early endosome antigen 1-like

Overview
Nameearly endosome antigen 1-like
Smed IDSMED30004587
Length (bp)1758
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of early endosome antigen 1-like (SMED30004587) t-SNE clustered cells

Violin plots show distribution of expression levels for early endosome antigen 1-like (SMED30004587) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of early endosome antigen 1-like (SMED30004587) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for early endosome antigen 1-like (SMED30004587) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004587

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30004587h1SMcG0008363 dd_Smed_v4_5283_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004587h1SMcG0008363 dd_Smed_v4_5283_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004587h1SMcG0008363 dd_Smed_v4_5283_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004587h1SMcG0008363 dd_Smed_v6_5283_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30004587h1SMcG0008363 dd_Smed_v6_5283_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of early endosome antigen 1-like vs. Ensembl Human
Match: EEA1 (early endosome antigen 1 [Source:HGNC Symbol;Acc:HGNC:3185])

HSP 1 Score: 116.701 bits (291), Expect = 2.122e-26
Identity = 45/89 (50.56%), Postives = 61/89 (68.54%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACF 1567
            ++ D   +A+ +LGRENQSLQI   +  NR+W  D +   C  C K FS+T+R+HHCR CG + C +CS+K+A    S+KPVRVCDACF
Sbjct: 1318 RKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACF 1406          
BLAST of early endosome antigen 1-like vs. Ensembl Human
Match: RUFY2 (RUN and FYVE domain containing 2 [Source:HGNC Symbol;Acc:HGNC:19761])

HSP 1 Score: 79.337 bits (194), Expect = 7.128e-15
Identity = 31/57 (54.39%), Postives = 37/57 (64.91%), Query Frame = 2
Query: 1394 WIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            W+ D +A  C  C K FSL+ RKHHCRNCG++ C  CS     L  S KPVRVCD+C
Sbjct:  537 WLKDKEATHCKLCEKEFSLSKRKHHCRNCGEIFCNACSDNELPLPSSPKPVRVCDSC 593          
BLAST of early endosome antigen 1-like vs. Ensembl Human
Match: RUFY2 (RUN and FYVE domain containing 2 [Source:HGNC Symbol;Acc:HGNC:19761])

HSP 1 Score: 79.337 bits (194), Expect = 8.541e-15
Identity = 31/57 (54.39%), Postives = 37/57 (64.91%), Query Frame = 2
Query: 1394 WIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            W+ D +A  C  C K FSL+ RKHHCRNCG++ C  CS     L  S KPVRVCD+C
Sbjct:  551 WLKDKEATHCKLCEKEFSLSKRKHHCRNCGEIFCNACSDNELPLPSSPKPVRVCDSC 607          
BLAST of early endosome antigen 1-like vs. Ensembl Human
Match: RUFY1 (RUN and FYVE domain containing 1 [Source:HGNC Symbol;Acc:HGNC:19760])

HSP 1 Score: 78.9518 bits (193), Expect = 9.496e-15
Identity = 41/95 (43.16%), Postives = 53/95 (55.79%), Query Frame = 2
Query: 1292 KKCKEFDQ-LQSAILDLGRENQSLQISKE---KLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            K C+E +Q LQ   L L +    ++  KE    L    W+ D +A  C  C K FS++ RKHHCRNCG + C  CSS   +L    KPVRVCD+C
Sbjct:  493 KICEEQEQALQEMGLHLSQSKLKMEDIKEVNQALKGHAWLKDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSC 587          
BLAST of early endosome antigen 1-like vs. Ensembl Human
Match: RUFY1 (RUN and FYVE domain containing 1 [Source:HGNC Symbol;Acc:HGNC:19760])

HSP 1 Score: 78.9518 bits (193), Expect = 9.496e-15
Identity = 41/95 (43.16%), Postives = 53/95 (55.79%), Query Frame = 2
Query: 1292 KKCKEFDQ-LQSAILDLGRENQSLQISKE---KLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            K C+E +Q LQ   L L +    ++  KE    L    W+ D +A  C  C K FS++ RKHHCRNCG + C  CSS   +L    KPVRVCD+C
Sbjct:  493 KICEEQEQALQEMGLHLSQSKLKMEDIKEVNQALKGHAWLKDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSC 587          
BLAST of early endosome antigen 1-like vs. Ensembl Celegans
Match: eea-1 (EEA1 (Early Endosome Antigen, Rab effector) homolog [Source:UniProtKB/TrEMBL;Acc:Q5FC45])

HSP 1 Score: 119.013 bits (297), Expect = 1.313e-27
Identity = 45/89 (50.56%), Postives = 63/89 (70.79%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACF 1567
            + FD   SA+ +LGR NQSLQI  ++ ++R+W+ D +A+ C  C K FSLT+RKHHCR CG++ C  CSSKS  +A ++ PVR C+ CF
Sbjct: 1112 RRFDDALSAMHELGRANQSLQIDADRYSSRKWLDDAEAINCTECGKVFSLTVRKHHCRVCGKIYCNPCSSKSVRIASAKNPVRACNTCF 1200          
BLAST of early endosome antigen 1-like vs. Ensembl Celegans
Match: eea-1 (EEA1 (Early Endosome Antigen, Rab effector) homolog [Source:UniProtKB/TrEMBL;Acc:Q5FC45])

HSP 1 Score: 119.013 bits (297), Expect = 1.323e-27
Identity = 45/89 (50.56%), Postives = 63/89 (70.79%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACF 1567
            + FD   SA+ +LGR NQSLQI  ++ ++R+W+ D +A+ C  C K FSLT+RKHHCR CG++ C  CSSKS  +A ++ PVR C+ CF
Sbjct: 1110 RRFDDALSAMHELGRANQSLQIDADRYSSRKWLDDAEAINCTECGKVFSLTVRKHHCRVCGKIYCNPCSSKSVRIASAKNPVRACNTCF 1198          
BLAST of early endosome antigen 1-like vs. Ensembl Celegans
Match: ZK632.12 (pep chromosome:WBcel235:III:9830802:9832378:1 gene:WBGene00014019.1 transcript:ZK632.12.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK632.12)

HSP 1 Score: 74.3294 bits (181), Expect = 1.340e-14
Identity = 32/60 (53.33%), Postives = 43/60 (71.67%), Query Frame = 2
Query: 1394 WIGDLDAVECFTCHKP-FSLTLRKHHCRNCGQVLCQDCSSKSASL-AVSRKPVRVCDACF 1567
            W+ D +AV+C  C K  F+L  R+HHCRNCG+V+C  CSS++  +  V +KPVRVCD CF
Sbjct:  149 WVPDGEAVKCMVCGKTQFNLVQRRHHCRNCGRVVCGACSSRTFRIDNVHKKPVRVCDHCF 208          
BLAST of early endosome antigen 1-like vs. Ensembl Celegans
Match: ZK632.12 (pep chromosome:WBcel235:III:9830792:9832430:1 gene:WBGene00014019.1 transcript:ZK632.12.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK632.12)

HSP 1 Score: 74.3294 bits (181), Expect = 1.340e-14
Identity = 32/60 (53.33%), Postives = 43/60 (71.67%), Query Frame = 2
Query: 1394 WIGDLDAVECFTCHKP-FSLTLRKHHCRNCGQVLCQDCSSKSASL-AVSRKPVRVCDACF 1567
            W+ D +AV+C  C K  F+L  R+HHCRNCG+V+C  CSS++  +  V +KPVRVCD CF
Sbjct:  149 WVPDGEAVKCMVCGKTQFNLVQRRHHCRNCGRVVCGACSSRTFRIDNVHKKPVRVCDHCF 208          
BLAST of early endosome antigen 1-like vs. Ensembl Celegans
Match: lst-2 (Lateral signaling target protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9TZD0])

HSP 1 Score: 65.4698 bits (158), Expect = 6.400e-11
Identity = 26/63 (41.27%), Postives = 38/63 (60.32%), Query Frame = 2
Query: 1391 QWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASL---AVSRKPVRVCDACFI 1570
            +W+ D D  +C  C  PF+   R+HHCRNCG++ C  CS  + S+      RK VRVC+ C++
Sbjct:  562 RWVPDEDCEQCTACSMPFNFVRRRHHCRNCGRIFCHKCSCNTISIPEHGYDRK-VRVCNLCYV 623          
BLAST of early endosome antigen 1-like vs. Ensembl Fly
Match: CG31064 (gene:FBgn0051064 transcript:FBtr0085125)

