beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3

Overview
Namebeta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
Smed IDSMED30004585
Length (bp)1513
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004585

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30004585SMESG000043063.1 dd_Smed_v4_13967_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30004585SMESG000043063.1 dd_Smed_v4_13967_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT1 (glucosaminyl (N-acetyl) transferase 1 [Source:HGNC Symbol;Acc:HGNC:4203])

HSP 1 Score: 179.104 bits (453), Expect = 2.778e-50
Identity = 107/338 (31.66%), Postives = 175/338 (51.78%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVE-----AHYKRRFNKRIPTIN------------IPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYT-------CESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKV 1198
            Y ++  DC+ F+  +KY +     E+ E F IAYSIV       L+RLLR IY P N+YCIH+D KS + +  AV  +  C    + N+  +     V  ++ S + ADLNCMK+LY    NWKY INL G +FP+KTNLE+V+ L+   G NN+E     +H + R+ KR   +N             P     ++GS +  V+ E+V ++ ++ + + +++  +D + PDE  ++T+   P+  +PGS   +   +      +  F+      G  +       C+  + VR +CI+G GDL  ++   +LFANKF  +     ++CL+  +  K 
Sbjct:   93 YINMTSDCSSFIKRRKYIVEPLSKEEAE-FPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASC----FSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIPE--VPGSLPASHKYDLSDMQAVARFVKWQYFEGDVSKGAPYPPCDGVH-VRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT1 (glucosaminyl (N-acetyl) transferase 1 [Source:HGNC Symbol;Acc:HGNC:4203])

HSP 1 Score: 179.104 bits (453), Expect = 2.778e-50
Identity = 107/338 (31.66%), Postives = 175/338 (51.78%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVE-----AHYKRRFNKRIPTIN------------IPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYT-------CESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKV 1198
            Y ++  DC+ F+  +KY +     E+ E F IAYSIV       L+RLLR IY P N+YCIH+D KS + +  AV  +  C    + N+  +     V  ++ S + ADLNCMK+LY    NWKY INL G +FP+KTNLE+V+ L+   G NN+E     +H + R+ KR   +N             P     ++GS +  V+ E+V ++ ++ + + +++  +D + PDE  ++T+   P+  +PGS   +   +      +  F+      G  +       C+  + VR +CI+G GDL  ++   +LFANKF  +     ++CL+  +  K 
Sbjct:   93 YINMTSDCSSFIKRRKYIVEPLSKEEAE-FPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASC----FSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIPE--VPGSLPASHKYDLSDMQAVARFVKWQYFEGDVSKGAPYPPCDGVH-VRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT1 (glucosaminyl (N-acetyl) transferase 1 [Source:HGNC Symbol;Acc:HGNC:4203])

HSP 1 Score: 179.104 bits (453), Expect = 2.778e-50
Identity = 107/338 (31.66%), Postives = 175/338 (51.78%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVE-----AHYKRRFNKRIPTIN------------IPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYT-------CESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKV 1198
            Y ++  DC+ F+  +KY +     E+ E F IAYSIV       L+RLLR IY P N+YCIH+D KS + +  AV  +  C    + N+  +     V  ++ S + ADLNCMK+LY    NWKY INL G +FP+KTNLE+V+ L+   G NN+E     +H + R+ KR   +N             P     ++GS +  V+ E+V ++ ++ + + +++  +D + PDE  ++T+   P+  +PGS   +   +      +  F+      G  +       C+  + VR +CI+G GDL  ++   +LFANKF  +     ++CL+  +  K 
Sbjct:   93 YINMTSDCSSFIKRRKYIVEPLSKEEAE-FPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASC----FSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIPE--VPGSLPASHKYDLSDMQAVARFVKWQYFEGDVSKGAPYPPCDGVH-VRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT2 (glucosaminyl (N-acetyl) transferase 2 (I blood group) [Source:HGNC Symbol;Acc:HGNC:4204])

