-----KKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASD-VERMIIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIKSKMEQN 176          
BLAST of Ras-related protein Rab-27A vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 155.606 bits (392), Expect = 5.074e-45
Identity = 76/184 (41.30%), Postives = 120/184 (65.22%), Query Frame = 2
Query:  113 YDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKS 664
            YDYL KLL +GDS VGKT +L++++D  FN  F ST+G+DF+ + I      + DG     +K+ LQ+WDTAGQERFR++ T + R AMG +LV+D+TNERS  N + W++ +  HA  +  + +++GNK D+  +R VS ++ E++A E G K++ETSA    N++     L   +  ++E++
Sbjct:    5 YDYLFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTI------ELDG-----KKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASD-VERMIIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIKSKMEQN 176          
BLAST of Ras-related protein Rab-27A vs. Ensembl Fly
Match: Rab27 (gene:FBgn0025382 transcript:FBtr0070294)

HSP 1 Score: 216.853 bits (551), Expect = 2.933e-68
Identity = 107/193 (55.44%), Postives = 132/193 (68.39%), Query Frame = 2
Query:  104 NDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKL 682
            N DYDYL+K L LGDS VGKT LLYQYTDG F+ +F STVG+DFR+KR++  S        G+R ++HLQ+WDTAGQERFRSL T F RDAMGFLL+FDLT+E+S      WL  L  HAY E PDVVL GNK DL   RVVS +Q   + +   + Y+ETSA TG NV+  + LL+  VM+RIE +    + 
Sbjct:    5 NIDYDYLLKFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSR-------GRRHRIHLQIWDTAGQERFRSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIENAACNREF 190          
BLAST of Ras-related protein Rab-27A vs. Ensembl Fly
Match: Rab27 (gene:FBgn0025382 transcript:FBtr0070293)

HSP 1 Score: 202.216 bits (513), Expect = 1.404e-62
Identity = 100/185 (54.05%), Postives = 125/185 (67.57%), Query Frame = 2
Query:  128 KLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKL 682
            + L LGDS VGKT LLYQYTDG F+ +F STVG+DFR+KR++  S        G+R ++HLQ+WDTAGQERFRSL T F RDAMGFLL+FDLT+E+S      WL  L  HAY E PDVVL GNK DL   RVVS +Q   + +   + Y+ETSA TG NV+  + LL+  VM+RIE +    + 
Sbjct:   19 QFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNS-------RGRRHRIHLQIWDTAGQERFRSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIENAACNREF 196          
BLAST of Ras-related protein Rab-27A vs. Ensembl Fly
Match: Rab3 (gene:FBgn0005586 transcript:FBtr0473383)

HSP 1 Score: 170.629 bits (431), Expect = 1.362e-50
Identity = 88/235 (37.45%), Postives = 139/235 (59.15%), Query Frame = 2
Query:   68 GDQMIQESDVPPNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPE----KKCGC 760
            GD   Q+     N  +DY+ KLL +G+S+VGKTS L++Y D  F   F STVG+DF+ K + R   R           + LQ+WDTAGQER+R++ T + R AMGF+L++D+TNE S  + ++W+  +  +++ +   V+LVGNK D+ +QRV+S E+  ++A +LGV++ ETSA    NV+     L+D++ D++ +S+  +  L G     G   G    +QP+      C C
Sbjct:    5 GDPKWQKDAADQN--FDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKR-----------VKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSW-DNAQVILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVG-----GGQKGQRLTDQPQGTPNANCNC 220          
BLAST of Ras-related protein Rab-27A vs. Ensembl Fly
Match: Rab3 (gene:FBgn0005586 transcript:FBtr0088257)

HSP 1 Score: 170.629 bits (431), Expect = 1.362e-50
Identity = 88/235 (37.45%), Postives = 139/235 (59.15%), Query Frame = 2
Query:   68 GDQMIQESDVPPNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPE----KKCGC 760
            GD   Q+     N  +DY+ KLL +G+S+VGKTS L++Y D  F   F STVG+DF+ K + R   R           + LQ+WDTAGQER+R++ T + R AMGF+L++D+TNE S  + ++W+  +  +++ +   V+LVGNK D+ +QRV+S E+  ++A +LGV++ ETSA    NV+     L+D++ D++ +S+  +  L G     G   G    +QP+      C C
Sbjct:    5 GDPKWQKDAADQN--FDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKR-----------VKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSW-DNAQVILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVG-----GGQKGQRLTDQPQGTPNANCNC 220          
BLAST of Ras-related protein Rab-27A vs. Ensembl Fly
Match: Rab10 (gene:FBgn0015789 transcript:FBtr0077337)

HSP 1 Score: 159.458 bits (402), Expect = 1.846e-46
Identity = 77/180 (42.78%), Postives = 120/180 (66.67%), Query Frame = 2
Query:  113 YDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDR 652
            YD L KLL +GDS VGKT +L++++D  F   F ST+G+DF+ K +          L G+  K+ LQ+WDTAGQERF ++ T + R AMG +LV+D+TNE+S  N  +WL+ +  HA  E  + +++GNK D+T++RVV+ E+ E +A+E G+++METSA +  N+E     L + ++D+
Sbjct:    6 YDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTV---------ELRGK--KIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHAN-EDVEKMILGNKCDMTDKRVVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDK 173          
BLAST of Ras-related protein Rab-27A vs. Ensembl Zebrafish
Match: rab27a (RAB27A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-050913-46])

HSP 1 Score: 263.077 bits (671), Expect = 2.100e-86
Identity = 127/219 (57.99%), Postives = 156/219 (71.23%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGN-TEAEQPEK-KCGC 760
            DYDYLIK LALGDS VGKTS LYQYTD  FN +F +TVG+DFR+KR+V +S    DG  G+ Q++H+QLWDTAGQERFRSL T F RDAMGFLL+FDLTNE+S  N R W+  L  HAYCE PD+VL GNK+DL  QR V  E A  +A++ GV Y ETSAA G NV   + +LLD++M R+E+ V K+ + DG     G S+ + TE   PE+ KC C
Sbjct:    5 DYDYLIKFLALGDSGVGKTSFLYQYTDSKFNSKFITTVGIDFREKRVVYKSS-GPDGTAGRGQRIHIQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWMSQLQTHAYCENPDIVLCGNKSDLEEQRAVKAENARELAEKYGVPYFETSAANGENVSRAVEVLLDLIMKRMERCVDKSWIPDGTVRSNGHSTADLTEPHDPEQSKCAC 222          
BLAST of Ras-related protein Rab-27A vs. Ensembl Zebrafish
Match: rab27b (RAB27B, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-120215-85])

HSP 1 Score: 253.062 bits (645), Expect = 1.871e-82
Identity = 125/228 (54.82%), Postives = 158/228 (69.30%), Query Frame = 2
Query:   77 MIQESDVPPNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 760
            M   S    + DYDYLIKLLALGDS VGKT+ LY+YTD  FNP+F +TVG+DFR+KR+V  +    +G  G+  K+HLQLWDTAGQERFRSL T F RDAMGFLL+FDLT+++S  N R W+  L A+AYCE PD+VLVGNKADL +QR V  +QA+ +A + G+ Y ETSAATG+ V+  +  LLD+VM R+E+ V K      D      SS  + A   +KKC C
Sbjct:    1 MFSSSSTMTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYTT-NSPNGTTGKTFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLVGNKADLADQREVQEKQAKELADKYGIPYFETSAATGSEVDKAVVTLLDLVMKRMEQCVEKPS---ADANTSDGSSKLSAAPAQQKKCAC 224          
BLAST of Ras-related protein Rab-27A vs. Ensembl Zebrafish
Match: rab27b (RAB27B, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-120215-85])

HSP 1 Score: 250.751 bits (639), Expect = 1.799e-81
Identity = 123/217 (56.68%), Postives = 155/217 (71.43%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 760
            DYDYLIKLLALGDS VGKT+ LY+YTD  FNP+F +TVG+DFR+KR+V  +    +G  G+  K+HLQLWDTAGQERFRSL T F RDAMGFLL+FDLT+++S  N R W+  L A+AYCE PD+VLVGNKADL +QR V  +QA+ +A + G+ Y ETSAATG+ V+  +  LLD+VM R+E+ V K      D      SS  + A   +KKC C
Sbjct:   12 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYTT-NSPNGTTGKTFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLVGNKADLADQREVQEKQAKELADKYGIPYFETSAATGSEVDKAVVTLLDLVMKRMEQCVEKPS---ADANTSDGSSKLSAAPAQQKKCAC 224          
BLAST of Ras-related protein Rab-27A vs. Ensembl Zebrafish
Match: rab3db (RAB3D, member RAS oncogene family, b [Source:ZFIN;Acc:ZDB-GENE-040718-428])