HSP 1 Score: 70.0922 bits (170), Expect = 2.844e-12
Identity = 33/77 (42.86%), Postives = 43/77 (55.84%), Query Frame = 2
Query: 1352 QSLQISKEKLTNRQ-WIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASL----AVSRKPVRVCDACF 1567
            QSLQ   E + +   W  D  A  C  C + F+LT RKHHCR+CG++ C+ CS  +  L        KPVRVCD C+
Sbjct:  650 QSLQAMPEAVGSPGIWAPDSIATHCTACEREFNLTRRKHHCRSCGEIFCKACSEHTLPLLNAQGQPGKPVRVCDNCY 726          
BLAST of early endosome antigen 1-like vs. Ensembl Fly
Match: CG31064 (gene:FBgn0051064 transcript:FBtr0339249)

HSP 1 Score: 70.4774 bits (171), Expect = 2.875e-12
Identity = 33/77 (42.86%), Postives = 43/77 (55.84%), Query Frame = 2
Query: 1352 QSLQISKEKLTNRQ-WIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASL----AVSRKPVRVCDACF 1567
            QSLQ   E + +   W  D  A  C  C + F+LT RKHHCR+CG++ C+ CS  +  L        KPVRVCD C+
Sbjct:  798 QSLQAMPEAVGSPGIWAPDSIATHCTACEREFNLTRRKHHCRSCGEIFCKACSEHTLPLLNAQGQPGKPVRVCDNCY 874          
BLAST of early endosome antigen 1-like vs. Ensembl Fly
Match: CG6051 (gene:FBgn0039492 transcript:FBtr0339264)

HSP 1 Score: 68.9366 bits (167), Expect = 7.667e-12
Identity = 30/66 (45.45%), Postives = 36/66 (54.55%), Query Frame = 2
Query: 1379 LTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSR--KPVRVCDACFI 1570
            L+   WI D  A  C  C  PF+   R+HHCRNCG V C  CS+ SA L      K VRVC  C++
Sbjct:  900 LSPPAWIPDGKAPRCMACQTPFTAFRRRHHCRNCGGVFCGVCSNASAPLPKYGLTKAVRVCRDCYV 965          
BLAST of early endosome antigen 1-like vs. Ensembl Fly
Match: CG6051 (gene:FBgn0039492 transcript:FBtr0305050)

HSP 1 Score: 68.9366 bits (167), Expect = 7.670e-12
Identity = 30/66 (45.45%), Postives = 36/66 (54.55%), Query Frame = 2
Query: 1379 LTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSR--KPVRVCDACFI 1570
            L+   WI D  A  C  C  PF+   R+HHCRNCG V C  CS+ SA L      K VRVC  C++
Sbjct:  901 LSPPAWIPDGKAPRCMACQTPFTAFRRRHHCRNCGGVFCGVCSNASAPLPKYGLTKAVRVCRDCYV 966          
BLAST of early endosome antigen 1-like vs. Ensembl Fly
Match: CG6051 (gene:FBgn0039492 transcript:FBtr0113297)

HSP 1 Score: 68.9366 bits (167), Expect = 7.670e-12
Identity = 30/66 (45.45%), Postives = 36/66 (54.55%), Query Frame = 2
Query: 1379 LTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSR--KPVRVCDACFI 1570
            L+   WI D  A  C  C  PF+   R+HHCRNCG V C  CS+ SA L      K VRVC  C++
Sbjct:  901 LSPPAWIPDGKAPRCMACQTPFTAFRRRHHCRNCGGVFCGVCSNASAPLPKYGLTKAVRVCRDCYV 966          
BLAST of early endosome antigen 1-like vs. Ensembl Zebrafish
Match: eea1 (early endosome antigen 1 [Source:ZFIN;Acc:ZDB-GENE-041111-270])

HSP 1 Score: 106.686 bits (265), Expect = 1.666e-25
Identity = 44/91 (48.35%), Postives = 62/91 (68.13%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACFIE 1573
            ++ D   +A+ +LGRENQSLQI + +   R+W  D +   C  C K FS+T+RKHHCR+CG + C +CS+++A    S+KPVRVCD CF E
Sbjct:  162 RKLDDTTAAMQELGRENQSLQIKQSQSLTRKWTEDHEVQNCMACGKGFSVTVRKHHCRHCGNIFCAECSARNALTPSSKKPVRVCDNCFDE 252          
BLAST of early endosome antigen 1-like vs. Ensembl Zebrafish
Match: eea1 (early endosome antigen 1 [Source:ZFIN;Acc:ZDB-GENE-041111-270])

HSP 1 Score: 112.079 bits (279), Expect = 3.381e-25
Identity = 44/91 (48.35%), Postives = 62/91 (68.13%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACFIE 1573
            ++ D   +A+ +LGRENQSLQI + +   R+W  D +   C  C K FS+T+RKHHCR+CG + C +CS+++A    S+KPVRVCD CF E
Sbjct: 1305 RKLDDTTAAMQELGRENQSLQIKQSQSLTRKWTEDHEVQNCMACGKGFSVTVRKHHCRHCGNIFCAECSARNALTPSSKKPVRVCDNCFDE 1395          
BLAST of early endosome antigen 1-like vs. Ensembl Zebrafish
Match: rufy2 (RUN and FYVE domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-070424-66])

HSP 1 Score: 83.1889 bits (204), Expect = 2.643e-16
Identity = 36/79 (45.57%), Postives = 45/79 (56.96%), Query Frame = 2
Query: 1328 ILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            I D+   N++LQ        + W+ D DA  C  C K FS++ RKHHCRNCG++ C  CS     L  S KPVRVCD C
Sbjct:  547 IEDIKEANKALQ------GGQVWLKDKDATHCKLCEKEFSISRRKHHCRNCGEIFCNACSDNELPLPASPKPVRVCDTC 619          
BLAST of early endosome antigen 1-like vs. Ensembl Zebrafish
Match: rufy2 (RUN and FYVE domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-070424-66])

HSP 1 Score: 83.1889 bits (204), Expect = 2.987e-16
Identity = 36/79 (45.57%), Postives = 45/79 (56.96%), Query Frame = 2
Query: 1328 ILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            I D+   N++LQ        + W+ D DA  C  C K FS++ RKHHCRNCG++ C  CS     L  S KPVRVCD C
Sbjct:  547 IEDIKEANKALQ------GGQVWLKDKDATHCKLCEKEFSISRRKHHCRNCGEIFCNACSDNELPLPASPKPVRVCDTC 619          
BLAST of early endosome antigen 1-like vs. Ensembl Zebrafish
Match: rufy2 (RUN and FYVE domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-070424-66])

HSP 1 Score: 83.1889 bits (204), Expect = 2.987e-16
Identity = 36/79 (45.57%), Postives = 45/79 (56.96%), Query Frame = 2
Query: 1328 ILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            I D+   N++LQ        + W+ D DA  C  C K FS++ RKHHCRNCG++ C  CS     L  S KPVRVCD C
Sbjct:  547 IEDIKEANKALQ------GGQVWLKDKDATHCKLCEKEFSISRRKHHCRNCGEIFCNACSDNELPLPASPKPVRVCDTC 619          
BLAST of early endosome antigen 1-like vs. Ensembl Xenopus
Match: ovol1 (ovo like zinc finger 1 [Source:Xenbase;Acc:XB-GENE-5964939])

HSP 1 Score: 108.997 bits (271), Expect = 5.186e-24
Identity = 43/89 (48.31%), Postives = 60/89 (67.42%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACF 1567
            K+ D+   A+ +LGRENQSLQI   +  +R+W  D +   C +C + FS+T+R+HHCR CG + C +CSSK+A    S+K VRVCD CF
Sbjct: 1174 KKVDESSYAMEELGRENQSLQIKHNQALSRKWTEDHEVQNCMSCGRGFSVTIRRHHCRQCGNIFCHECSSKNALTPSSKKAVRVCDTCF 1262          
BLAST of early endosome antigen 1-like vs. Ensembl Xenopus
Match: ovol1 (ovo like zinc finger 1 [Source:Xenbase;Acc:XB-GENE-5964939])

HSP 1 Score: 108.612 bits (270), Expect = 7.290e-24
Identity = 43/89 (48.31%), Postives = 60/89 (67.42%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACF 1567
            K+ D+   A+ +LGRENQSLQI   +  +R+W  D +   C +C + FS+T+R+HHCR CG + C +CSSK+A    S+K VRVCD CF
Sbjct: 1269 KKVDESSYAMEELGRENQSLQIKHNQALSRKWTEDHEVQNCMSCGRGFSVTIRRHHCRQCGNIFCHECSSKNALTPSSKKAVRVCDTCF 1357          
BLAST of early endosome antigen 1-like vs. Ensembl Xenopus
Match: ovol1 (ovo like zinc finger 1 [Source:Xenbase;Acc:XB-GENE-5964939])