HSP 1 Score: 171.4 bits (433), Expect = 1.187e-47
Identity = 113/346 (32.66%), Postives = 173/346 (50.00%), Query Frame = 2
Query:  266 IHQ--DCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNV-----------------EAHYKRRFNKRIPTINI----PFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWG----QYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGL 1222
            IH+   C ++L  Q +++    +++E +F +AY +V         RL R IY P N YC+H+D K++  F+ AV +L+ C    + N   +     V    +S L ADLNC+++L     +WKY IN  GQ+FPLKTN E+V+ L+ FKG N                   + H  +  +  I T  +    P  +  Y GS ++ ++ EF +F+   P++  +L   KD F PDE F+ TLN     RIPG     P+ +   N        R   W     ++     + V  ICI+G GDL  L+N+P+LFANKF  N  P+T++CLE    ++  NQ  T +
Sbjct:   66 IHEKSSCKEYL-TQSHYITAPLSKEEADFPLAYIMVIHHHFDTFARLFRAIYMPQNIYCVHVDEKATTEFKDAVEQLLSC----FPNAFLASKMEPVVYGGISRLQADLNCIRDLSAFEVSWKYVINTCGQDFPLKTNKEIVQYLKGFKGKNITPGVLPPAHAIGRTKYVHQEHLGKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLHDPRAVDLLQWSKDTFSPDEHFWVTLN-----RIPGVPGSMPNASWTGN-------LRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAI 394          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT2 (glucosaminyl (N-acetyl) transferase 2 (I blood group) [Source:HGNC Symbol;Acc:HGNC:4204])

HSP 1 Score: 171.4 bits (433), Expect = 1.187e-47
Identity = 113/346 (32.66%), Postives = 173/346 (50.00%), Query Frame = 2
Query:  266 IHQ--DCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNV-----------------EAHYKRRFNKRIPTINI----PFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWG----QYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGL 1222
            IH+   C ++L  Q +++    +++E +F +AY +V         RL R IY P N YC+H+D K++  F+ AV +L+ C    + N   +     V    +S L ADLNC+++L     +WKY IN  GQ+FPLKTN E+V+ L+ FKG N                   + H  +  +  I T  +    P  +  Y GS ++ ++ EF +F+   P++  +L   KD F PDE F+ TLN     RIPG     P+ +   N        R   W     ++     + V  ICI+G GDL  L+N+P+LFANKF  N  P+T++CLE    ++  NQ  T +
Sbjct:   66 IHEKSSCKEYL-TQSHYITAPLSKEEADFPLAYIMVIHHHFDTFARLFRAIYMPQNIYCVHVDEKATTEFKDAVEQLLSC----FPNAFLASKMEPVVYGGISRLQADLNCIRDLSAFEVSWKYVINTCGQDFPLKTNKEIVQYLKGFKGKNITPGVLPPAHAIGRTKYVHQEHLGKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLHDPRAVDLLQWSKDTFSPDEHFWVTLN-----RIPGVPGSMPNASWTGN-------LRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAI 394          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-15 (GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:L8E6J1])

HSP 1 Score: 133.65 bits (335), Expect = 3.508e-34
Identity = 114/369 (30.89%), Postives = 179/369 (48.51%), Query Frame = 2
Query:  251 KLYQDIHQDCTKFLFNQKYFLNLKE--TEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNI---INSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVE--AHYKRRFNKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNP-QLRIPGSF----------------IGNPDENQPQNDYLGYFITRYK---NWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGLVDVNSDYYSSLPFVKYRY 1276
            KL    +  C +F   QK F   +E  +++E  F +AY ++      QL  LL  IY+P N +C+ +D  SS  F   +G LV+ L   Y NI   I  E    +      +LT+   C+  L +  ++WKYF  L+G + PLK+NLE+++IL+A  G+ N E       R N++ P  + P P+  Y  S+  T + +  +F+  S +    +D L+     DE+ ++T+  NP +L +PG F                +G   ENQ  ++  GY+++RY+   N     C+     R  C++GV DLP LIN   L A+K Y ++QP    CL       VEN R+  +     D+ +     KYRY
Sbjct:   73 KLSGQENAQCAEF---QKIFGFFQEPTSQEELEFPLAYGMLVHGDFVQLSLLLSAIYQPQNQFCLAVDGNSSVEF---IG-LVRMLSRCYGNIQYFITDE----IRWCGYEILTSVFQCVDYLAKLPSDWKYFQYLSGVDAPLKSNLEMIRILKALNGSFNAEILPFEFYRLNRKRPW-SSPLPL--YKTSLSATFSRKSANFMVNSEKVLEQIDFLRGTTCADESLWATIAGNPKELPMPGGFDAKAWIHKNYRRTRGKLGKYGENQKIDN--GYYVSRYQQYVNRAPVKCKGY-YYRLSCVFGVYDLPNLINRHELVAHKLYFSYQPAAFMCL-------VENSRQKSMRTPQFDFSAE----KYRY 413          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-16 (GLY-16; GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:G5EDP7])