HSP 1 Score: 167.933 bits (424), Expect = 1.876e-49
Identity = 84/223 (37.67%), Postives = 130/223 (58.30%), Query Frame = 2
Query:   98 PPNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTV--RLGTSSGNTEAEQPEKKCGC 760
              + ++DY+ KLL +G+S+VGKTS L++Y D  F   F STVG+DF+ K + R + R           + LQ+WDTAGQER+R++ T + R AMGFLL+FD+TN  S    R+W   +  +++ +   V+LVGNK DL ++R++  E ++R+A ELG ++ E SA    NV+     L+D++ D++ +S      LDGD         S    A++    C C
Sbjct:   16 AADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRNNKR-----------IKLQIWDTAGQERYRTITTAYYRGAMGFLLMFDITNRDSFNAVRDWATQIKTYSW-DNAQVILVGNKCDLEDERLIPTEDSQRLAHELGFQFFEASAKDSINVKQVFECLVDVICDKMTES------LDGDAAVSNHKDCSLQDAADEGHSACAC 220          
BLAST of Ras-related protein Rab-27A vs. Ensembl Zebrafish
Match: rab3ab (RAB3A, member RAS oncogene family, b [Source:ZFIN;Acc:ZDB-GENE-041210-268])

HSP 1 Score: 167.933 bits (424), Expect = 2.020e-49
Identity = 82/222 (36.94%), Postives = 132/222 (59.46%), Query Frame = 2
Query:  104 NDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQ---PEKKCGC 760
            + ++DY+ K+L +G+S+VGKTS L++Y D  F P F STVG+DF+ K I R   R           + LQ+WDTAGQER+R++ T + R AMGF+L++D+TNE S    ++W   +  +++ +   V+LVGNK D+ ++RVV+ E+  ++++ LG +Y E SA    NV+ T   L+D++ +++ +S+        D    G   G    EQ   P + C C
Sbjct:   16 DQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKR-----------IKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFAAVQDWSTQIKTYSW-DNAQVLLVGNKCDMEDERVVASERGRQLSEHLGFEYFEASAKDNINVKQTFERLVDIICEKMSESLDA-----ADPAVTGAKQGPQLTEQPAAPHQDCAC 220          
BLAST of Ras-related protein Rab-27A vs. Ensembl Xenopus
Match: lemd3 (LEM domain containing 3 [Source:Xenbase;Acc:XB-GENE-486033])

HSP 1 Score: 254.988 bits (650), Expect = 4.843e-83
Identity = 123/217 (56.68%), Postives = 160/217 (73.73%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 760
            DYDYLIKLLALGDS VGKT+ LY+YTD  FNP+F +TVG+DFR+KR++  S     G  G+  K+HLQLWDTAGQERFRSL T F RDAMGFLL+FDLT+++S  N R W+  L A+AYCE PD+VL+GNKADL++QR V+  QA+ +A + G+ Y ETSAA+G +VE ++  LLD++M R+E+ V K ++   D V  GTS    EA+   +KC C
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVIY-SNAGPGGTHGKTFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLSDQREVNERQAKELADKYGIPYFETSAASGQDVEKSVDTLLDLIMKRMEQCVDKTQV--PDAVNGGTSGKLDEAKPEGRKCAC 218          
BLAST of Ras-related protein Rab-27A vs. Ensembl Xenopus
Match: lemd3 (LEM domain containing 3 [Source:Xenbase;Acc:XB-GENE-486033])

HSP 1 Score: 254.218 bits (648), Expect = 1.667e-81
Identity = 123/217 (56.68%), Postives = 160/217 (73.73%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 760
            DYDYLIKLLALGDS VGKT+ LY+YTD  FNP+F +TVG+DFR+KR++  S     G  G+  K+HLQLWDTAGQERFRSL T F RDAMGFLL+FDLT+++S  N R W+  L A+AYCE PD+VL+GNKADL++QR V+  QA+ +A + G+ Y ETSAA+G +VE ++  LLD++M R+E+ V K ++   D V  GTS    EA+   +KC C
Sbjct:   95 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVIY-SNAGPGGTHGKTFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLSDQREVNERQAKELADKYGIPYFETSAASGQDVEKSVDTLLDLIMKRMEQCVDKTQV--PDAVNGGTSGKLDEAKPEGRKCAC 308          
BLAST of Ras-related protein Rab-27A vs. Ensembl Xenopus
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:493339])

HSP 1 Score: 248.825 bits (634), Expect = 1.270e-80
Identity = 126/218 (57.80%), Postives = 153/218 (70.18%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEK-KCGC 760
            DYDYLIK LALGDS VGKTS LYQYTD  FN +F +TVG+DFR+KR+V  S    DG+ G+ Q++HLQLWDTAGQERFRSL T F RDAMGFLL+FDLTNE+S  N R W+  L  HAYCE PD+VL GNK DL  QR V  E+A+  A++ G+ Y ETSAA G NV   +  LLD++M R+E+ V K+ +  G     G SS     E+ +K KCGC
Sbjct:    5 DYDYLIKFLALGDSGVGKTSFLYQYTDAKFNSKFITTVGIDFREKRVVYRS-NGPDGISGRGQRVHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWMSQLQVHAYCENPDIVLCGNKCDLDEQRAVKEEEAKEFAEKYGIPYFETSAAIGTNVNKAVETLLDLIMKRMERCVDKSWIPQGVVQSNGHSSTEQLTEEKDKGKCGC 221          
BLAST of Ras-related protein Rab-27A vs. Ensembl Xenopus
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:493339])

HSP 1 Score: 236.884 bits (603), Expect = 3.949e-76
Identity = 117/201 (58.21%), Postives = 145/201 (72.14%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGT 712
            DYDYLIK LALGDS VGKTS LYQYTD  FN +F +TVG+DFR+KR+V  S    DG+ G+ Q++HLQLWDTAGQERFRSL T F RDAMGFLL+FDLTNE+S  N R W+  L  HAYCE PD+VL GNK DL  QR V  E+A+  A++ G+ Y ETSAA G NV   +  LLD++M R+E+++ + K    + +R G 
Sbjct:    5 DYDYLIKFLALGDSGVGKTSFLYQYTDAKFNSKFITTVGIDFREKRVVYRS-NGPDGISGRGQRVHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWMSQLQVHAYCENPDIVLCGNKCDLDEQRAVKEEEAKEFAEKYGIPYFETSAAIGTNVNKAVETLLDLIMKRMERNLGQ-KTCQQNFIRAGA 203          
BLAST of Ras-related protein Rab-27A vs. Ensembl Xenopus
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:493339])

HSP 1 Score: 186.808 bits (473), Expect = 1.076e-56
Identity = 105/220 (47.73%), Postives = 136/220 (61.82%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQER--FRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEK-KCGC 760
            DYDYLIK LALGDS VGKTS LYQYTD  FN +F +TVG+DFR+KR+V  S    DG+ G+ Q++HLQLWDTAGQER  F   C +               +++ L+    ++  L  HAYCE PD+VL GNK DL  QR V  E+A+  A++ G+ Y ETSAA G NV   +  LLD++M R+E+ V K+ +  G     G SS     E+ +K KCGC
Sbjct:    5 DYDYLIKFLALGDSGVGKTSFLYQYTDAKFNSKFITTVGIDFREKRVVYRS-NGPDGISGRGQRVHLQLWDTAGQERHSFPFHCCI---------------SDKLLSLITVFIGQLQVHAYCENPDIVLCGNKCDLDEQRAVKEEEAKEFAEKYGIPYFETSAAIGTNVNKAVETLLDLIMKRMERCVDKSWIPQGVVQSNGHSSTEQLTEEKDKGKCGC 208          
BLAST of Ras-related protein Rab-27A vs. Ensembl Mouse
Match: Rab27b (RAB27B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1931295])

HSP 1 Score: 268.47 bits (685), Expect = 1.570e-88
Identity = 131/218 (60.09%), Postives = 167/218 (76.61%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQP-EKKCGC 760
            DYDYLIKLLALGDS VGKT+ LY+YTD  FNP+F +TVG+DFR+KR+V ++ + ADG  G+  K+HLQLWDTAGQERFRSL T F RDAMGFLL+FDLT+++S  N R W+  L A+AYCE PD+VL+GNKADL +QR V+  QA  +A++ G+ Y ETSAATG NVE ++  LLD++M R+EK V K ++   DTV  G +SG  + E+P EKKC C
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDT-QGADGASGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVEKTQV--PDTVN-GGNSGKLDGEKPAEKKCAC 218          
BLAST of Ras-related protein Rab-27A vs. Ensembl Mouse
Match: Rab27b (RAB27B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1931295])

HSP 1 Score: 268.47 bits (685), Expect = 1.570e-88
Identity = 131/218 (60.09%), Postives = 167/218 (76.61%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQP-EKKCGC 760
            DYDYLIKLLALGDS VGKT+ LY+YTD  FNP+F +TVG+DFR+KR+V ++ + ADG  G+  K+HLQLWDTAGQERFRSL T F RDAMGFLL+FDLT+++S  N R W+  L A+AYCE PD+VL+GNKADL +QR V+  QA  +A++ G+ Y ETSAATG NVE ++  LLD++M R+EK V K ++   DTV  G +SG  + E+P EKKC C
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDT-QGADGASGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVEKTQV--PDTVN-GGNSGKLDGEKPAEKKCAC 218          
BLAST of Ras-related protein Rab-27A vs. Ensembl Mouse
Match: Rab27b (RAB27B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1931295])