HSP 1 Score: 108.227 bits (269), Expect = 7.732e-24
Identity = 43/89 (48.31%), Postives = 60/89 (67.42%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACF 1567
            K+ D+   A+ +LGRENQSLQI   +  +R+W  D +   C +C + FS+T+R+HHCR CG + C +CSSK+A    S+K VRVCD CF
Sbjct: 1319 KKVDESSYAMEELGRENQSLQIKHNQALSRKWTEDHEVQNCMSCGRGFSVTIRRHHCRQCGNIFCHECSSKNALTPSSKKAVRVCDTCF 1407          
BLAST of early endosome antigen 1-like vs. Ensembl Xenopus
Match: ovol1 (ovo like zinc finger 1 [Source:Xenbase;Acc:XB-GENE-5964939])

HSP 1 Score: 108.227 bits (269), Expect = 8.031e-24
Identity = 43/89 (48.31%), Postives = 60/89 (67.42%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACF 1567
            K+ D+   A+ +LGRENQSLQI   +  +R+W  D +   C +C + FS+T+R+HHCR CG + C +CSSK+A    S+K VRVCD CF
Sbjct: 1214 KKVDESSYAMEELGRENQSLQIKHNQALSRKWTEDHEVQNCMSCGRGFSVTIRRHHCRQCGNIFCHECSSKNALTPSSKKAVRVCDTCF 1302          
BLAST of early endosome antigen 1-like vs. Ensembl Xenopus
Match: ovol1 (ovo like zinc finger 1 [Source:Xenbase;Acc:XB-GENE-5964939])

HSP 1 Score: 107.842 bits (268), Expect = 9.793e-24
Identity = 43/89 (48.31%), Postives = 60/89 (67.42%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACF 1567
            K+ D+   A+ +LGRENQSLQI   +  +R+W  D +   C +C + FS+T+R+HHCR CG + C +CSSK+A    S+K VRVCD CF
Sbjct: 1088 KKVDESSYAMEELGRENQSLQIKHNQALSRKWTEDHEVQNCMSCGRGFSVTIRRHHCRQCGNIFCHECSSKNALTPSSKKAVRVCDTCF 1176          
BLAST of early endosome antigen 1-like vs. Ensembl Mouse
Match: Eea1 (early endosome antigen 1 [Source:MGI Symbol;Acc:MGI:2442192])

HSP 1 Score: 114.39 bits (285), Expect = 7.785e-26
Identity = 45/89 (50.56%), Postives = 62/89 (69.66%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACF 1567
            ++ D   +A+ +LGRENQSLQI   +  NR+W  D +   C +C K FS+T+R+HHCR CG + C +CS+K+A    S+KPVRVCDACF
Sbjct: 1318 RKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMSCGKCFSVTVRRHHCRQCGNIFCAECSTKNALTPSSKKPVRVCDACF 1406          
BLAST of early endosome antigen 1-like vs. Ensembl Mouse
Match: Rufy2 (RUN and FYVE domain-containing 2 [Source:MGI Symbol;Acc:MGI:1917682])

HSP 1 Score: 81.2629 bits (199), Expect = 1.155e-15
Identity = 32/57 (56.14%), Postives = 37/57 (64.91%), Query Frame = 2
Query: 1394 WIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            W+ D DA  C  C K FSL+ RKHHCRNCG++ C  CS     L  S KPVRVCD+C
Sbjct:  537 WLKDKDATHCKLCEKEFSLSKRKHHCRNCGEIFCNACSDNELPLPSSPKPVRVCDSC 593          
BLAST of early endosome antigen 1-like vs. Ensembl Mouse
Match: Rufy1 (RUN and FYVE domain containing 1 [Source:MGI Symbol;Acc:MGI:2429762])

HSP 1 Score: 78.1814 bits (191), Expect = 1.475e-14
Identity = 41/95 (43.16%), Postives = 53/95 (55.79%), Query Frame = 2
Query: 1292 KKCKEFDQ-LQSAILDLGRENQSLQISKE---KLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            K C+E +Q LQ   L L +    ++  KE    L    W+ D +A  C  C K FS++ RKHHCRNCG + C  CSS   +L    KPVRVCD+C
Sbjct:  605 KVCEEQEQALQEMGLHLSQSKLKMEDIKEVNKALKGHTWLKDDEATHCKQCEKDFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSC 699          
BLAST of early endosome antigen 1-like vs. Ensembl Mouse
Match: Zfyve28 (zinc finger, FYVE domain containing 28 [Source:MGI Symbol;Acc:MGI:2684992])

HSP 1 Score: 67.781 bits (164), Expect = 3.012e-11
Identity = 28/62 (45.16%), Postives = 38/62 (61.29%), Query Frame = 2
Query: 1391 QWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLA--VSRKPVRVCDACFI 1570
            +W+ D     C +C  PF++  RKHHCR+CG++ C  CSS SA L      KPVRVC  C++
Sbjct:  831 EWVPDEACGFCTSCKAPFTVIRRKHHCRSCGKIFCSRCSSHSAPLPRYGQVKPVRVCTHCYM 892          
BLAST of early endosome antigen 1-like vs. Ensembl Mouse
Match: Fgd6 (FYVE, RhoGEF and PH domain containing 6 [Source:MGI Symbol;Acc:MGI:1261419])

HSP 1 Score: 63.5438 bits (153), Expect = 5.852e-10
Identity = 28/61 (45.90%), Postives = 36/61 (59.02%), Query Frame = 2
Query: 1394 WIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASL-AVSRKPVRVCDACFIE 1573
            WI D  A  C  C   F+LT R+HHCR CG+++CQ CSS    L  +  +  RVC+ CF E
Sbjct: 1188 WIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACSSNKYGLDYLKGQLARVCEHCFQE 1248          
BLAST of early endosome antigen 1-like vs. UniProt/SwissProt
Match: sp|Q15075|EEA1_HUMAN (Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2)

HSP 1 Score: 116.701 bits (291), Expect = 1.019e-25
Identity = 45/89 (50.56%), Postives = 61/89 (68.54%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACF 1567
            ++ D   +A+ +LGRENQSLQI   +  NR+W  D +   C  C K FS+T+R+HHCR CG + C +CS+K+A    S+KPVRVCDACF
Sbjct: 1318 RKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACF 1406          
BLAST of early endosome antigen 1-like vs. UniProt/SwissProt
Match: sp|Q8BL66|EEA1_MOUSE (Early endosome antigen 1 OS=Mus musculus OX=10090 GN=Eea1 PE=1 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 5.445e-25
Identity = 45/89 (50.56%), Postives = 62/89 (69.66%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACF 1567
            ++ D   +A+ +LGRENQSLQI   +  NR+W  D +   C +C K FS+T+R+HHCR CG + C +CS+K+A    S+KPVRVCDACF
Sbjct: 1318 RKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMSCGKCFSVTVRRHHCRQCGNIFCAECSTKNALTPSSKKPVRVCDACF 1406          
BLAST of early endosome antigen 1-like vs. UniProt/SwissProt
Match: sp|Q8R4C2|RUFY2_MOUSE (RUN and FYVE domain-containing protein 2 OS=Mus musculus OX=10090 GN=Rufy2 PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 8.080e-15
Identity = 32/57 (56.14%), Postives = 37/57 (64.91%), Query Frame = 2
Query: 1394 WIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            W+ D DA  C  C K FSL+ RKHHCRNCG++ C  CS     L  S KPVRVCD+C
Sbjct:  537 WLKDKDATHCKLCEKEFSLSKRKHHCRNCGEIFCNACSDNELPLPSSPKPVRVCDSC 593          
BLAST of early endosome antigen 1-like vs. UniProt/SwissProt
Match: sp|Q5R5R4|RUFY2_PONAB (RUN and FYVE domain-containing protein 2 OS=Pongo abelii OX=9601 GN=RUFY2 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.423e-14
Identity = 31/57 (54.39%), Postives = 37/57 (64.91%), Query Frame = 2
Query: 1394 WIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            W+ D +A  C  C K FSL+ RKHHCRNCG++ C  CS     L  S KPVRVCD+C
Sbjct:  537 WLKDKEATHCKLCEKEFSLSKRKHHCRNCGEIFCNACSDNELPLPSSPKPVRVCDSC 593          
BLAST of early endosome antigen 1-like vs. UniProt/SwissProt
Match: sp|Q8WXA3|RUFY2_HUMAN (RUN and FYVE domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RUFY2 PE=1 SV=3)