HSP 1 Score: 132.88 bits (333), Expect = 7.880e-34
Identity = 115/423 (27.19%), Postives = 206/423 (48.70%), Query Frame = 2
Query:   74 YALVSKMLNFLVFTNLIASIQSDSSNEDLI------CENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDI---HQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYKRRFNKRIPTIN---IPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQL-RIPGS--------FIGNPDEN--QPQNDYLGYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGLVDVNSDY--YSSLPFVK 1267
            ++ V+   + ++FT L  +  S     DL+      C N  +      ++E   T      + + KL+      H   + F FN+     +  +E+E  F ++Y ++ ++  SQ+  +L +IY+P N YCI +   S++ F I + EL  C  +     ++   R  +   +  ++ +  +C+K L    +NWKYF  L+G + PLKTNLE+V+IL++  G  NVE   K   N+R+   N    P P+  +  S+   +  +  +++  S   + +L+ L++ ++ DE F+ TL  N  L  +PGS        F  N   N  +P + +  Y+I+R++ W +  C + ++    C++G+GD+  L+ A  L A+K Y   +P    CL +      E++RRT   D   D   YS LP V+
Sbjct:    8 FSCVAVYGSLVIFTYLFVAKPSSRPPTDLLDDLEINCTNILQGLKNEKQLELINT-----KMIEDKLWNSTDRCHTVKSMFRFNE-----VPLSEEEARFPLSYGLLVYKELSQVLFMLSSIYQPQNEYCIAVGENSASTFLILLEELSDCFPN-----VHFMKRPPITWGSYEIINSVYDCLKFLSHLKSNWKYFQYLSGVDIPLKTNLEMVRILKSLNGTANVEI--KVYENRRLLGQNETESPLPL--FKSSLSSLIPRKAANYLASSSIPQQLLEFLRNTWVADEGFWGTLFGNKGLFDVPGSLNFEEWIYFKENARANLTKPTDGWF-YYISRHQIWFESGCHN-HMKDGSCVFGIGDVSNLLQAKALVAHKLYLTSEPEAYFCLLK------EHRRRTLNPDSTFDASKYSELPQVE 403          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-18 (GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:Q19730])

HSP 1 Score: 132.494 bits (332), Expect = 1.463e-33
Identity = 111/401 (27.68%), Postives = 196/401 (48.88%), Query Frame = 2
Query:  113 TNLIASIQSDSSNE-DLICENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEA---HYKRRFNKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQL-RIPG--------SFIGNPDENQP-QNDYLGYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGLVDVNSDY--YSSLPFVK 1267
            T++++ I++D  ++ D+ C N F       ++    +      + D  LY        K LF    F  +  + +EE+F ++Y ++ ++  SQ+  +L +IY P N YCI +   S+ +F+  + EL  C  +     I+   R  ++  +  ++ +  +C++ L    ++W+YF  L+G + PLKTNLE+V+IL+   G  NVE     Y+R   K       P P+  +  S+   +  E  + +  S   + +L+ L++  I DE F+ TL  N  L  IPG        S+  N + N     D   Y+I+R + W +  C +  +    C++G+GD+P+L+ +  L A+KFY   +P    CL +      E++RRT   D+  D   YS LP V+
Sbjct:   46 TSILSKIENDLLDDLDINCLNIFNGSKNRNQLRIVNSRS----IEDKLLYSTDRCQTLKSLFR---FNKVPLSPEEESFPLSYGLLVYKELSQVLFMLSSIYHPQNEYCIAVGENSAPIFQNLLKELSNCFSN-----IHFMKRPPIDWGSHEIINSAYDCLEFLSHLKSDWRYFQYLSGVDIPLKTNLEMVQILKHLNGTANVEIKPYQYQRLRGKN--ETQSPLPL--FKSSLSSLIPREAANHLSSSSIPQQLLEFLRNTGIADEGFWGTLFGNKNLFDIPGSLNFKEWISYKNNVETNLTYPTDGWRYYISRDQIWSKPNCHNY-MKAGSCVFGIGDVPRLLKSKALVAHKFYLKSEPEAYFCLLK------EHRRRTCNPDLTFDASKYSELPQVE 423          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-17 (GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:O02315])