HSP 1 Score: 268.47 bits (685), Expect = 1.570e-88
Identity = 131/218 (60.09%), Postives = 167/218 (76.61%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQP-EKKCGC 760
            DYDYLIKLLALGDS VGKT+ LY+YTD  FNP+F +TVG+DFR+KR+V ++ + ADG  G+  K+HLQLWDTAGQERFRSL T F RDAMGFLL+FDLT+++S  N R W+  L A+AYCE PD+VL+GNKADL +QR V+  QA  +A++ G+ Y ETSAATG NVE ++  LLD++M R+EK V K ++   DTV  G +SG  + E+P EKKC C
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDT-QGADGASGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVEKTQV--PDTVN-GGNSGKLDGEKPAEKKCAC 218          
BLAST of Ras-related protein Rab-27A vs. Ensembl Mouse
Match: Rab27a (RAB27A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1861441])

HSP 1 Score: 263.462 bits (672), Expect = 2.099e-86
Identity = 124/218 (56.88%), Postives = 161/218 (73.85%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKK-CGC 760
            DYDYLIK LALGDS VGKTS+LYQYTDG FN +F +TVG+DFR+KR+V  +    DG +G+ Q++HLQLWDTAGQERFRSL T F RDAMGFLL+FDLTNE+S  N R W+  L  HAYCE PD+VL GNK+DL +QR V  E+A  +A++ G+ Y ETSAA G N+ + + +LLD++M R+E+ V K+ + +G     G +S +  +E+ EK  CGC
Sbjct:    5 DYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRA-NGPDGAVGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISHAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHTSADQLSEEKEKGLCGC 221          
BLAST of Ras-related protein Rab-27A vs. Ensembl Mouse
Match: Rab27a (RAB27A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1861441])

HSP 1 Score: 263.462 bits (672), Expect = 2.099e-86
Identity = 124/218 (56.88%), Postives = 161/218 (73.85%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKK-CGC 760
            DYDYLIK LALGDS VGKTS+LYQYTDG FN +F +TVG+DFR+KR+V  +    DG +G+ Q++HLQLWDTAGQERFRSL T F RDAMGFLL+FDLTNE+S  N R W+  L  HAYCE PD+VL GNK+DL +QR V  E+A  +A++ G+ Y ETSAA G N+ + + +LLD++M R+E+ V K+ + +G     G +S +  +E+ EK  CGC
Sbjct:    5 DYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRA-NGPDGAVGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISHAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHTSADQLSEEKEKGLCGC 221          
BLAST of Ras-related protein Rab-27A vs. UniProt/SwissProt
Match: sp|Q99P74|RB27B_RAT (Ras-related protein Rab-27B OS=Rattus norvegicus OX=10116 GN=Rab27b PE=2 SV=3)

HSP 1 Score: 268.855 bits (686), Expect = 1.018e-87
Identity = 131/218 (60.09%), Postives = 167/218 (76.61%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQP-EKKCGC 760
            DYDYLIKLLALGDS VGKT+ LY+YTD  FNP+F +TVG+DFR+KR+V ++ + ADG  G+  K+HLQLWDTAGQERFRSL T F RDAMGFLL+FDLT+++S  N R W+  L A+AYCE PD+VL+GNKADL +QR V+  QA  +A++ G+ Y ETSAATG NVE ++  LLD++M R+EK V K ++   DTV  G +SG  + E+P EKKC C
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDT-QGADGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLLDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVEKTQV--PDTVN-GVNSGKVDGEKPAEKKCAC 218          
BLAST of Ras-related protein Rab-27A vs. UniProt/SwissProt
Match: sp|Q99P58|RB27B_MOUSE (Ras-related protein Rab-27B OS=Mus musculus OX=10090 GN=Rab27b PE=1 SV=3)

HSP 1 Score: 268.47 bits (685), Expect = 1.098e-87
Identity = 131/218 (60.09%), Postives = 167/218 (76.61%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQP-EKKCGC 760
            DYDYLIKLLALGDS VGKT+ LY+YTD  FNP+F +TVG+DFR+KR+V ++ + ADG  G+  K+HLQLWDTAGQERFRSL T F RDAMGFLL+FDLT+++S  N R W+  L A+AYCE PD+VL+GNKADL +QR V+  QA  +A++ G+ Y ETSAATG NVE ++  LLD++M R+EK V K ++   DTV  G +SG  + E+P EKKC C
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDT-QGADGASGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVEKTQV--PDTVN-GGNSGKLDGEKPAEKKCAC 218          
BLAST of Ras-related protein Rab-27A vs. UniProt/SwissProt
Match: sp|Q9ERI2|RB27A_MOUSE (Ras-related protein Rab-27A OS=Mus musculus OX=10090 GN=Rab27a PE=1 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 1.468e-85
Identity = 124/218 (56.88%), Postives = 161/218 (73.85%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKK-CGC 760
            DYDYLIK LALGDS VGKTS+LYQYTDG FN +F +TVG+DFR+KR+V  +    DG +G+ Q++HLQLWDTAGQERFRSL T F RDAMGFLL+FDLTNE+S  N R W+  L  HAYCE PD+VL GNK+DL +QR V  E+A  +A++ G+ Y ETSAA G N+ + + +LLD++M R+E+ V K+ + +G     G +S +  +E+ EK  CGC
Sbjct:    5 DYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRA-NGPDGAVGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISHAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHTSADQLSEEKEKGLCGC 221          
BLAST of Ras-related protein Rab-27A vs. UniProt/SwissProt
Match: sp|O00194|RB27B_HUMAN (Ras-related protein Rab-27B OS=Homo sapiens OX=9606 GN=RAB27B PE=1 SV=4)

HSP 1 Score: 262.307 bits (669), Expect = 3.231e-85
Identity = 129/218 (59.17%), Postives = 164/218 (75.23%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQ-PEKKCGC 760
            DYDYLIKLLALGDS VGKT+ LY+YTD  FNP+F +TVG+DFR+KR+V  + +  +G  G+  K+HLQLWDTAGQERFRSL T F RDAMGFLL+FDLT+++S  N R W+  L A+AYCE PD+VL+GNKADL +QR V+  QA  +A + G+ Y ETSAATG NVE  +  LLD++M R+E+ V K ++   DTV  G +SGN + E+ PEKKC C
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNA-QGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQI--PDTVN-GGNSGNLDGEKPPEKKCIC 218          
BLAST of Ras-related protein Rab-27A vs. UniProt/SwissProt
Match: sp|P51159|RB27A_HUMAN (Ras-related protein Rab-27A OS=Homo sapiens OX=9606 GN=RAB27A PE=1 SV=3)