HSP 1 Score: 79.337 bits (194), Expect = 3.423e-14
Identity = 31/57 (54.39%), Postives = 37/57 (64.91%), Query Frame = 2
Query: 1394 WIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            W+ D +A  C  C K FSL+ RKHHCRNCG++ C  CS     L  S KPVRVCD+C
Sbjct:  537 WLKDKEATHCKLCEKEFSLSKRKHHCRNCGEIFCNACSDNELPLPSSPKPVRVCDSC 593          
BLAST of early endosome antigen 1-like vs. TrEMBL
Match: V3ZP83 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_132243 PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 1.078e-30
Identity = 52/91 (57.14%), Postives = 69/91 (75.82%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACFIE 1573
            ++ D  ++A+ +LGRENQ+LQI+  K+TNR+W  D +A +C  C K FS+T R+HHCRNCG + C DCSSK+  LA S+KPVRVCDACF E
Sbjct:  203 RKLDDTEAALQELGRENQTLQITSTKVTNRKWTDDTEATDCSACRKAFSVTNRRHHCRNCGHIFCNDCSSKTVPLAASKKPVRVCDACFTE 293          
BLAST of early endosome antigen 1-like vs. TrEMBL
Match: A0A0V0J4C2 (FYVE-type domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR149303 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.452e-28
Identity = 50/91 (54.95%), Postives = 69/91 (75.82%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACFIE 1573
            +E + LQ  +LDLGR+NQ+LQI+++++T+RQW+ D  A  C  C + FSL+LRKHHCR CG V CQ CS+K A++  S+ P+RVCDACF E
Sbjct:  369 QELESLQRIVLDLGRQNQTLQIAQQRMTSRQWVADESASACSNCQREFSLSLRKHHCRRCGDVFCQTCSTKKATMPASKSPLRVCDACFTE 459          
BLAST of early endosome antigen 1-like vs. TrEMBL
Match: A0A3P7ESH3 (FYVE-type domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS3550 PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 3.659e-28
Identity = 50/90 (55.56%), Postives = 67/90 (74.44%), Query Frame = 2
Query: 1304 EFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACFIE 1573
            E + LQ  +LDLGR+NQ+LQI++++LTNRQWI D     C  C K FS+++RKHHCR+CG+V CQ CSSK  + + S+ P+RVCD CF E
Sbjct:  218 EMEGLQRIVLDLGRQNQALQITQDRLTNRQWISDDSVQSCSNCQKDFSISVRKHHCRHCGKVFCQACSSKKTATSASKDPLRVCDGCFAE 307          
BLAST of early endosome antigen 1-like vs. TrEMBL
Match: A0A0R3WS25 (FYVE-type domain-containing protein OS=Hydatigena taeniaeformis OX=6205 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 4.115e-28
Identity = 50/90 (55.56%), Postives = 67/90 (74.44%), Query Frame = 2
Query: 1304 EFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACFIE 1573
            E + LQ  +LDLGR+NQ+LQI++++LTNRQWI D     C  C K FS+++RKHHCR+CG+V CQ CSSK  + + S+ P+RVCD CF E
Sbjct:  218 EMEGLQRIVLDLGRQNQALQITQDRLTNRQWISDDSVQSCSNCQKDFSISVRKHHCRHCGKVFCQACSSKKTATSASKDPLRVCDGCFAE 307          
BLAST of early endosome antigen 1-like vs. TrEMBL
Match: A0A1S3KAC2 (early endosome antigen 1-like OS=Lingula unguis OX=7574 GN=LOC106179935 PE=4 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 7.101e-28
Identity = 48/91 (52.75%), Postives = 70/91 (76.92%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACFIE 1573
            ++F++  +A+ +LGRENQ LQI   K+  R+W  D + +EC  C KPFS+T+R+HHCRNCGQ+ C +CSS++A++A S+KPVRVCD C+ E
Sbjct: 1570 RKFEETTAALQELGRENQVLQIQTTKVVTRKWADDSEVLECQACSKPFSVTVRRHHCRNCGQIFCHECSSRNATIASSKKPVRVCDTCYGE 1660          
BLAST of early endosome antigen 1-like vs. Ensembl Cavefish
Match: eea1 (early endosome antigen 1 [Source:ZFIN;Acc:ZDB-GENE-041111-270])

HSP 1 Score: 109.768 bits (273), Expect = 1.719e-24
Identity = 44/91 (48.35%), Postives = 64/91 (70.33%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACFIE 1573
            ++ D   +A+ +LGRENQSLQI + +   R+W  D +   C +C K FS+T+RKHHCR+CG + C +CS+++A    S+KPVRVC+ACF E
Sbjct: 1271 RKLDDTTAAMQELGRENQSLQIKQSQSLTRKWAEDNEVQNCMSCGKGFSVTIRKHHCRHCGNIFCAECSARNALTPSSKKPVRVCEACFEE 1361          
BLAST of early endosome antigen 1-like vs. Ensembl Cavefish
Match: eea1 (early endosome antigen 1 [Source:ZFIN;Acc:ZDB-GENE-041111-270])

HSP 1 Score: 109.768 bits (273), Expect = 1.815e-24
Identity = 44/91 (48.35%), Postives = 64/91 (70.33%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACFIE 1573
            ++ D   +A+ +LGRENQSLQI + +   R+W  D +   C +C K FS+T+RKHHCR+CG + C +CS+++A    S+KPVRVC+ACF E
Sbjct: 1306 RKLDDTTAAMQELGRENQSLQIKQSQSLTRKWAEDNEVQNCMSCGKGFSVTIRKHHCRHCGNIFCAECSARNALTPSSKKPVRVCEACFEE 1396          
BLAST of early endosome antigen 1-like vs. Ensembl Cavefish
Match: rufy2 (RUN and FYVE domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-070424-66])

HSP 1 Score: 77.411 bits (189), Expect = 4.549e-16
Identity = 31/57 (54.39%), Postives = 36/57 (63.16%), Query Frame = 2
Query: 1394 WIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            W+ D DA  C  C K FS++ RKHHCRNCG++ C  CS     L  S KPVRVCD C
Sbjct:  112 WLKDKDATHCKLCEKEFSISRRKHHCRNCGEIFCNACSDNELPLPASPKPVRVCDTC 168          
BLAST of early endosome antigen 1-like vs. Ensembl Cavefish
Match: rufy2 (RUN and FYVE domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-070424-66])

HSP 1 Score: 80.1073 bits (196), Expect = 1.931e-15
Identity = 36/79 (45.57%), Postives = 45/79 (56.96%), Query Frame = 2
Query: 1328 ILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            I D+   N++LQ        + W+ D DA  C  C K FS++ RKHHCRNCG++ C  CS     L  S KPVRVCD C
Sbjct:  513 IEDIKEANKALQ------GGQVWLKDKDATHCKLCEKEFSISRRKHHCRNCGEIFCNACSDNELPLPASPKPVRVCDTC 585          
BLAST of early endosome antigen 1-like vs. Ensembl Cavefish
Match: rufy2 (RUN and FYVE domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-070424-66])

HSP 1 Score: 80.4925 bits (197), Expect = 2.016e-15
Identity = 36/79 (45.57%), Postives = 45/79 (56.96%), Query Frame = 2
Query: 1328 ILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            I D+   N++LQ        + W+ D DA  C  C K FS++ RKHHCRNCG++ C  CS     L  S KPVRVCD C
Sbjct:  572 IEDIKEANKALQ------GGQVWLKDKDATHCKLCEKEFSISRRKHHCRNCGEIFCNACSDNELPLPASPKPVRVCDTC 644          
BLAST of early endosome antigen 1-like vs. Ensembl Sea Lamprey
Match: eea1 (early endosome antigen 1 [Source:ZFIN;Acc:ZDB-GENE-041111-270])