HSP 1 Score: 129.028 bits (323), Expect = 1.177e-32
Identity = 86/307 (28.01%), Postives = 157/307 (51.14%), Query Frame = 2
Query:  326 TEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVE-AHYKRRFNKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQL-RIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGLVDVNSD 1240
            +E+E  F +++ ++ ++  SQ+  LL +IY+P N YCI +   S+  F I + EL  C  + Y        R  ++  +  ++ +   C++ L    ++WKYF  L+G + PLKTNLE+V+IL+   G  N+  + Y+ R          P P+  +  S+   +  +  +++  S   + +L+ L+  ++ DE F+ TL  N  L  +PGSF    + N P  +  G +++R++ W +  C +    R  C++G+GD+P L+ +  L A+K Y   +P    CL +       ++ RT   D+ SD
Sbjct:  101 SEEEARFPLSFGLLVYKELSQVLFLLSSIYQPQNEYCIAVGENSAPAFLILLKELANCFPNVY-----FMKRPPIKWGSFEIINSVYGCLEFLSHLKSDWKYFQYLSGVDIPLKTNLEMVRILKRLNGTVNIGISTYEDRLLNGKNKTESPLPL--FKSSLSSLIPRKAANYLSSSSVPQQLLEFLRTTWVADEGFWGTLFGNKDLFNVPGSF----NFNDPLTNGWGNYVSRHQLWVESECHNYMKDRS-CVFGIGDVPNLMKSRALVAHKLYIESEPEAFFCLLK------RHRHRTINPDLTSD 389          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-1 (GLY-1; GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:G5ECK8])

HSP 1 Score: 126.716 bits (317), Expect = 2.183e-31
Identity = 89/338 (26.33%), Postives = 161/338 (47.63%), Query Frame = 2
Query:  308 FLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVE-AHYKRRFNKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQ-LRIPGS------------FIGNPDENQPQNDYLGYFITRYKNWG-QYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGLVDVN---SDYYSSLPFVK 1267
            F  +  + +E  + +AY +V +++  Q+   +   Y+P + +CI +D +S N ++  +  L  C  + +  I         +  +  +L     C   L +    WKY+  L+G + P++TNLE+V+I +A  G+ N + + ++    K +  +  P P+  Y  S+ + V  E   ++  SP+ + +L  L   +IPDE+F+ST+  +P  L +PGS            F   P      N     +I RY+ WG Q  C  K +    C++GV D+ +++  P L A+K Y  FQP    C+ +      E +RR+   D +   +  YS +P V+
Sbjct:  115 FTRIPSSREEAEYPLAYGLVVYKTIVQVLTQMSLFYQPQHMFCITVDDQSPNEYKSVIQALPSCFPNMHVFIGEPS-----QWGSFGILKNVYTCFNWLSKSKQKWKYYQYLSGTDLPIRTNLEMVRIFKALNGSMNTDVSTFEVDRYKNMEGVLPPMPV--YKSSMSVVVPREGADYLISSPRVQKLLKYLSKTWIPDESFWSTVLGSPALLPVPGSIRVRDILWLRKNFKLRPPYENTVNSIGTSYIGRYQVWGWQKECFGK-VKDFSCVFGVEDIEEIMTRPELVAHKLYLEFQPAAFMCMLK------EVRRRSLSPDAHLFSARSYSQMPTVE 438          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Fly
Match: oxt (gene:FBgn0015360 transcript:FBtr0072904)

HSP 1 Score: 79.337 bits (194), Expect = 2.799e-15
Identity = 86/320 (26.88%), Postives = 141/320 (44.06%), Query Frame = 2
Query:  326 TEDEENFRIAYSIVAFESA-SQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAH--------YKRRFNK----------RIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDAL----KDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANK-----FYENFQPV----TLKCLERWIY 1189
            +E+ +  RIA+ +     A  Q+ RLL+ +Y P + Y IH+D +   ++     +L++ L SK+ NI  +  R        S+LT  L CM++L +   +W + INL+  +FP+KT  +LV  L A  G N V+ H         K+  +K          RI    +P  I    GS  + ++  FV ++    +   +L AL    +   +P E+FF T+  N   +   S++ N              +T +K      C+ K++V   C     D  K  + P L A +     F   F+PV     L  LE W+Y
Sbjct:  242 SEETKRVRIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQDYLYR----KLLE-LESKFPNIRLARKRFSTIWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDKLVDFLSANPGRNFVKGHGRETQKFIQKQGLDKTFVECDTHMWRIGDRKLPAGIQVDGGSDWVALSRPFVGYVTHPREDDELLQALLKLFRHTLLPAESFFHTVLRN--TKHCTSYVDN-----------NLHVTNWKRKQGCKCQYKHVV-DWCGCSPNDF-KPEDWPRLQATEQKSLFFARKFEPVINQAVLLQLEEWLY 541          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: gcnt4b (glucosaminyl (N-acetyl) transferase 4b [Source:ZFIN;Acc:ZDB-GENE-091118-69])