HSP 1 Score: 261.922 bits (668), Expect = 5.221e-85
Identity = 125/218 (57.34%), Postives = 160/218 (73.39%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEK-KCGC 760
            DYDYLIK LALGDS VGKTS+LYQYTDG FN +F +TVG+DFR+KR+V  +    DG  G+ Q++HLQLWDTAGQERFRSL T F RDAMGFLL+FDLTNE+S  N R W+  L  HAYCE PD+VL GNK+DL +QRVV  E+A  +A++ G+ Y ETSAA G N+   + +LLD++M R+E+ V K+ + +G     G +S +  +E+ EK  CGC
Sbjct:    5 DYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRAS-GPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC 221          
BLAST of Ras-related protein Rab-27A vs. TrEMBL
Match: C1L3U1 (Rab-protein 8 OS=Schistosoma japonicum OX=6182 GN=Rab8 PE=2 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 5.182e-103
Identity = 152/232 (65.52%), Postives = 183/232 (78.88%), Query Frame = 2
Query:   65 MGDQMIQESDVPPNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 760
            MGD +   S   P+D+YDYLIKLLALGDSNVGKTSLLYQYTD +FNPRFT+TVGVDFRQKR+VRES RD++GLLG +Q+LHLQLWDTAGQER+RSLCTVFLRDAMGFLLVFDLTNE SL +CREW+ +L  HAYC++PDVVLVGNK DLT +R VS+  A  +A+EL V Y+ETSAATG  V   +  LLD+VM RIE SV+K + + G+T      + N ++   +  CGC
Sbjct:    1 MGDSLFHNSSAAPDDEYDYLIKLLALGDSNVGKTSLLYQYTDNIFNPRFTTTVGVDFRQKRLVRES-RDSEGLLGPKQRLHLQLWDTAGQERYRSLCTVFLRDAMGFLLVFDLTNESSLQSCREWMNLLCQHAYCDRPDVVLVGNKFDLTKERQVSMSAANAMARELDVPYIETSAATGYQVTAAVDRLLDLVMTRIEASVTKAR-IHGNT----EGTANLKSSTSKSNCGC 226          
BLAST of Ras-related protein Rab-27A vs. TrEMBL
Match: A0A4S2MEA6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000676 PE=4 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 2.714e-100
Identity = 151/232 (65.09%), Postives = 183/232 (78.88%), Query Frame = 2
Query:   65 MGDQMIQESDVPPNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 760
            MGD + QE+    +DDYDYLIKLLALGDSNVGKTSL +QYTD VFNPRFTSTVGVDFRQKRIVRES RDADGLLG +Q+LHLQLWDTAGQER+RSLC+VFLRDAMGFLLVFDLTNE+SL NCREW+ +L  HAYC++PDVVLVGNK DLT++R V +  A  +A+EL V Y+ETSAATG  V   + LLLD VM+++E S+ K+++ +       T+     +++P K   C
Sbjct:    1 MGDSLFQENVGHQDDDYDYLIKLLALGDSNVGKTSLWFQYTDNVFNPRFTSTVGVDFRQKRIVRES-RDADGLLGPKQRLHLQLWDTAGQERYRSLCSVFLRDAMGFLLVFDLTNEKSLYNCREWMDLLCQHAYCDRPDVVLVGNKFDLTSERQVPLSMATAMARELNVPYIETSAATGYQVAAAVDLLLDAVMNKVEASLIKSRIHN------STADAVNLSKRPNKGSSC 225          
BLAST of Ras-related protein Rab-27A vs. TrEMBL
Match: A0A074ZKZ6 (Ras family protein OS=Opisthorchis viverrini OX=6198 GN=T265_05333 PE=4 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 2.714e-100
Identity = 151/232 (65.09%), Postives = 183/232 (78.88%), Query Frame = 2
Query:   65 MGDQMIQESDVPPNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 760
            MGD + QE+    +DDYDYLIKLLALGDSNVGKTSL +QYTD VFNPRFTSTVGVDFRQKRIVRES RDADGLLG +Q+LHLQLWDTAGQER+RSLC+VFLRDAMGFLLVFDLTNE+SL NCREW+ +L  HAYC++PDVVLVGNK DLT++R V +  A  +A+EL V Y+ETSAATG  V   + LLLD VM+++E S+ K+++ +       T+     +++P K   C
Sbjct:    1 MGDSLFQENVGHQDDDYDYLIKLLALGDSNVGKTSLWFQYTDNVFNPRFTSTVGVDFRQKRIVRES-RDADGLLGPKQRLHLQLWDTAGQERYRSLCSVFLRDAMGFLLVFDLTNEKSLYNCREWMDLLCQHAYCDRPDVVLVGNKFDLTSERQVPLSMATAMARELNVPYIETSAATGYQVAAAVDLLLDAVMNKVEASLIKSRIHN------STADAVNLSKRPNKGSSC 225          
BLAST of Ras-related protein Rab-27A vs. TrEMBL
Match: H2KNW4 (Ras-related protein Rab-27A OS=Clonorchis sinensis OX=79923 GN=RAB27A PE=4 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 2.714e-100
Identity = 151/232 (65.09%), Postives = 183/232 (78.88%), Query Frame = 2
Query:   65 MGDQMIQESDVPPNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 760
            MGD + QE+    +DDYDYLIKLLALGDSNVGKTSL +QYTD VFNPRFTSTVGVDFRQKRIVRES RDADGLLG +Q+LHLQLWDTAGQER+RSLC+VFLRDAMGFLLVFDLTNE+SL NCREW+ +L  HAYC++PDVVLVGNK DLT++R V +  A  +A+EL V Y+ETSAATG  V   + LLLD VM+++E S+ K+++ +       T+     +++P K   C
Sbjct:    1 MGDSLFQENVGHQDDDYDYLIKLLALGDSNVGKTSLWFQYTDNVFNPRFTSTVGVDFRQKRIVRES-RDADGLLGPKQRLHLQLWDTAGQERYRSLCSVFLRDAMGFLLVFDLTNEKSLYNCREWMDLLCQHAYCDRPDVVLVGNKFDLTSERQVPLSMATAMARELNVPYIETSAATGYQVAAAVDLLLDAVMNKVEASLIKSRIHN------STADAVNLSKRPNKGSSC 225          
BLAST of Ras-related protein Rab-27A vs. TrEMBL
Match: Q5BYA6 (SJCHGC04801 protein (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=2)

HSP 1 Score: 304.679 bits (779), Expect = 2.201e-99
Identity = 148/220 (67.27%), Postives = 178/220 (80.91%), Query Frame = 2
Query:  101 PNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 760
            P+D+YDYLIKLLALGDSNVGKTSLLYQYTD +FNPRFT+TVGVDFRQKR+VRES RD++GLLG +Q+LHLQLWDTAGQER+RSLCTVFLRDAMGFLLVFDLTNE SL +CREW+ +L  HAYC++PDVVLVGNK DLT +R VS+  A  +A+EL V Y+ETSAATG  V   +  LLD+VM RIE SV+K + + G+T      + N ++   +  CGC
Sbjct:    4 PDDEYDYLIKLLALGDSNVGKTSLLYQYTDNIFNPRFTTTVGVDFRQKRLVRES-RDSEGLLGPKQRLHLQLWDTAGQERYRSLCTVFLRDAMGFLLVFDLTNESSLQSCREWMNLLCQHAYCDRPDVVLVGNKFDLTKERQVSMSAANAMARELDVPYIETSAATGYQVTAAVDRLLDLVMTRIEASVTKAR-IHGNT----EGTANLKSSTSKSNCGC 217          
BLAST of Ras-related protein Rab-27A vs. Ensembl Cavefish
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:103047190])

HSP 1 Score: 262.692 bits (670), Expect = 3.232e-86
Identity = 128/220 (58.18%), Postives = 160/220 (72.73%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGN--TEAEQPEK-KCGC 760
            DYDYLIK LALGDS VGKTS LYQYTDG FN +F +TVG+DFR+KR+V +S    DG  G+ Q++H+QLWDTAGQERFRSL T F RDAMGFLL+FDL+NE+S  N R W+  L  HAYCE PD+VL GNK DL +QR VS E+A  +A++ G+ Y ETSAA G NV   + +LLD++M R+E+ V ++ + DG T+R    SG+   E   PEK KC C
Sbjct:    5 DYDYLIKFLALGDSGVGKTSFLYQYTDGKFNSKFITTVGIDFREKRVVYKS-SGPDGTPGRGQRIHIQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLSNEQSFLNVRNWMSQLQMHAYCENPDIVLCGNKCDLEDQRAVSEEEARELAEKYGIPYFETSAANGENVSRAVEVLLDLIMKRMERCVDRSWIPDG-TMRSNGHSGSELVEPPTPEKSKCAC 222          
BLAST of Ras-related protein Rab-27A vs. Ensembl Cavefish
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:103047190])

HSP 1 Score: 262.692 bits (670), Expect = 3.232e-86
Identity = 128/220 (58.18%), Postives = 160/220 (72.73%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGN--TEAEQPEK-KCGC 760
            DYDYLIK LALGDS VGKTS LYQYTDG FN +F +TVG+DFR+KR+V +S    DG  G+ Q++H+QLWDTAGQERFRSL T F RDAMGFLL+FDL+NE+S  N R W+  L  HAYCE PD+VL GNK DL +QR VS E+A  +A++ G+ Y ETSAA G NV   + +LLD++M R+E+ V ++ + DG T+R    SG+   E   PEK KC C
Sbjct:    5 DYDYLIKFLALGDSGVGKTSFLYQYTDGKFNSKFITTVGIDFREKRVVYKS-SGPDGTPGRGQRIHIQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLSNEQSFLNVRNWMSQLQMHAYCENPDIVLCGNKCDLEDQRAVSEEEARELAEKYGIPYFETSAANGENVSRAVEVLLDLIMKRMERCVDRSWIPDG-TMRSNGHSGSELVEPPTPEKSKCAC 222          
BLAST of Ras-related protein Rab-27A vs. Ensembl Cavefish
Match: rab27b (RAB27B, member RAS oncogene family [Source:NCBI gene;Acc:103022885])

HSP 1 Score: 254.988 bits (650), Expect = 2.726e-83
Identity = 125/217 (57.60%), Postives = 154/217 (70.97%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 760
            DYDYLIKLLALGDS VGKT+ LY+YTD  FNP+F +TVG+DFR+KR+V  S    +G  G+  K+HLQLWDTAGQERFRSL T F RDAMGFLL+FDLT+++S  N R W+  L A+AYCE PD+VLVGNKADL +QR V  +QA+ +A + G+ Y ETSAATG  V+  +  LLD+VM R+E+ V K      D      +S  T A   EKKC C
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVY-STNSPNGTTGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLVGNKADLADQREVQEKQAKELADKYGIPYFETSAATGAQVDKAVVTLLDLVMKRMEQCVEKPT---ADAQNTDAASKLTAAPAAEKKCAC 217          
BLAST of Ras-related protein Rab-27A vs. Ensembl Cavefish
Match: rab3c (RAB3C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-263])

HSP 1 Score: 170.629 bits (431), Expect = 1.575e-50
Identity = 84/226 (37.17%), Postives = 136/226 (60.18%), Query Frame = 2
Query:   83 QESDVPPNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 760
            QE+  P   ++DY+ KLL +G+S+VGKTSLL+++ D  F P F STVG+DF+ K + + + R           + LQ+WDTAGQER+R++ T + R AMGF+L++D+TNE S    ++W   +  +++ E   V+LVGNK D+  +R+VSV+    +A++LG ++ ETSA    N+  T   L+D++ D++  ++  +    G T    T   +  A  P+  C C
Sbjct:    9 QETSEP---NFDYMFKLLIIGNSSVGKTSLLFRFADDAFTPAFVSTVGIDFKIKTLYKNNKR-----------IKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFAAVQDWSTQIKTYSW-ENAQVILVGNKCDMEEERIVSVDSGRLLAEQLGFEFYETSAKDNINITQTFQRLVDIICDKMPDTLDSDPA--GPTGSATTKLTDQPAPPPQSDCSC 217          
BLAST of Ras-related protein Rab-27A vs. Ensembl Cavefish
Match: rab3aa (ras-related protein Rab-3A-like [Source:NCBI gene;Acc:103026901])