HSP 1 Score: 107.842 bits (268), Expect = 1.443e-24
Identity = 41/91 (45.05%), Postives = 65/91 (71.43%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACFIE 1573
            ++ + + +A+ +LGRENQSLQI   ++ +R+W  D +   C  C K FS+T+RKHHCR+CG + C +CS++++ +  ++KPVRVCD CF E
Sbjct: 1276 RKLEDVTAAMQELGRENQSLQIKHTQVLSRKWAEDGEVQNCMGCGKGFSVTVRKHHCRHCGNIFCGECSARNSMIPSAKKPVRVCDTCFEE 1366          
BLAST of early endosome antigen 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001934.1 (pep scaffold:Pmarinus_7.0:GL488632:1056:3278:1 gene:ENSPMAG00000001758.1 transcript:ENSPMAT00000001934.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 3.160e-17
Identity = 32/62 (51.61%), Postives = 38/62 (61.29%), Query Frame = 2
Query: 1379 LTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            L  + W+ D DA  C  C K FS++ RKHHCRNCG++ C  CS     L  S KPVRVCD C
Sbjct:   50 LQGQVWLKDQDATNCKLCEKEFSISRRKHHCRNCGEIFCNSCSDNELPLPSSPKPVRVCDLC 111          
BLAST of early endosome antigen 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005437.1 (pep scaffold:Pmarinus_7.0:GL486528:10206:16522:1 gene:ENSPMAG00000004933.1 transcript:ENSPMAT00000005437.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 4.676e-12
Identity = 29/62 (46.77%), Postives = 39/62 (62.90%), Query Frame = 2
Query: 1394 WIGDLDAVECFTCHKPFS-LTLRKHHCRNCGQVLCQDCSSKSASLAV-SRKPVRVCDACFIE 1573
            W+ D++   C TC  PF+ LT R+HHCR CG+V+C  CS     LA   RK  RVC+AC+ +
Sbjct:  228 WVRDVNVTLCMTCQDPFTTLTRRRHHCRACGKVVCWKCSDHRVLLAYEPRKLQRVCEACYAQ 289          
BLAST of early endosome antigen 1-like vs. Ensembl Sea Lamprey
Match: ankfy1 (ankyrin repeat and FYVE domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-041222-1])

HSP 1 Score: 63.929 bits (154), Expect = 7.848e-11
Identity = 27/55 (49.09%), Postives = 34/55 (61.82%), Query Frame = 2
Query: 1409 DAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVS--RKPVRVCDACF 1567
            D   C+ C   F +T RKHHCR+CG++LC  CS+K   +      KPVRVCD CF
Sbjct: 1105 DGSNCYECAAKFGVTTRKHHCRHCGRLLCNRCSAKEIPIIKFDLNKPVRVCDICF 1159          
BLAST of early endosome antigen 1-like vs. Ensembl Sea Lamprey
Match: zfyve1 (zinc finger, FYVE domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-131205-1])

HSP 1 Score: 55.8398 bits (133), Expect = 8.705e-9
Identity = 26/68 (38.24%), Postives = 35/68 (51.47%), Query Frame = 2
Query: 1373 EKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASL---AVSRKPVRVCDACF 1567
            +++    W  +   + C  C+K F     KHHCR CG+  C  CSS+S  +        PVRVCDACF
Sbjct:  114 DQIAPAYWRPNAVVIACHNCNKQFEEKDTKHHCRACGEGFCGACSSRSRPVPERGWGPNPVRVCDACF 181          

HSP 2 Score: 47.7506 bits (112), Expect = 3.324e-6
Identity = 28/76 (36.84%), Postives = 38/76 (50.00%), Query Frame = 2
Query: 1349 NQSLQISKEKLTNRQWIGDLDAVECFTCHKPF-SLTLRKHHCRNCGQVLCQDCSSKSASLAVSRK---PVRVCDAC 1564
            N  L + K+      W+ D +   C  C+K   S  L KHHCR CG+  C +CS+    +  SR    PVRVC+ C
Sbjct:  225 NYPLGLVKDVARPTYWVPDHEIASCQDCNKDMTSGKLAKHHCRACGKGFCNECSTARRPVP-SRGWDHPVRVCNTC 299          
BLAST of early endosome antigen 1-like vs. Ensembl Yeast
Match: VPS27 (Endosomal protein that forms a complex with Hse1p; required for recycling Golgi proteins, forming lumenal membranes and sorting ubiquitinated proteins destined for degradation; has Ubiquitin Interaction Motifs which bind ubiquitin (Ubi4p) [Source:SGD;Acc:S000005289])

HSP 1 Score: 68.5514 bits (166), Expect = 1.391e-12
Identity = 35/64 (54.69%), Postives = 39/64 (60.94%), Query Frame = 2
Query: 1382 TNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLA--VSRKPVRVCDACF 1567
            T   WI D DA  C  C K FSL  RKHHCR+CG V CQ+ SS S  L      +PVRVCD+CF
Sbjct:  166 TPADWI-DSDA--CMICSKKFSLLNRKHHCRSCGGVFCQEHSSNSIPLPDLGIYEPVRVCDSCF 226          
BLAST of early endosome antigen 1-like vs. Ensembl Yeast
Match: PIB2 (Protein of unknown function; contains FYVE domain; similar to Fab1 and Vps27 [Source:SGD;Acc:S000002991])

HSP 1 Score: 58.151 bits (139), Expect = 2.323e-9
Identity = 22/40 (55.00%), Postives = 25/40 (62.50%), Query Frame = 2
Query: 1382 TNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQD 1501
            T   WI D     C  CHKPF+L  RKHHCR+CG + CQD
Sbjct:  445 TKDHWIPDSKRNSCRYCHKPFTLWERKHHCRHCGDIFCQD 484          
BLAST of early endosome antigen 1-like vs. Ensembl Yeast
Match: FAB1 (1-phosphatidylinositol-3-phosphate 5-kinase; vacuolar membrane kinase that generates phosphatidylinositol (3,5)P2, which is involved in vacuolar sorting and homeostasis [Source:SGD;Acc:S000001915])

HSP 1 Score: 53.1434 bits (126), Expect = 1.050e-7
Identity = 20/43 (46.51%), Postives = 27/43 (62.79%), Query Frame = 2
Query: 1379 LTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCS 1507
            L+   W+ D  + ECF+C K F+   RKHHCR CGQ+ C  C+
Sbjct:  232 LSKEYWMKDESSKECFSCGKTFNTFRRKHHCRICGQIFCSSCT 274          
BLAST of early endosome antigen 1-like vs. Ensembl Yeast
Match: PEP7 (Adaptor protein involved in vesicle-mediated vacuolar protein sorting; multivalent adaptor protein; facilitates vesicle-mediated vacuolar protein sorting by ensuring high-fidelity vesicle docking and fusion, which are essential for targeting of vesicles to the endosome; required for vacuole inheritance [Source:SGD;Acc:S000002731])

HSP 1 Score: 51.6026 bits (122), Expect = 2.556e-7
Identity = 22/49 (44.90%), Postives = 29/49 (59.18%), Query Frame = 2
Query: 1361 QISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCS 1507
            ++SK + T   W  D   + C  C +PF L LRKHHCR CG V+C D +
Sbjct:  201 EMSKLERTVTPWRDDRSVLFCNICSEPFGLLLRKHHCRLCGMVVCDDAN 249          
BLAST of early endosome antigen 1-like vs. Ensembl Yeast
Match: PIB1 (RING-type ubiquitin ligase of the endosomal and vacuolar membranes; binds phosphatidylinositol(3)-phosphate; contains a FYVE finger domain [Source:SGD;Acc:S000002721])

HSP 1 Score: 49.2914 bits (116), Expect = 6.061e-7
Identity = 22/72 (30.56%), Postives = 32/72 (44.44%), Query Frame = 2
Query: 1391 QWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLA-------------VSRKPVRVCDACF 1567
            +W  D +A  CF C   FS  +R+HHCR CG++ C  C+    +               V   P R C+ C+
Sbjct:   13 RWQADEEAHSCFQCKTNFSFLVRRHHCRCCGRIFCSSCTENFVNYNKKRVHALQKKNSDVESPPYRTCNECY 84          
BLAST of early endosome antigen 1-like vs. Ensembl Nematostella
Match: EDO44969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU81])

HSP 1 Score: 84.3445 bits (207), Expect = 7.102e-18
Identity = 32/58 (55.17%), Postives = 41/58 (70.69%), Query Frame = 2
Query: 1391 QWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            +W  D +A+ C  C +PFSL+ RKHHCR+CG + CQ CSS +  L  S KPVRVCD+C
Sbjct:  248 KWTDDKEALNCQQCEQPFSLSRRKHHCRSCGGIFCQPCSSNTMPLPSSAKPVRVCDSC 305          
BLAST of early endosome antigen 1-like vs. Ensembl Nematostella
Match: EDO44615 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVB5])