HSP 1 Score: 172.555 bits (436), Expect = 4.091e-48
Identity = 116/351 (33.05%), Postives = 173/351 (49.29%), Query Frame = 2
Query:  272 QDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYKRRFNKRIPTINI----------------------PFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQY------TCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGLVDVNSD 1240
             DC +F+ +  Y   ++ TE E  F +AYS+V   +A+ +ERLLR +Y P N YCIH D KSS  F +A+  L +C+     N+  +     V+ + +S L ADLNC+ +L      WKY INL GQ+FPL+TN ELV  L+  KG N VE+ +    N+R    ++                      P+ I  + GS + T++ EFV F+  S  ++  L   +D F PDE F++TL     +R+PG     P      ++ +    TR   W  +       C   + VR+ICI+G  +L  L+N  + FANK      PV ++CLE  + +K    R   L     D
Sbjct:   78 SDCDQFVSSLGYD-AIQVTESEREFPLAYSLVVHRNAALVERLLRAVYVPHNIYCIHYDRKSSTDFMLAMNGLARCI----PNVFIASKLERVQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAELVSDLKGLKGRNMVESKWPGAKNRRWSVHHLLKNKKFEFYNTPVSTSDKKRPPPYDIEMFVGSAYFTLSREFVYFVHWSYLARNFLAWSEDTFSPDEHFWATL-----VRVPGVPGEVPRSEADISELISK--TRLVKWSAFEGRLYPRCTGVH-VRKICIYGAAELRWLLNYGHWFANKVDPKVDPVLIECLEEKLAEKRRKSRDLSLTSHPKD 415          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: si:dkeyp-87d8.8 (si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-161])

HSP 1 Score: 172.17 bits (435), Expect = 1.014e-47
Identity = 130/377 (34.48%), Postives = 187/377 (49.60%), Query Frame = 2
Query:  200 EMEFGETWKPKVPVSDSKLYQDIHQ--------DCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHY----KRR----------------FNKRIPTINIPFP--IIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFI--TRYKNWGQYT------CESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRT 1216
            EME  E  K  V +   K+Y+ +          DC  F+ +Q+Y  +++ TE E  F +AYS+V  + A+ +ERLLR +Y P N YCIH D KSS  F +A+  L +C+     N+  +     V+ + +S L ADLNC+ +L      WKY INL GQ+FPL+TN ELV  L+  KG N VE+ +    K R                F    P    P P  I  + GS + T++ EFV F+  S  +K  L   +D F PDE F++TL     +R+PG     P E       +   I  TR   W  +       C   + VR+ICI+G  +L  L+N  + FANK      PV ++CLE    +K+  +RR+
Sbjct:   60 EMEPVEVGKSLV-IRKQKIYKGLTDAAIANATIDCEWFVSSQRYN-DIQVTESEREFPLAYSLVVHQDAALVERLLRAVYVPHNIYCIHYDRKSSTDFMLAMNGLARCI----PNVFIASKLERVQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAELVSDLKGLKGRNMVESKWPGGKKIRWSVHHLLKNNDSEYYDFPVSTPEEKPPPPHNIEMFVGSAYFTLSREFVYFVHWSSLAKDFLAWSEDTFSPDEHFWATL-----VRVPGV----PGEVPRSEADISELISKTRLVKWSAFEGRLYPRCTGVH-VRKICIYGAAELRWLLNYGHWFANKVDPKVDPVLIECLE----EKLAEKRRS 416          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: si:dkeyp-87d8.8 (si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-161])