HSP 1 Score: 167.933 bits (424), Expect = 1.556e-49
Identity = 83/222 (37.39%), Postives = 135/222 (60.81%), Query Frame = 2
Query:  104 NDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKK---CGC 760
            + ++DY+ K+L +G+S+VGKTS L++Y D  F P F STVG+DF+ K I R   R           + LQ+WDTAGQER+R++ T + R AMGF+L++D+TNE S    ++W   +  +++ +   V+LVGNK D+ ++R+V+ ++  ++A +LG ++ E SA    NV+ T   L+D++ +R+ +S     L  GD+   G   G    EQP++    C C
Sbjct:   16 DQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKR-----------IKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDSFNAVQDWSTQIKTYSW-DNAQVLLVGNKCDIEDERLVASQRGRQLADQLGFEFFEASAKDNINVKQTFERLVDVICERMSES-----LESGDSSVTGGKQGPQLTEQPQRSHQDCAC 220          
BLAST of Ras-related protein Rab-27A vs. Ensembl Sea Lamprey
Match: rab27a (RAB27A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-050913-46])

HSP 1 Score: 226.868 bits (577), Expect = 4.514e-73
Identity = 111/216 (51.39%), Postives = 150/216 (69.44%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCG 757
            +YDYLIKLL LGDS VGK+SLL QYT+G F+ ++ +TVG+DFR+KR+   +   ADG   Q +++HLQLWDTAGQERFRSL T F RDAMGFL++FDLT+E++  N R WL  L  HAYCE PD+VL GNK+DL+   +   +QA+  A++ G+ Y ETSA TGNNV   +  LL ++M R+E+ + K+ +  G   +        EA+  +KKCG
Sbjct:    5 EYDYLIKLLVLGDSGVGKSSLLCQYTEGRFHDKYITTVGIDFREKRVTY-TNEGADGTAKQTKRVHLQLWDTAGQERFRSLTTAFFRDAMGFLVIFDLTSEQTFLNVRNWLNQLQMHAYCESPDIVLCGNKSDLSEHNITQ-KQAKEFAEKHGMPYFETSARTGNNVVPAVETLLGLIMKRMERCIDKSWIPQGVLNKKDKLQEVDEADSEKKKCG 218          
BLAST of Ras-related protein Rab-27A vs. Ensembl Sea Lamprey
Match: rab27a (RAB27A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-050913-46])

HSP 1 Score: 167.933 bits (424), Expect = 1.884e-51
Identity = 79/119 (66.39%), Postives = 95/119 (79.83%), Query Frame = 2
Query:   89 SDVPPNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQ 445
            S    + DYD+LIKLLALGDS VGKTSLLY YTDG FN +F +TVG+DFR+KR+V  S  +ADG+ G+ Q++HLQLWDTAGQERFRSL T F RDAMGFLL+FDLT+E+S  N R W+ 
Sbjct:   11 SRAMSDSDYDFLIKLLALGDSGVGKTSLLYNYTDGKFNSKFVTTVGIDFREKRVVYRSE-NADGITGRGQRVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSEQSFLNVRNWMS 128          
BLAST of Ras-related protein Rab-27A vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 168.318 bits (425), Expect = 1.521e-50
Identity = 83/202 (41.09%), Postives = 127/202 (62.87%), Query Frame = 2
Query:  113 YDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSS 718
            YDYL KLL +GDS VGKT +L+++++  FN  F ST+G+DF+ + I      D DG     +K+ LQ+WDTAGQERFR++ T + R AMG +LV+D+TNE+S  N + W++ +  HA  +   ++L GNK D+  +R V+ E+ E++A E G+K+METSA    NVE     L   +  ++++ +  N   D + VR+   S
Sbjct:    5 YDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTI------DLDG-----KKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVEKMIL-GNKCDMNERRQVTRERGEKLAIEYGIKFMETSAKASINVEEAFFTLARDIKAKMDRKLEGNNTPDSNAVRITAPS 194          
BLAST of Ras-related protein Rab-27A vs. Ensembl Sea Lamprey
Match: rab27a (RAB27A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-050913-46])

HSP 1 Score: 159.844 bits (403), Expect = 1.237e-47
Identity = 74/133 (55.64%), Postives = 91/133 (68.42%), Query Frame = 2
Query:  260 SPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIE 658
            +P   +G  G   K+HLQLWDTAGQ RFRSL   F RDAMGF + FD+T+E+S  N R W+ +L  HAYC  PDVVL GNKADLT QR V  + A  +A E G+ Y+ETSAATG NV   + LLL+ VM R++
Sbjct:    3 NPGGKEGPAGDGLKIHLQLWDTAGQRRFRSLTNAFFRDAMGFFVFFDITDEQSFVNVRHWMVVLQHHAYCPSPDVVLCGNKADLTEQRAVGEDDALSLASEYGMPYVETSAATGENVARAVELLLERVMRRVQ 135          
BLAST of Ras-related protein Rab-27A vs. Ensembl Sea Lamprey
Match: rab3c (RAB3C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-263])

HSP 1 Score: 159.458 bits (402), Expect = 7.517e-47
Identity = 75/188 (39.89%), Postives = 121/188 (64.36%), Query Frame = 2
Query:  104 NDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSV 667
            + ++DY+ KLL +G+S+VGKTS L++Y D  F   F STVG+DF+ K + R   R           + LQ+WDTAGQER+R++ T + R AMGF+L++D+TNE S     +W   +  +++ +   VVLVGNK D+ + R+V  EQ  ++A++LG ++ ETSA    NV+ T   L+D++ +++ +S+
Sbjct:   23 DQNFDYMFKLLIIGNSSVGKTSFLFRYADESFTSAFVSTVGIDFKVKTVYRNEKR-----------IKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDSFNAVSDWSTQIKTYSW-DNAQVVLVGNKCDMEDDRMVPTEQGRQLAEQLGFEFFETSAKDNINVKQTFERLVDVICEKMSESL 198          
BLAST of Ras-related protein Rab-27A vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 159.458 bits (402), Expect = 3.574e-47
Identity = 79/191 (41.36%), Postives = 128/191 (67.02%), Query Frame = 2
Query:  113 YDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLL 685
            YD ++K+L +GDS VGK+ LL ++ +  FNP F +T+G+DF+ K +      D +G     +K+ LQLWDTAGQERFR++ T + R AMG +LV+D+T+ER+ TN ++W + ++ HA  ++  ++LVGNK+D+   RVV+ +Q E +AKELG+ ++E+SA   +NV      L  ++ ++I+     NKL+
Sbjct:   17 YDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTV------DING-----KKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHAN-DEAQLLLVGNKSDM-ETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKID----SNKLV 190          
BLAST of Ras-related protein Rab-27A vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 129.798 bits (325), Expect = 7.383e-36
Identity = 73/211 (34.60%), Postives = 122/211 (57.82%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQP 742
            DYD L K++ +GDS VGK++LL ++T   FN    ST+GV+F  + +      + DG     +++  Q+WDTAGQER+R++ + + R A+G L+V+D++   S  NC  WL  L  +A  +   V L+GNK+DL + R V  E+++  A+E  + + ETSA    NV+     L++ +  +    VSK+++  GD+   G ++G +    P
Sbjct:    9 DYDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTL------EIDG-----KRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENA-DDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQK----VSKHQMDLGDSSANGNANGASAPNGP 203          
BLAST of Ras-related protein Rab-27A vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 126.716 bits (317), Expect = 9.027e-35
Identity = 68/184 (36.96%), Postives = 107/184 (58.15%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEK 661
            DYDYL K++ +GDS VGK++LL ++T   FN    ST+GV+F  + I  E+           +K+  Q+WDTAGQER+R++ + + R A+G L+V+D++   S  NC  WL  L  +A  +   V L+GNK+DL + R V  ++A+  A E  + + ETSA   +NV+     L+  +   + K
Sbjct:    9 DYDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVEN-----------KKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENA-DDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSK 180          
BLAST of Ras-related protein Rab-27A vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 125.946 bits (315), Expect = 1.423e-34
Identity = 72/194 (37.11%), Postives = 116/194 (59.79%), Query Frame = 2
Query:  104 NDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDR-IEKSVSKNKL 682
            N +YDYL KLL +G+S VGK+ LL +++D  +   + ST+GVDF+ K +      + DG     + + LQ+WDTAGQERFR++ + + R + G ++V+D+T++ S    + WLQ +  +A       +LVGNK DL ++RVV  + A+  A    + ++ETSA    NVE+       + M R I++S+S+  L
Sbjct:    2 NSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTV------ELDG-----KTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLK-LLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAF-----LTMARQIKESMSQQNL 178          
BLAST of Ras-related protein Rab-27A vs. Ensembl Yeast
Match: YPT6 (Rab family GTPase; required for endosome-to-Golgii, intra-Golgi retrograde, and retrograde Golgi-to-ER transport; temporarily at the Golgi, dissociating into the cytosol on arrival of the late Golgi GTPase Ypt32p; Golgi-localized form is GTP bound, while cytosolic form is GDP-bound; required for delivery of Atg9p to the phagophore assembly site during autophagy under heat stress, with Ypt6p for starvation induced autophagy and for the CVT pathway; homolog of mammalian Rab6 [Source:SGD;Acc:S000004252])