HSP 1 Score: 68.9366 bits (167), Expect = 1.363e-12
Identity = 25/59 (42.37%), Postives = 38/59 (64.41%), Query Frame = 2
Query: 1391 QWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACF 1567
            +W    DA EC  C KP +    K+HC +CG++ C+ C SK+ S + +R+P +VCDAC+
Sbjct:  311 RWEHKDDARECRNCQKPLNTNKDKYHCHHCGKIFCEGCRSKTFSNSSTRRPHQVCDACY 369          
BLAST of early endosome antigen 1-like vs. Ensembl Nematostella
Match: EDO38501 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCW3])

HSP 1 Score: 60.8474 bits (146), Expect = 2.003e-10
Identity = 28/60 (46.67%), Postives = 39/60 (65.00%), Query Frame = 2
Query: 1394 WIGDLDAVECFTCHKP-FSLTLRKHHCRNCGQVLCQDCSSKSASL-AVSRKPVRVCDACF 1567
            W+ D +A  C +C K  F+   R+HHCR CG V+C  CS+K   L A S KP+RVC++C+
Sbjct:  151 WVPDSEASTCMSCMKTKFTAINRRHHCRKCGAVVCGACSTKKFLLPAQSSKPLRVCNSCY 210          
BLAST of early endosome antigen 1-like vs. Ensembl Nematostella
Match: EDO39875 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S0])

HSP 1 Score: 58.9214 bits (141), Expect = 3.337e-10
Identity = 27/55 (49.09%), Postives = 33/55 (60.00%), Query Frame = 2
Query: 1409 DAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVS--RKPVRVCDACF 1567
            D   C+ C   FS+  RKHHCR+CG++LC  CS K   +      KPVRVCD CF
Sbjct:  111 DGDSCYECGMKFSIKHRKHHCRHCGRLLCAKCSCKQIPIIKYELAKPVRVCDVCF 165          
BLAST of early endosome antigen 1-like vs. Ensembl Nematostella
Match: EDO48232 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKE8])

HSP 1 Score: 61.2326 bits (147), Expect = 5.553e-10
Identity = 25/59 (42.37%), Postives = 32/59 (54.24%), Query Frame = 2
Query: 1394 WIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLA-VSRKPVRVCDACF 1567
            WI D     C  C   F++T R+HHCR CG+V+C  CS   A L  +     RVCD C+
Sbjct:  341 WIPDARVTMCMLCTDDFTVTNRRHHCRGCGKVVCGSCSDNLAPLTYLDYAQARVCDMCY 399          
BLAST of early endosome antigen 1-like vs. Ensembl Medaka
Match: eea1 (early endosome antigen 1 [Source:NCBI gene;Acc:101175647])

HSP 1 Score: 111.694 bits (278), Expect = 3.598e-25
Identity = 44/91 (48.35%), Postives = 62/91 (68.13%), Query Frame = 2
Query: 1301 KEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACFIE 1573
            ++ D   +A+ +LGRENQSLQI + +   R+W  D +   C  C K FS+T+RKHHCR+CG + C +CSS++A    S+KPVRVC+ CF E
Sbjct: 1261 RKLDDTTAAMQELGRENQSLQIKQSQSLTRKWAEDHEVQNCMACGKGFSVTVRKHHCRHCGNIFCAECSSRNALTPSSKKPVRVCETCFEE 1351          
BLAST of early endosome antigen 1-like vs. Ensembl Medaka
Match: rufy2 (RUN and FYVE domain containing 2 [Source:NCBI gene;Acc:101165874])

HSP 1 Score: 83.9593 bits (206), Expect = 1.679e-16
Identity = 36/79 (45.57%), Postives = 45/79 (56.96%), Query Frame = 2
Query: 1328 ILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            I D+   N++LQ        + W+ D DA  C  C K FS++ RKHHCRNCG++ C  CS     L  S KPVRVCD C
Sbjct:  618 IEDIKEANKALQ------GGQVWLKDKDATHCKMCEKEFSISRRKHHCRNCGEIFCNSCSDNELPLPASPKPVRVCDTC 690          
BLAST of early endosome antigen 1-like vs. Ensembl Medaka
Match: rufy1 (RUN and FYVE domain-containing protein 1 [Source:NCBI gene;Acc:101155857])

HSP 1 Score: 77.0258 bits (188), Expect = 1.896e-14
Identity = 30/62 (48.39%), Postives = 37/62 (59.68%), Query Frame = 2
Query: 1379 LTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            L    W+ D +A +C  C K FS+  RKHHCRNCG + C  CSS   +L    +PVRVCD C
Sbjct:  495 LKGHAWLKDDEATQCKQCQKEFSIARRKHHCRNCGDIYCNSCSSNELALPSYPRPVRVCDVC 556          
BLAST of early endosome antigen 1-like vs. Ensembl Medaka
Match: rufy1 (RUN and FYVE domain-containing protein 1 [Source:NCBI gene;Acc:101155857])

HSP 1 Score: 76.6406 bits (187), Expect = 3.055e-14
Identity = 30/62 (48.39%), Postives = 37/62 (59.68%), Query Frame = 2
Query: 1379 LTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            L    W+ D +A +C  C K FS+  RKHHCRNCG + C  CSS   +L    +PVRVCD C
Sbjct:  687 LKGHAWLKDDEATQCKQCQKEFSIARRKHHCRNCGDIYCNSCSSNELALPSYPRPVRVCDVC 748          
BLAST of early endosome antigen 1-like vs. Ensembl Medaka
Match: FGD6 (FYVE, RhoGEF and PH domain-containing protein 6 [Source:NCBI gene;Acc:101155348])

HSP 1 Score: 70.4774 bits (171), Expect = 2.969e-12
Identity = 29/58 (50.00%), Postives = 34/58 (58.62%), Query Frame = 2
Query: 1394 WIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACF 1567
            WI D     C  C   F+LT R+HHCR CG+V+CQ CSS    L   +K  RVCD CF
Sbjct:  976 WIPDPRTTMCMICTSEFTLTWRRHHCRACGKVICQGCSSNKHYLQYMKKSDRVCDLCF 1033          
BLAST of early endosome antigen 1-like vs. Planmine SMEST
Match: SMESG000008512.1 (SMESG000008512.1)

HSP 1 Score: 792.727 bits (2046), Expect = 0.000e+0
Identity = 470/474 (99.16%), Postives = 472/474 (99.58%), Query Frame = 2
Query:  152 NHKEKMQSENESNVLLIENLKANIDEQNAKIIHQAQCISQNELRMNQFSEQNAINQNMILNQSNEISNLKIRVSELENEKKHSENTVTELNELINEIESKKKTLLQEKSLLTTEMDLMKKNLFEIEELNTNLKNKNQLMENELLKIKETLKTSNENFETLKKENDKMNNELFICKSQVDNAQELYENSMKLQNEYLHKLDKVTLEYDNTKKRLKEIEEKYSYLQIENSXXXXXXXXXXXXXXNKVSALTKTLNESSENYKQERLEAAEKEFSLISSCEELKTELASLTKSLHRTEEDLETEKNLRESERNNMTEKISQLSXXXXXXXXXXXXXXXKLEIIETENIXXXXXXXXXXXXXXXXXXXXXXXXXSFKKQTDLYSKKCKEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACFIE 1573
            NHKEKMQSENESNVLLIENLKANIDEQNAKIIHQAQCI QNELRMNQFSEQNAIN+NMILNQSNEISNLKIRVSELE EKKHSENTVTELNELINEIESKKKTLLQEKSLLTTEMDLMKKNLFEIEELNTNLKNKNQLMENELLKIKETLKTSNENFETLKKENDKMNNELFICKSQVDNAQELYENSMKLQNEYLHKLDKVTLEYDNTKKRLK+IEEKYSYLQIENSKELELLKKEEGQLKNKVSALTKTLNESSENYKQERLEAAEKEFSLISSCEELKTELASLTKSLHRTEEDLETEKNLRESERNNMTEKISQLSEQVVVVENVRNECEQKLEIIETENIENKLRLELANEEKEKLLEKIIQLENSFKKQTDLYSKKCKEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACFIE
Sbjct:  616 NHKEKMQSENESNVLLIENLKANIDEQNAKIIHQAQCIIQNELRMNQFSEQNAINKNMILNQSNEISNLKIRVSELEKEKKHSENTVTELNELINEIESKKKTLLQEKSLLTTEMDLMKKNLFEIEELNTNLKNKNQLMENELLKIKETLKTSNENFETLKKENDKMNNELFICKSQVDNAQELYENSMKLQNEYLHKLDKVTLEYDNTKKRLKDIEEKYSYLQIENSKELELLKKEEGQLKNKVSALTKTLNESSENYKQERLEAAEKEFSLISSCEELKTELASLTKSLHRTEEDLETEKNLRESERNNMTEKISQLSEQVVVVENVRNECEQKLEIIETENIENKLRLELANEEKEKLLEKIIQLENSFKKQTDLYSKKCKEFDQLQSAILDLGRENQSLQISKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDACFIE 1089          
BLAST of early endosome antigen 1-like vs. Planmine SMEST
Match: SMESG000050873.1 (SMESG000050873.1)