HSP 1 Score: 171.785 bits (434), Expect = 1.323e-47
Identity = 115/343 (33.53%), Postives = 174/343 (50.73%), Query Frame = 2
Query:  272 QDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYKRRFNKRIPTINI----------------------PFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQY------TCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRT 1216
             DC +F+ +  Y   ++ TE E  F +AYS+V   +A+ +ERLLR +Y P N YCIH D KSS  F +A+  L +C+     N+  +     V+ + +S L ADLNC+ +L      WKY INL GQ+FPL+TN ELV  L+  KG N VE+ +    N+R    ++                      P+ I  + GS + T++ EFV F+  S  ++  L   +D F PDE F++TL     +R+PG     P      ++ +    TR   W  +       C   + VR+ICI+G  +L  L+N  + FANK      PV ++CLE    +K+  +RR+
Sbjct:  104 SDCDQFVSSLGYD-AIQVTESEREFPLAYSLVVHRNAALVERLLRAVYVPHNIYCIHYDRKSSTDFMLAMNGLARCM----PNVFIASKLERVQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAELVSDLKGLKGRNMVESKWPGAKNRRWSVHHLLKNKKFEFYNTPVSTSDKKRPPPYDIEMFVGSAYFTLSREFVYFVHWSYLARNFLAWSEDTFSPDEHFWATL-----VRVPGVPGEVPRSEADISELISK--TRLVKWSAFEGRLYPRCTGVH-VRKICIYGAAELRWLLNYGHWFANKVDPKVDPVLIECLE----EKLAEKRRS 429          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: gcnt4b (glucosaminyl (N-acetyl) transferase 4b [Source:ZFIN;Acc:ZDB-GENE-091118-69])

HSP 1 Score: 171.014 bits (432), Expect = 1.534e-47
Identity = 115/343 (33.53%), Postives = 174/343 (50.73%), Query Frame = 2
Query:  272 QDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYKRRFNKRIPTINI----------------------PFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQY------TCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRT 1216
             DC +F+ +  Y   ++ TE E  F +AYS+V   +A+ +ERLLR +Y P N YCIH D KSS  F +A+  L +C+     N+  +     V+ + +S L ADLNC+ +L      WKY INL GQ+FPL+TN ELV  L+  KG N VE+ +    N+R    ++                      P+ I  + GS + T++ EFV F+  S  ++  L   +D F PDE F++TL     +R+PG     P      ++ +    TR   W  +       C   + VR+ICI+G  +L  L+N  + FANK      PV ++CLE    +K+  +RR+
Sbjct:   96 SDCDQFVSSLGYD-AIQVTESEREFPLAYSLVVHRNAALVERLLRAVYVPHNIYCIHYDRKSSTDFMLAMNGLARCI----PNVFIASKLERVQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAELVSDLKGLKGRNMVESKWPGAKNRRWSVHHLLKNKKFEFYNTPVSTSDKKRPPPYDIEMFVGSAYFTLSREFVYFVHWSYLARNFLAWSEDTFSPDEHFWATL-----VRVPGVPGEVPRSEADISELISK--TRLVKWSAFEGRLYPRCTGVH-VRKICIYGAAELRWLLNYGHWFANKVDPKVDPVLIECLE----EKLAEKRRS 421          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: si:dkeyp-87d8.8 (si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-161])

HSP 1 Score: 171.4 bits (433), Expect = 2.008e-47
Identity = 115/343 (33.53%), Postives = 174/343 (50.73%), Query Frame = 2
Query:  272 QDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYKRRFNKRIPTINI----------------------PFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQY------TCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRT 1216
             DC +F+ +  Y   ++ TE E  F +AYS+V   +A+ +ERLLR +Y P N YCIH D KSS  F +A+  L +C+     N+  +     V+ + +S L ADLNC+ +L      WKY INL GQ+FPL+TN ELV  L+  KG N VE+ +    N+R    ++                      P+ I  + GS + T++ EFV F+  S  ++  L   +D F PDE F++TL     +R+PG     P      ++ +    TR   W  +       C   + VR+ICI+G  +L  L+N  + FANK      PV ++CLE    +K+  +RR+
Sbjct:  101 SDCDQFVSSLGYD-AIQVTESEREFPLAYSLVVHRNAALVERLLRAVYVPHNIYCIHYDRKSSTDFMLAMNGLARCM----PNVFIASKLERVQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAELVSDLKGLKGRNMVESKWPGAKNRRWSVHHLLKNKKFEFYNTPVSTSDKKRPPPYDIEMFVGSAYFTLSREFVYFVHWSYLARNFLAWSEDTFSPDEHFWATL-----VRVPGVPGEVPRSEADISELISK--TRLVKWSAFEGRLYPRCTGVH-VRKICIYGAAELRWLLNYGHWFANKVDPKVDPVLIECLE----EKLAEKRRS 426          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: ccdc77 (coiled-coil domain containing 77 [Source:Xenbase;Acc:XB-GENE-959311])