HSP 1 Score: 117.472 bits (293), Expect = 2.230e-31
Identity = 71/218 (32.57%), Postives = 117/218 (53.67%), Query Frame = 2
Query:  128 KLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVK-YMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTV------RLGTSSGNTEAEQPEKKCGC 760
            K++ LG+  VGKTSL+ ++    F+  + +T+G+DF  K +  +            + + LQLWDTAGQERFRSL   ++RD+   ++V+D+T  +S     +W++ +      E   + +VGNK+DL+++R +S E+ E+ AK LG K +METS   G NV+   +L   +     E   S++  LD +        + G    +T  EQ +  C C
Sbjct:   12 KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDD-----------KTIRLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGNKSDLSDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVK---ALFKKIAKSLPEFQNSESTPLDSENANSANQNKPGVIDISTAEEQEQSACQC 215          
BLAST of Ras-related protein Rab-27A vs. Ensembl Nematostella
Match: EDO49958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RER3])

HSP 1 Score: 257.684 bits (657), Expect = 1.213e-84
Identity = 129/225 (57.33%), Postives = 154/225 (68.44%), Query Frame = 2
Query:  101 PNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQR-QKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSK----NKLLDGDTVRLGTSSGNTEAEQPEKKCGC 760
            P  DYDYLIK LALGDS VGKTS+LYQYTD  FNP+F STVG+DFR+KR+V   P + DG    R Q++HLQLWDTAGQERFRSL T F RDAMGFLLVFDLT+E+S  N R WL  L  HAYCE PD+VL+GNKADL + RVV   +A  +A  LG+KY ETSAATG NV  ++  LLD VM R+E  V +    N + + +  R+       EA +    C C
Sbjct:    4 PGGDYDYLIKFLALGDSGVGKTSILYQYTDESFNPKFISTVGIDFREKRVVHH-PLNPDGERSTRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLVFDLTHEQSFVNIRNWLSQLQTHAYCENPDIVLLGNKADLEDDRVVDEAEARALADNLGLKYFETSAATGQNVTKSVEALLDQVMVRMENCVDRATLPNNVFNNNPSRVSKLKEVDEASEESSGCSC 227          
BLAST of Ras-related protein Rab-27A vs. Ensembl Nematostella
Match: EDO28309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6U5])

HSP 1 Score: 245.358 bits (625), Expect = 1.795e-80
Identity = 119/182 (65.38%), Postives = 137/182 (75.27%), Query Frame = 2
Query:  101 PNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQR-QKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMV 643
            P  DYDYLIK LALGDS VGKTS+LYQYTD  FNP+F STVG+DFR+KR+V   P + DG    R Q++HLQLWDTAGQERFRSL T F RDAMGFLLVFDLT+E+S  N R WL  L  HAYCE PD+VL+GNKADL + RVV   +A  +A  LG+KY ETSAATG NV  ++  LLD V
Sbjct:    4 PGGDYDYLIKFLALGDSGVGKTSILYQYTDESFNPKFISTVGIDFREKRVVHH-PLNPDGERSTRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLVFDLTHEQSFVNIRNWLSQLQTHAYCENPDIVLLGNKADLEDDRVVDEAEARALADNLGLKYFETSAATGQNVTKSVEALLDQV 184          
BLAST of Ras-related protein Rab-27A vs. Ensembl Nematostella
Match: EDO34944 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMW8])

HSP 1 Score: 166.392 bits (420), Expect = 2.819e-49
Identity = 86/227 (37.89%), Postives = 137/227 (60.35%), Query Frame = 2
Query:   98 PPNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGD-TVRLGTSSGNTE--AEQPEK---KCGC 760
              + ++DY+ KLL +G+S VGKTS L++Y D  F   F STVG+DF+ K + R   R           + LQ+WDTAGQER+R++ T + R AMGF+L++D+TNE S    ++W   +  +++     V+LVGNK D+  +RVVS ++ +++A +LG+++ ETSA    NV+     L+D++ D++ +S      LD D T+  G   G T+  AE+P++    C C
Sbjct:   13 AADQNFDYMFKLLIIGNSAVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRNDKR-----------VKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFQAVQDWSTQVKTYSWAN-AQVILVGNKCDMEEERVVSYDRGKQLADQLGLEFYETSAKDNTNVKKVFERLVDIICDKMSQS------LDTDPTIVSGQKPGTTKLTAERPKQNQDNCAC 221          
BLAST of Ras-related protein Rab-27A vs. Ensembl Nematostella
Match: EDO47471 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMA6])

HSP 1 Score: 162.925 bits (411), Expect = 2.704e-48
Identity = 83/216 (38.43%), Postives = 133/216 (61.57%), Query Frame = 2
Query:  113 YDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 760
            YDYL KLL +GDS VGKT +L++++D  FN  F ST+G+DF+ K I             Q +K+ LQ+WDTAGQERF ++ T + R AMG +LV+D+T E++  N  +WL+ +  HA  E  + +++GNK D+ ++R+VS E+ E++A+E G++++ETSA T  N+E     L     D ++K ++K+     + + +         +Q +KK GC
Sbjct:    6 YDYLFKLLLIGDSGVGKTCILFRFSDDAFNTTFISTIGIDFKIKTIEM-----------QGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITQEKTFDNISKWLRNIEEHAN-EDVEKMILGNKCDMDDRRIVSRERGEQIAREHGIRFLETSAKTNINIEQAFQYL---AQDILKKELNKDSEEPSNNIHV--------HDQKDKKGGC 198          
BLAST of Ras-related protein Rab-27A vs. Ensembl Nematostella
Match: EDO41018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5I6])

HSP 1 Score: 157.532 bits (397), Expect = 3.820e-46
Identity = 79/183 (43.17%), Postives = 122/183 (66.67%), Query Frame = 2
Query:  113 YDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVEN---TMSLLLDMVMDR 652
            YD+L KLL +GDS VGKT +L+++++  FN  F ST+G+DF+ + I      + DG     +K+ LQ+WDTAGQERFR++ T + R AMG +LV+D+TN++S  N + W++ +  HA  +   +VL GNK D+ ++R VS E+ E++A E G+K+METSA    NVE    T++  + + MD+
Sbjct:    5 YDFLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTI------ELDG-----KKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNDKSFENIKNWIRNIEEHASQDVEKMVL-GNKCDMEDRRQVSKERGEQLAVEYGIKFMETSAKASINVEEAFFTLARDIKLKMDK 175          
BLAST of Ras-related protein Rab-27A vs. Ensembl Medaka
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:101164788])

HSP 1 Score: 252.292 bits (643), Expect = 2.944e-82
Identity = 123/218 (56.42%), Postives = 154/218 (70.64%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEK-KCGC 760
            +YDYLIK LALGDS VGKTS LYQYTDG FN +F +TVG+DFR+K ++   P  + G   + QK+HLQLWDTAGQERFRSL T F RDAMGFLL+FDLTNE+S  N R W+  L  HAYCE PDVVL GNK DL +QR +S ++A  +A++ G+ Y ETSAA G NV   + +LLD++M R+E  V K+ + DG TVR    +     E P++ KC C
Sbjct:    5 EYDYLIKFLALGDSGVGKTSFLYQYTDGKFNSKFITTVGIDFREKTVLF-PPTGSGGTSSKGQKIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWMSQLQMHAYCENPDVVLCGNKCDLMDQRAISEDEARELAEKYGIPYFETSAANGQNVTEAVRILLDLIMRRMEHCVDKSWIPDG-TVRPNGPNHQDIPEAPDRGKCAC 220          
BLAST of Ras-related protein Rab-27A vs. Ensembl Medaka
Match: rab27b (RAB27B, member RAS oncogene family [Source:NCBI gene;Acc:101161176])

HSP 1 Score: 249.21 bits (635), Expect = 5.297e-81
Identity = 120/217 (55.30%), Postives = 154/217 (70.97%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 760
            DYDYLIKLLALGDS VGKT+ LY+YTD  FNP+F +TVG+DFR+KR+V  +        G+  K+HLQLWDTAGQERFRSL T F RDAMGFLL+FDLT+++S  N R W+  L A+AYCE PD+VLVGNK DL +QR V  +QA+ +A + G+ Y ETSAATG  V+  +  LLD+VM R+E+ V K      D+     ++  ++A+  EKKC C
Sbjct:    5 DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYTASNPNGTTTGKTFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLVGNKVDLADQREVQEKQAKELADKYGIPYFETSAATGAEVDKAVITLLDLVMKRMEQCVDKPP---ADSANGNGATKLSDAQPIEKKCAC 218          
BLAST of Ras-related protein Rab-27A vs. Ensembl Medaka
Match: ENSORLT00000000515.2 (ras-related protein Rab-27B [Source:NCBI gene;Acc:101172416])