HSP 1 Score: 81.6481 bits (200), Expect = 5.251e-16
Identity = 31/58 (53.45%), Postives = 39/58 (67.24%), Query Frame = 2
Query: 1391 QWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSRKPVRVCDAC 1564
            +W  D +  +C  C KPF+++ RKHHCR CG V C +CSS   SLA S KP+RVCD C
Sbjct:  543 RWTDDKEVNQCIQCAKPFNVSRRKHHCRRCGGVYCHECSSNRMSLASSSKPMRVCDTC 600          
BLAST of early endosome antigen 1-like vs. Planmine SMEST
Match: SMESG000069357.1 (SMESG000069357.1)

HSP 1 Score: 65.855 bits (159), Expect = 5.532e-11
Identity = 26/60 (43.33%), Postives = 34/60 (56.67%), Query Frame = 2
Query: 1391 QWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSR--KPVRVCDAC 1564
            +WI D     C  C   F+ +LRKHHCRNCG++ C  CS+    +   +   PVRVCD C
Sbjct:  609 RWIPDHAVTHCSNCKIIFTFSLRKHHCRNCGRIFCHPCSNNRCPIPKQKLNYPVRVCDTC 668          
BLAST of early endosome antigen 1-like vs. Planmine SMEST
Match: SMESG000039846.1 (SMESG000039846.1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.661e-10
Identity = 31/61 (50.82%), Postives = 34/61 (55.74%), Query Frame = 2
Query: 1391 QWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSR--KPVRVCDACF 1567
             WI D +A  C  C   FSLT R+HHCRNCG V C  CS     +   R  KPVRVC  CF
Sbjct: 1919 HWIRDENAEVCIGCKIRFSLTERRHHCRNCGLVFCNKCSKHETEIHRLRLFKPVRVCAKCF 1979          
BLAST of early endosome antigen 1-like vs. Planmine SMEST
Match: SMESG000039846.1 (SMESG000039846.1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.884e-10
Identity = 31/61 (50.82%), Postives = 34/61 (55.74%), Query Frame = 2
Query: 1391 QWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKSASLAVSR--KPVRVCDACF 1567
             WI D +A  C  C   FSLT R+HHCRNCG V C  CS     +   R  KPVRVC  CF
Sbjct: 3701 HWIRDENAEVCIGCKIRFSLTERRHHCRNCGLVFCNKCSKHETEIHRLRLFKPVRVCAKCF 3761          
The following BLAST results are available for this feature:
BLAST of early endosome antigen 1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EEA12.122e-2650.56early endosome antigen 1 [Source:HGNC Symbol;Acc:H... [more]
RUFY27.128e-1554.39RUN and FYVE domain containing 2 [Source:HGNC Symb... [more]
RUFY28.541e-1554.39RUN and FYVE domain containing 2 [Source:HGNC Symb... [more]
RUFY19.496e-1543.16RUN and FYVE domain containing 1 [Source:HGNC Symb... [more]
RUFY19.496e-1543.16RUN and FYVE domain containing 1 [Source:HGNC Symb... [more]
back to top
BLAST of early endosome antigen 1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eea-11.313e-2750.56EEA1 (Early Endosome Antigen, Rab effector) homolo... [more]
eea-11.323e-2750.56EEA1 (Early Endosome Antigen, Rab effector) homolo... [more]
ZK632.121.340e-1453.33pep chromosome:WBcel235:III:9830802:9832378:1 gene... [more]
ZK632.121.340e-1453.33pep chromosome:WBcel235:III:9830792:9832430:1 gene... [more]
lst-26.400e-1141.27Lateral signaling target protein 2 [Source:UniPro... [more]
back to top
BLAST of early endosome antigen 1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG310642.844e-1242.86gene:FBgn0051064 transcript:FBtr0085125[more]
CG310642.875e-1242.86gene:FBgn0051064 transcript:FBtr0339249[more]
CG60517.667e-1245.45gene:FBgn0039492 transcript:FBtr0339264[more]
CG60517.670e-1245.45gene:FBgn0039492 transcript:FBtr0305050[more]
CG60517.670e-1245.45gene:FBgn0039492 transcript:FBtr0113297[more]
back to top
BLAST of early endosome antigen 1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eea11.666e-2548.35early endosome antigen 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
eea13.381e-2548.35early endosome antigen 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
rufy22.643e-1645.57RUN and FYVE domain containing 2 [Source:ZFIN;Acc:... [more]
rufy22.987e-1645.57RUN and FYVE domain containing 2 [Source:ZFIN;Acc:... [more]
rufy22.987e-1645.57RUN and FYVE domain containing 2 [Source:ZFIN;Acc:... [more]
back to top
BLAST of early endosome antigen 1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ovol15.186e-2448.31ovo like zinc finger 1 [Source:Xenbase;Acc:XB-GENE... [more]
ovol17.290e-2448.31ovo like zinc finger 1 [Source:Xenbase;Acc:XB-GENE... [more]
ovol17.732e-2448.31ovo like zinc finger 1 [Source:Xenbase;Acc:XB-GENE... [more]
ovol18.031e-2448.31ovo like zinc finger 1 [Source:Xenbase;Acc:XB-GENE... [more]
ovol19.793e-2448.31ovo like zinc finger 1 [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of early endosome antigen 1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eea17.785e-2650.56early endosome antigen 1 [Source:MGI Symbol;Acc:MG... [more]
Rufy21.155e-1556.14RUN and FYVE domain-containing 2 [Source:MGI Symbo... [more]
Rufy11.475e-1443.16RUN and FYVE domain containing 1 [Source:MGI Symbo... [more]
Zfyve283.012e-1145.16zinc finger, FYVE domain containing 28 [Source:MGI... [more]
Fgd65.852e-1045.90FYVE, RhoGEF and PH domain containing 6 [Source:MG... [more]
back to top
BLAST of early endosome antigen 1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q15075|EEA1_HUMAN1.019e-2550.56Early endosome antigen 1 OS=Homo sapiens OX=9606 G... [more]
sp|Q8BL66|EEA1_MOUSE5.445e-2550.56Early endosome antigen 1 OS=Mus musculus OX=10090 ... [more]
sp|Q8R4C2|RUFY2_MOUSE8.080e-1556.14RUN and FYVE domain-containing protein 2 OS=Mus mu... [more]
sp|Q5R5R4|RUFY2_PONAB3.423e-1454.39RUN and FYVE domain-containing protein 2 OS=Pongo ... [more]
sp|Q8WXA3|RUFY2_HUMAN3.423e-1454.39RUN and FYVE domain-containing protein 2 OS=Homo s... [more]
back to top
BLAST of early endosome antigen 1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3ZP831.078e-3057.14Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A0V0J4C22.452e-2854.95FYVE-type domain-containing protein OS=Schistoceph... [more]
A0A3P7ESH33.659e-2855.56FYVE-type domain-containing protein OS=Hydatigena ... [more]
A0A0R3WS254.115e-2855.56FYVE-type domain-containing protein OS=Hydatigena ... [more]
A0A1S3KAC27.101e-2852.75early endosome antigen 1-like OS=Lingula unguis OX... [more]
back to top
BLAST of early endosome antigen 1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eea11.719e-2448.35early endosome antigen 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
eea11.815e-2448.35early endosome antigen 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
rufy24.549e-1654.39RUN and FYVE domain containing 2 [Source:ZFIN;Acc:... [more]
rufy21.931e-1545.57RUN and FYVE domain containing 2 [Source:ZFIN;Acc:... [more]
rufy22.016e-1545.57RUN and FYVE domain containing 2 [Source:ZFIN;Acc:... [more]
back to top
BLAST of early endosome antigen 1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eea11.443e-2445.05early endosome antigen 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000001934.13.160e-1751.61pep scaffold:Pmarinus_7.0:GL488632:1056:3278:1 gen... [more]
ENSPMAT00000005437.14.676e-1246.77pep scaffold:Pmarinus_7.0:GL486528:10206:16522:1 g... [more]
ankfy17.848e-1149.09ankyrin repeat and FYVE domain containing 1 [Sourc... [more]
zfyve18.705e-938.24zinc finger, FYVE domain containing 1 [Source:ZFIN... [more]
back to top
BLAST of early endosome antigen 1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
VPS271.391e-1254.69Endosomal protein that forms a complex with Hse1p;... [more]
PIB22.323e-955.00Protein of unknown function; contains FYVE domain;... [more]
FAB11.050e-746.511-phosphatidylinositol-3-phosphate 5-kinase; vacuo... [more]
PEP72.556e-744.90Adaptor protein involved in vesicle-mediated vacuo... [more]
PIB16.061e-730.56RING-type ubiquitin ligase of the endosomal and va... [more]
back to top
BLAST of early endosome antigen 1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO449697.102e-1855.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446151.363e-1242.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385012.003e-1046.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398753.337e-1049.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482325.553e-1042.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of early endosome antigen 1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eea13.598e-2548.35early endosome antigen 1 [Source:NCBI gene;Acc:101... [more]
rufy21.679e-1645.57RUN and FYVE domain containing 2 [Source:NCBI gene... [more]
rufy11.896e-1448.39RUN and FYVE domain-containing protein 1 [Source:N... [more]
rufy13.055e-1448.39RUN and FYVE domain-containing protein 1 [Source:N... [more]
FGD62.969e-1250.00FYVE, RhoGEF and PH domain-containing protein 6 [S... [more]
back to top
BLAST of early endosome antigen 1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008512.10.000e+099.16SMESG000008512.1[more]
SMESG000050873.15.251e-1653.45SMESG000050873.1[more]
SMESG000069357.15.532e-1143.33SMESG000069357.1[more]
SMESG000039846.11.661e-1050.82SMESG000039846.1[more]
SMESG000039846.11.884e-1050.82SMESG000039846.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004587 ID=SMED30004587|Name=early endosome antigen 1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1758bp
CGATCTGTGAATTGTATTTATACATTTTTATTTGAAGTTTTTTATCGATG
TTTCATTAAGATTTTCAATTTTTTCTTTTTATCTCATAAATGATAGGAAA
AAAATATTCCTTATAAAGTTTTGCTTAATGTTGAAAGATTTTTGCTAATA
GAATCACAAGGAAAAAATGCAATCTGAAAACGAATCAAATGTACTTTTGA
TTGAAAATCTTAAAGCTAATATTGATGAACAAAATGCAAAAATTATTCAT
CAAGCACAATGTATTAGTCAAAACGAGTTACGAATGAATCAATTTTCGGA
ACAAAACGCAATTAATCAAAACATGATTTTGAACCAATCAAACGAAATAT
CAAATTTGAAAATTAGAGTGAGTGAGTTAGAAAATGAGAAAAAACATTCA
GAAAATACAGTCACAGAATTAAATGAATTGATAAATGAAATAGAAAGTAA
GAAGAAAACACTTTTACAAGAAAAATCTTTGTTGACAACGGAGATGGATC
TCATGAAGAAAAATCTTTTTGAAATAGAAGAATTGAATACTAATCTTAAA
AATAAGAATCAATTAATGGAAAATGAACTCCTTAAAATTAAGGAAACTTT
GAAAACTTCCAATGAAAATTTTGAAACATTAAAAAAGGAAAACGATAAAA
TGAATAACGAATTGTTCATATGTAAAAGTCAAGTGGACAATGCTCAAGAA
CTGTATGAGAATTCTATGAAATTGCAGAATGAATACCTGCACAAGTTGGA
CAAGGTCACTTTAGAATATGATAATACTAAAAAGCGTCTAAAAGAGATTG
AAGAAAAATATTCGTACTTGCAAATAGAAAACTCTAAGGAACTTGAGTTA
TTAAAAAAAGAAGAAGGTCAATTGAAAAATAAAGTGTCAGCTCTGACAAA
GACTTTAAATGAAAGTTCCGAAAATTACAAACAGGAACGCTTGGAAGCCG
CAGAAAAGGAATTCTCCTTAATAAGTTCATGTGAAGAGCTTAAAACTGAA
TTGGCCAGTCTAACAAAATCTCTTCATCGAACTGAGGAGGATTTAGAAAC
AGAGAAAAATCTTCGTGAATCAGAACGCAACAATATGACGGAAAAAATCT
CTCAATTATCTGAACAGGTTGTTGTCGTAGAAAATGTTAGAAATGAATGT
GAACAGAAATTGGAAATCATTGAAACGGAAAATATTGAAAACAAACTCCG
ACTGGAACTGGCAAATGAAGAAAAAGAAAAACTGTTAGAGAAAATAATTC
AGCTAGAAAATAGTTTTAAAAAACAAACAGATTTATATTCGAAAAAATGT
AAGGAATTCGATCAACTGCAATCGGCGATTTTAGATCTTGGGAGAGAAAA
TCAAAGTTTGCAAATTTCAAAAGAAAAGCTAACTAATCGTCAGTGGATTG
GAGATTTAGATGCTGTAGAGTGTTTCACTTGTCATAAACCATTTTCACTC
ACATTACGGAAGCATCACTGTCGAAATTGTGGCCAAGTTTTGTGTCAAGA
TTGTTCTTCCAAATCTGCAAGTTTAGCAGTTTCTAGAAAACCAGTTCGTG
TTTGTGATGCATGCTTCATTGAAGTGCAATCTCAAAGAAGAAATAGCAGC
GTGAGCTCATCGAATATGAGTCTGCAGATATGAGCCTACAGTTGTTTTTT
ATCTCGCAAAATACATAGTCGCTGTTAAAATTGATTGTGCTGTAAATTAT
TATGCAGAATATTCAAATCATTTTTAAAAAATTAAATCTTTAAGAAGAAT
ATGAATGA
back to top