HSP 1 Score: 182.185 bits (461), Expect = 1.833e-51
Identity = 115/339 (33.92%), Postives = 171/339 (50.44%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEA-----HYKRRFNKRIPTIN------------IPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPD-ENQPQNDYL-----GYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVEN 1204
            Y ++  DC  F  ++KY L    +++E  F IAYSIV +     LERLLR+IY P NYYCIH+D KSS  F  AV  +  C    ++N+  +     V  ++ + + ADLNCM +L+ K   WKY INL G +FP+KTN E+V++L+  K  N++E      H + R+ K    ++             P     ++GS +  V   FVS+I E+ + +  L+  KD + PDE  ++TL   P   +PGS   N   +    N Y       Y          Y   + N VR +C++G GDL  ++   +LF NKF  +  P  +KCLE  +  K  N
Sbjct:   90 YINMTNDCEAFTRDRKYLL-YPLSKEEREFPIAYSIVVYHRIDMLERLLRSIYTPQNYYCIHVDKKSSTSFLNAVKAITSC----FENVFIASQLENVVYASWARVQADLNCMTDLHNKNAKWKYLINLCGMDFPIKTNREMVEMLKGLKSQNSLETEKMPPHKEVRWRKHYEIVDNAIRKTEEDKTPPPLETPVFSGSAYFVVTRAFVSYILENEKIQRFLEWSKDTYSPDEFIWATLQRIPG--VPGSVPANSKYDVSDMNAYARFVKWAYLEGDVAKGAPYPPCAGNHVRSVCVFGAGDLEFMLQKHHLFGNKFDIDVDPTAIKCLEEHLRHKALN 421          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: cnksr2 (connector enhancer of kinase suppressor of Ras 2 [Source:Xenbase;Acc:XB-GENE-490704])

HSP 1 Score: 178.333 bits (451), Expect = 4.602e-50
Identity = 113/344 (32.85%), Postives = 174/344 (50.58%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEA-------------HY-------KRRFNKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWG----------QYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKV 1198
            Y ++  DC+ F  N+KY +    +++EENF IAYS+V  E     ERLLR IY P N YC+H+D KS  VF+ AV  +  C    + N+  +   V V  +    + ADLNCM++L +    WKY +N  G +FPLKTN E+V+ L++  G N++E+             H+       K    K  P I+ P     +TG+ +I V   FV  IF +PQ+  +++ +KD + PDE  ++TLN     R+PG    +P  ++ +   +   + R   WG           Y   +    R IC++G GDL  L+   ++ ANKF      + L+CLE ++  K 
Sbjct:   97 YINMTTDCSYFKKNRKY-MPFPMSKEEENFPIAYSMVIHEKIDMFERLLRAIYAPQNIYCVHVDEKSPAVFKEAVNAITSC----FDNVFIASKLVKVVYAAWPRVQADLNCMEDLLQSKVLWKYLLNTCGTDFPLKTNAEIVRTLKSLNGKNSMESEKPSSSKKTRWEFHFEVGDSISKTAIEKSPPPIDSPM----FTGNAYIVVCRNFVEHIFNNPQALTLIEWVKDTYSPDEHLWATLN-----RMPGVPGSSPYSDKYEKSDMNA-VARMVKWGYMEGDIAKGAPYPPCTGTHRRSICVYGTGDLYWLLEQHHVLANKFDPKVDNIALECLEEYLRHKT 425          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: gcnt2.2 (glucosaminyl (N-acetyl) transferase 2 (I blood group), gene 2 [Source:NCBI gene;Acc:100038221])