HSP 1 Score: 225.713 bits (574), Expect = 9.499e-69
Identity = 114/219 (52.05%), Postives = 149/219 (68.04%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPE--KKCGC 760
            DYDYLIKLLALGDS  GKT+ L++YTD  F+ RFT+TVG+DFR+KR+V      ADG   +  ++HLQLWDTAGQERFRSL T F RDAMGFLL+FDLTN++S  N R W+  L A+AYC+ PDVVLVG KADL + R V   QA  +A+  G+ Y ETSA TG  V+  ++ LL++VM R+E+    ++         G+ S + E E+    ++C C
Sbjct:  257 DYDYLIKLLALGDSGAGKTTFLHRYTDNKFHRRFTTTVGIDFREKRVVYVG-TGADGASERSFRVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTNQQSFVNVRNWMSQLQANAYCDSPDVVLVGTKADLKDMRNVHARQARELAERYGIPYFETSALTGAGVDQAVTTLLNLVMKRMEQGAYGSEP-------NGSHSCSREVEEAPVRRRCAC 467          
BLAST of Ras-related protein Rab-27A vs. Ensembl Medaka
Match: rab27a (RAB27A, member RAS oncogene family [Source:NCBI gene;Acc:101164788])

HSP 1 Score: 206.453 bits (524), Expect = 1.625e-64
Identity = 96/153 (62.75%), Postives = 116/153 (75.82%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELG 568
            +YDYLIK LALGDS VGKTS LYQYTDG FN +F +TVG+DFR+K ++   P  + G   + QK+HLQLWDTAGQERFRSL T F RDAMGFLL+FDLTNE+S  N R W+  L  HAYCE PDVVL GNK DL +QR +S ++A  +A++ G
Sbjct:    5 EYDYLIKFLALGDSGVGKTSFLYQYTDGKFNSKFITTVGIDFREKTVLF-PPTGSGGTSSKGQKIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWMSQLQMHAYCENPDVVLCGNKCDLMDQRAISEDEARELAEKYG 156          
BLAST of Ras-related protein Rab-27A vs. Ensembl Medaka
Match: RAB8A (RAB8A, member RAS oncogene family [Source:NCBI gene;Acc:101161304])

HSP 1 Score: 168.703 bits (426), Expect = 5.425e-50
Identity = 90/212 (42.45%), Postives = 134/212 (63.21%), Query Frame = 2
Query:  113 YDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEK 748
            YDYL KLL +GDS VGKT +L+++ D  FN  F ST+G+DF+ + I      D +G     +K+ LQ+WDTAGQERFR++ T + R AMG +LV+D+TNE+S  N + W++ +  HA  +   +VL GNK D+ ++R VS E+ E++A E G+K+METSA    NVEN    L   +  +++K       L+G+  + G++ G    EQP+K
Sbjct:    5 YDYLFKLLLIGDSGVGKTCVLFRFADDAFNSTFISTIGIDFKIRTI------DLNG-----KKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVERMVL-GNKCDVNDRRQVSKERGEQLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDKK------LEGNNPQ-GSNQGVKITEQPKK 197          
BLAST of Ras-related protein Rab-27A vs. Planmine SMEST
Match: SMESG000023446.1 (SMESG000023446.1)

HSP 1 Score: 481.485 bits (1238), Expect = 2.416e-172
Identity = 232/232 (100.00%), Postives = 232/232 (100.00%), Query Frame = 2
Query:   65 MGDQMIQESDVPPNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 760
            MGDQMIQESDVPPNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC
Sbjct:    1 MGDQMIQESDVPPNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 232          
BLAST of Ras-related protein Rab-27A vs. Planmine SMEST
Match: SMESG000077907.1 (SMESG000077907.1)

HSP 1 Score: 257.684 bits (657), Expect = 2.037e-84
Identity = 121/193 (62.69%), Postives = 149/193 (77.20%), Query Frame = 2
Query:  104 NDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKL 682
            ND+YDYLI+LLALGD +VGKT+ LY YTDG F+P FTST+GVDFRQKRI+  S    D  LG+ Q LHLQLWDTAGQERFRSLC++F RDAMGF+L+FDLTNE SL N REW+ IL A+AYC+ PD++LVGNKADL   R V+ E A++VA+E  + Y+ETS   G  VE  M  L++MVM RIE S++  K+
Sbjct:    4 NDEYDYLIRLLALGDQDVGKTTFLYYYTDGKFDPGFTSTIGVDFRQKRIIHRSVDKTDSCLGEEQILHLQLWDTAGQERFRSLCSIFFRDAMGFVLMFDLTNEESLLNIREWMNILKANAYCDNPDIILVGNKADL--PRTVTEEAAKKVAQEFNLPYIETSGLNGIRVEEAMDKLVNMVMTRIENSITNYKI 194          
BLAST of Ras-related protein Rab-27A vs. Planmine SMEST
Match: SMESG000014812.1 (SMESG000014812.1)

HSP 1 Score: 253.062 bits (645), Expect = 1.493e-82
Identity = 125/218 (57.34%), Postives = 157/218 (72.02%), Query Frame = 2
Query:  107 DDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 760
            DDYDYL+KLLALGDS VGKTSLL++YTD  F+P+F STVGVDF+QKRIV  S  + +G+LG+ QKL LQLWDTAGQERFRSL   F RDAMGFLLVFD+TNE+S  + R W+ +L +HAYC+ PD++LVGNK DL   R VS ++AE +A+ LG+ Y+ETSA +  NVE     ++ MVM RIE+S+ KN L     VR        +  + EK  GC
Sbjct:   10 DDYDYLLKLLALGDSAVGKTSLLHRYTDDEFSPKFVSTVGVDFKQKRIVHNSNTE-NGVLGKSQKLQLQLWDTAGQERFRSLSMAFFRDAMGFLLVFDVTNEQSFLHIRNWVTVLRSHAYCDTPDMILVGNKIDLEEARQVSFKEAEDLAETLGIPYIETSALSAENVEKAFDQIVVMVMKRIERSIDKNIL----PVRRPIGVSLKQKSESEKNSGC 222          
BLAST of Ras-related protein Rab-27A vs. Planmine SMEST
Match: SMESG000044557.1 (SMESG000044557.1)

HSP 1 Score: 236.113 bits (601), Expect = 4.453e-76
Identity = 114/224 (50.89%), Postives = 159/224 (70.98%), Query Frame = 2
Query:   89 SDVPPNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSVSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC 760
            S    NDDYDYLIKLLALGDS+VGKT +L +Y D  +   F +TVGVDF+QKR++  +P++ +G++ +  +L+LQLWDTAGQERF+SL   F RDAMGFLLVFDLT+E S  N R+W+++L  ++Y E PD+VLVGNK+DL+++RV+S E A  +AKE  V Y+ETSA++G NVE     L+++VM+RI K + K+ L     V+  T   +   ++   KC C
Sbjct:    4 SSTAGNDDYDYLIKLLALGDSSVGKTCILQRYIDNAYTRDFGNTVGVDFKQKRVIY-TPKNTNGIIEKEARLNLQLWDTAGQERFKSLTVSFFRDAMGFLLVFDLTDENSFINIRDWMRLLKINSYSENPDIVLVGNKSDLSSRRVISHETALELAKEFNVPYLETSASSGENVEKAFQTLIELVMERINKVLDKSLL----PVKKKTKKPSPVEKKEANKCSC 222          
BLAST of Ras-related protein Rab-27A vs. Planmine SMEST
Match: SMESG000034019.1 (SMESG000034019.1)