protein sequence of SMED30004587-orf-1

>SMED30004587-orf-1 ID=SMED30004587-orf-1|Name=SMED30004587-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=489bp
MQSENESNVLLIENLKANIDEQNAKIIHQAQCISQNELRMNQFSEQNAIN
QNMILNQSNEISNLKIRVSELENEKKHSENTVTELNELINEIESKKKTLL
QEKSLLTTEMDLMKKNLFEIEELNTNLKNKNQLMENELLKIKETLKTSNE
NFETLKKENDKMNNELFICKSQVDNAQELYENSMKLQNEYLHKLDKVTLE
YDNTKKRLKEIEEKYSYLQIENSKELELLKKEEGQLKNKVSALTKTLNES
SENYKQERLEAAEKEFSLISSCEELKTELASLTKSLHRTEEDLETEKNLR
ESERNNMTEKISQLSEQVVVVENVRNECEQKLEIIETENIENKLRLELAN
EEKEKLLEKIIQLENSFKKQTDLYSKKCKEFDQLQSAILDLGRENQSLQI
SKEKLTNRQWIGDLDAVECFTCHKPFSLTLRKHHCRNCGQVLCQDCSSKS
ASLAVSRKPVRVCDACFIEVQSQRRNSSVSSSNMSLQI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR000306Znf_FYVE
IPR013083Znf_RING/FYVE/PHD
IPR017455Znf_FYVE-rel
IPR011011Znf_FYVE_PHD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 226..246
NoneNo IPR availableCOILSCoilCoilcoord: 194..221
NoneNo IPR availableCOILSCoilCoilcoord: 272..373
NoneNo IPR availableCOILSCoilCoilcoord: 54..165
NoneNo IPR availableCOILSCoilCoilcoord: 388..408
NoneNo IPR availableGENE3DG3DSA:1.20.5.390coord: 348..409
e-value: 2.4E-10
score: 42.3
NoneNo IPR availablePANTHERPTHR23164:SF17EARLY ENDOSOME ANTIGEN 1coord: 158..467
NoneNo IPR availablePANTHERPTHR23164EARLY ENDOSOME ANTIGEN 1coord: 158..467
NoneNo IPR availableCDDcd15730FYVE_EEA1coord: 408..470
e-value: 2.61532E-30
score: 110.181
NoneNo IPR availableSUPERFAMILYSSF69979Eea1 homodimerisation domaincoord: 351..408
IPR000306FYVE zinc fingerSMARTSM00064fyve_4coord: 405..472
e-value: 5.8E-25
score: 98.9
IPR000306FYVE zinc fingerPFAMPF01363FYVEcoord: 409..471
e-value: 6.3E-18
score: 64.7
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 410..472
e-value: 1.3E-20
score: 75.2
IPR017455Zinc finger, FYVE-relatedPROSITEPS50178ZF_FYVEcoord: 413..471
score: 13.706
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 409..477