HSP 1 Score: 164.081 bits (414), Expect = 3.573e-48
Identity = 78/186 (41.94%), Postives = 128/186 (68.82%), Query Frame = 2
Query:  110 DYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFTSTVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVFLRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLTNQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKSV 667
            ++DY+ KLL +G+S+VGKTS L++Y D  F   F STVG+DF+ K IVR   RD        +K+ LQ+WDTAGQER+R++ T + R AMGF+L++D+TNE S    ++W+  +  +++ +   VVLVGNK DL  +RV+S+++  ++A +LG+++ ETSA    +V++    L+D++ D++ +S+
Sbjct:   11 NFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTIVR---RD--------KKVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWVTQIKTYSW-DNAQVVLVGNKVDLDYERVISIDRGRQLASQLGLEFFETSAKENLHVKSVFERLVDIICDKMSESL 184          
The following BLAST results are available for this feature:
BLAST of Ras-related protein Rab-27A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB27B6.727e-8659.17RAB27B, member RAS oncogene family [Source:HGNC Sy... [more]
RAB27A1.087e-8557.34RAB27A, member RAS oncogene family [Source:HGNC Sy... [more]
RAB27A1.087e-8557.34RAB27A, member RAS oncogene family [Source:HGNC Sy... [more]
RAB27A1.087e-8557.34RAB27A, member RAS oncogene family [Source:HGNC Sy... [more]
RAB27A1.087e-8557.34RAB27A, member RAS oncogene family [Source:HGNC Sy... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aex-66.726e-7454.21Rab27 [Source:UniProtKB/TrEMBL;Acc:G5EBS5][more]
rab-31.035e-4937.27Ras-related protein Rab-3 [Source:UniProtKB/Swiss... [more]
rab-31.240e-4937.27Ras-related protein Rab-3 [Source:UniProtKB/Swiss... [more]
rab-85.074e-4541.30RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-85.074e-4541.30RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab272.933e-6855.44gene:FBgn0025382 transcript:FBtr0070294[more]
Rab271.404e-6254.05gene:FBgn0025382 transcript:FBtr0070293[more]
Rab31.362e-5037.45gene:FBgn0005586 transcript:FBtr0473383[more]
Rab31.362e-5037.45gene:FBgn0005586 transcript:FBtr0088257[more]
Rab101.846e-4642.78gene:FBgn0015789 transcript:FBtr0077337[more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab27a2.100e-8657.99RAB27A, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab27b1.871e-8254.82RAB27B, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab27b1.799e-8156.68RAB27B, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab3db1.876e-4937.67RAB3D, member RAS oncogene family, b [Source:ZFIN;... [more]
rab3ab2.020e-4936.94RAB3A, member RAS oncogene family, b [Source:ZFIN;... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lemd34.843e-8356.68LEM domain containing 3 [Source:Xenbase;Acc:XB-GEN... [more]
lemd31.667e-8156.68LEM domain containing 3 [Source:Xenbase;Acc:XB-GEN... [more]
rab27a1.270e-8057.80RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
rab27a3.949e-7658.21RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
rab27a1.076e-5647.73RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab27b1.570e-8860.09RAB27B, member RAS oncogene family [Source:MGI Sym... [more]
Rab27b1.570e-8860.09RAB27B, member RAS oncogene family [Source:MGI Sym... [more]
Rab27b1.570e-8860.09RAB27B, member RAS oncogene family [Source:MGI Sym... [more]
Rab27a2.099e-8656.88RAB27A, member RAS oncogene family [Source:MGI Sym... [more]
Rab27a2.099e-8656.88RAB27A, member RAS oncogene family [Source:MGI Sym... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99P74|RB27B_RAT1.018e-8760.09Ras-related protein Rab-27B OS=Rattus norvegicus O... [more]
sp|Q99P58|RB27B_MOUSE1.098e-8760.09Ras-related protein Rab-27B OS=Mus musculus OX=100... [more]
sp|Q9ERI2|RB27A_MOUSE1.468e-8556.88Ras-related protein Rab-27A OS=Mus musculus OX=100... [more]
sp|O00194|RB27B_HUMAN3.231e-8559.17Ras-related protein Rab-27B OS=Homo sapiens OX=960... [more]
sp|P51159|RB27A_HUMAN5.221e-8557.34Ras-related protein Rab-27A OS=Homo sapiens OX=960... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C1L3U15.182e-10365.52Rab-protein 8 OS=Schistosoma japonicum OX=6182 GN=... [more]
A0A4S2MEA62.714e-10065.09Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A074ZKZ62.714e-10065.09Ras family protein OS=Opisthorchis viverrini OX=61... [more]
H2KNW42.714e-10065.09Ras-related protein Rab-27A OS=Clonorchis sinensis... [more]
Q5BYA62.201e-9967.27SJCHGC04801 protein (Fragment) OS=Schistosoma japo... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab27a3.232e-8658.18RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
rab27a3.232e-8658.18RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
rab27b2.726e-8357.60RAB27B, member RAS oncogene family [Source:NCBI ge... [more]
rab3c1.575e-5037.17RAB3C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab3aa1.556e-4937.39ras-related protein Rab-3A-like [Source:NCBI gene;... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab27a4.514e-7351.39RAB27A, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab27a1.884e-5166.39RAB27A, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab8a1.521e-5041.09RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab27a1.237e-4755.64RAB27A, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab3c7.517e-4739.89RAB3C, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SEC43.574e-4741.36Rab family GTPase; essential for vesicle-mediated ... [more]
YPT317.383e-3634.60Rab family GTPase; involved in the exocytic pathwa... [more]
YPT329.027e-3536.96Rab family GTPase involved in the exocytic pathway... [more]
YPT11.423e-3437.11Rab family GTPase; involved in the ER-to-Golgi ste... [more]
YPT62.230e-3132.57Rab family GTPase; required for endosome-to-Golgii... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO499581.213e-8457.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283091.795e-8065.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349442.819e-4937.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474712.704e-4838.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410183.820e-4643.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab27a2.944e-8256.42RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
rab27b5.297e-8155.30RAB27B, member RAS oncogene family [Source:NCBI ge... [more]
ENSORLT00000000515.29.499e-6952.05ras-related protein Rab-27B [Source:NCBI gene;Acc:... [more]
rab27a1.625e-6462.75RAB27A, member RAS oncogene family [Source:NCBI ge... [more]
RAB8A5.425e-5042.45RAB8A, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-27A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023446.12.416e-172100.00SMESG000023446.1[more]
SMESG000077907.12.037e-8462.69SMESG000077907.1[more]
SMESG000014812.11.493e-8257.34SMESG000014812.1[more]
SMESG000044557.14.453e-7650.89SMESG000044557.1[more]
SMESG000034019.13.573e-4841.94SMESG000034019.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004590 ID=SMED30004590|Name=Ras-related protein Rab-27A|organism=Schmidtea mediterranea sexual|type=transcript|length=1249bp
CTTCCGATCTATTTAGTTGATTACATATATGCGGTGGTTGCTTAATTATT
AAATTAAATATAGAATGGGTGATCAAATGATTCAAGAATCAGATGTTCCA
CCAAATGACGATTATGATTATCTCATAAAGCTATTAGCCTTAGGTGATAG
TAACGTTGGAAAAACGAGCCTTCTTTATCAATACACAGATGGCGTTTTTA
ATCCTCGTTTTACATCAACAGTCGGTGTAGACTTTAGACAAAAACGCATT
GTTCGTGAATCACCTAGAGATGCCGATGGTTTATTGGGCCAGAGACAAAA
GCTTCATTTACAGTTATGGGATACTGCTGGACAGGAAAGATTTCGAAGTT
TATGCACAGTGTTTCTTCGAGATGCGATGGGGTTTCTATTAGTTTTCGAT
TTGACAAATGAAAGAAGTCTCACCAATTGCAGAGAATGGCTTCAAATTTT
GTCAGCTCATGCTTATTGTGAGAAACCTGACGTAGTACTCGTGGGAAATA
AAGCTGATCTGACAAATCAGCGGGTAGTCTCTGTAGAGCAAGCAGAGCGA
GTAGCCAAAGAACTTGGGGTGAAATATATGGAAACAAGTGCAGCAACGGG
AAATAATGTTGAAAATACAATGTCACTTCTATTAGATATGGTTATGGATA
GAATAGAGAAATCTGTGAGTAAAAATAAATTATTAGATGGTGATACTGTA
CGTTTGGGAACCTCATCCGGTAATACAGAAGCAGAACAGCCGGAAAAGAA
ATGCGGTTGTTAACAATTCATTTGAGCTTTGTTATCTTCCTCCGTTATTT
TTATTAAAATTATCAATGCAAAATTTCAGAATTATTTTAATTAGTTCGAG
TAAATGTTTTTTTCCGTATACACATATATTGACATAGGATATTTTTGACT
GTTTTAATGGCGCTAATCTTTGACTTTCAATTTTATGTTGAACCGATTAT
TTTCCCAATTGTTGAATCTTACTCATTTGTGAAATTCTGATCAGTCAATT
AATTATATATTAATATTAACAATATATGGTTAATTGAAAATTAATTATTT
TCTGTATTAGATTTCACTTTTTCTGAAAGTCTACAAATCAGGGCAAATCA
GAATAAAATTTTCAGTGTTGCTTTTTGTTTTTCTTTTTTTTAAAGCGCGC
AAAACTGTTTGTTTTTTATTTAAACAGCATAAATACATATAAATATATTT
TTATTCGTTTCATCTTTGAAAATTATTGCAGATGATGTGTTGTTTTGTG
back to top

protein sequence of SMED30004590-orf-1

>SMED30004590-orf-1 ID=SMED30004590-orf-1|Name=SMED30004590-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=233bp
MGDQMIQESDVPPNDDYDYLIKLLALGDSNVGKTSLLYQYTDGVFNPRFT
STVGVDFRQKRIVRESPRDADGLLGQRQKLHLQLWDTAGQERFRSLCTVF
LRDAMGFLLVFDLTNERSLTNCREWLQILSAHAYCEKPDVVLVGNKADLT
NQRVVSVEQAERVAKELGVKYMETSAATGNNVENTMSLLLDMVMDRIEKS
VSKNKLLDGDTVRLGTSSGNTEAEQPEKKCGC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR027417P-loop_NTPase
IPR001806Small_GTPase
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 136..149
score: 49.15
coord: 44..60
score: 29.81
coord: 73..95
score: 43.78
coord: 21..42
score: 45.7
coord: 171..193
score: 31.65
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 22..196
e-value: 3.6E-21
score: 86.3
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 23..191
e-value: 1.1E-11
score: 30.0
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 21..196
e-value: 2.0E-68
score: 243.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 16..211
e-value: 5.9E-62
score: 210.5
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 17..232
NoneNo IPR availablePANTHERPTHR24073:SF587RAS-RELATED PROTEIN RAB-27Bcoord: 17..232
NoneNo IPR availablePROSITEPS51419RABcoord: 16..232
score: 30.411
IPR001806Small GTPasePFAMPF00071Rascoord: 22..193
e-value: 2.5E-51
score: 173.5
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 19..186
e-value: 1.0E-21
score: 75.3
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 17..197