HSP 1 Score: 165.236 bits (417), Expect = 2.544e-45
Identity = 114/345 (33.04%), Postives = 167/345 (48.41%), Query Frame = 2
Query:  278 CTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEA--------------HYKRRFNKRIPTINI-----PFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYTCESK---NIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGLVDVNSDYY 1246
            C +++  Q +F+    +++E  F +AY +   +     ERL R IY P N YC+H+D K+S  F  AV  LV+C    + N   +     V    +S L ADLNCMK+L      WKY INL GQ+FPLKTN E++  +++FKG N                  H +   N R+    +     P  I  Y GS ++ +  EF  FI E  ++  +L   KD + PDE ++ TLN      +PGS         P   + G    R   W     + K   + VR ICI+G GDL  L+N+ ++FANKF     P T++CLE  + ++  NQ     V V  ++Y
Sbjct:   93 CPEYV-RQNHFIMSPLSQEEAAFPLAYILTVHKEFETFERLFRAIYMPQNIYCVHVDEKASADFMQAVDSLVQC----FPNTFLASKMEPVVYGGISRLQADLNCMKDLLASDVQWKYVINLCGQDFPLKTNKEIIHHIKSFKGKNITPGVLPPAHAIPRTKYVHREDIVNSRVVRTRVLKPPPPHNITIYFGSAYVALTREFTRFILEDQRATNLLLWSKDTYSPDEHYWVTLNRIAD--VPGS--------APDASWEGQL--RAVKWKDMKDQEKCHGHYVRDICIYGTGDLQWLMNSRSIFANKFEAKSYPPTVECLELKVRERTLNQSE---VTVPPEWY 417          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: GCNT4 (glucosaminyl (N-acetyl) transferase 4 [Source:NCBI gene;Acc:100492495])

HSP 1 Score: 164.466 bits (415), Expect = 7.292e-45
Identity = 115/336 (34.23%), Postives = 166/336 (49.40%), Query Frame = 2
Query:  275 DCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHY-----KRRFN------------KRIP----TINIPFP--IIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRR 1213
            DC  + + ++Y L     E E++F IAYS+V  + A  +ERLL TIY P N YCIH D KS   F+ A+  L  CL     N+  +     V  + ++ L ADLNC+K+L      WKY INL GQ+ PLK+N ELV  L+   G N +E        KRRF             +++P       +P P  +  + GS +  ++  F+S+IF+SP  K  L   +D F PDE F++TL   P   +PG    +  +    N         Y   G Y   +   VR +CI+G G+L  L+   + FANKF     P  +KCL     +K+E Q++
Sbjct:   99 DCEAYRYQRQYDLKPLSPE-EKDFPIAYSLVVHKDAISVERLLHTIYNPVNIYCIHYDQKSLPGFKRAMTNLAICL----PNVFIASKLERVTYAHVTRLQADLNCLKDLLESSVQWKYVINLCGQDMPLKSNYELVAELKKLNGRNMLETSRPSDSKKRRFTFHHEVQNVNFNYQQMPVKSSVTKMPPPGNLQIFIGSAYFVLSHSFISYIFDSPVFKEFLTWSEDTFSPDEHFWATLVRMPG--VPGEIPRSQKDVTDLNSKTRLVKWGYLEGGLYPPCTGTHVRSVCIYGAGELRWLMTYGHWFANKFDPKVDPTLIKCL----IEKLEEQQK 423          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: adsl (adenylosuccinate lyase [Source:Xenbase;Acc:XB-GENE-1001539])

HSP 1 Score: 162.54 bits (410), Expect = 1.885e-44
Identity = 105/320 (32.81%), Postives = 157/320 (49.06%), Query Frame = 2
Query:  275 DCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEA--------------HYKRRFNKRIPTINI-----PFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLE 1177
            +C  F+    Y + L  +E+E  F +AY +   +     ERL R IY P N YC+H+D K+S  F  AV  LV+C    + N   +     V    +S L ADLNCMK+L      WKY INL GQ+FPLKTN E++  +++FKG N                  H +   N R+    +     P  I  Y GS ++ +  EF  FI E  ++  +L   KD + PDE ++ TLN     RI   F G+  + + + D       ++ +   +     + VR +C++G GDL  L+ +P++F NKF     P T++CLE
Sbjct:   70 NCKDFILKNNY-ITLPLSEEEAAFPLAYILTVHKEFETFERLFRAIYMPQNIYCVHVDEKASADFMQAVDSLVQC----FPNTFLASKMEPVVYGGISRLQADLNCMKDLLASDVQWKYVINLCGQDFPLKTNREIIHHIKSFKGKNITPGVLPPAHAIPRTKYVHREDIVNSRVVRTRVLKPPPPHNITIYFGSAYVALTREFTRFILEDQRATNLLLWSKDTYSPDEHYWVTLN-----RI-ADFPGSVPDAKWEGDLRA---IKWSDDKTHDGCHGHYVRDVCVYGTGDLQWLLKSPSMFGNKFELASYPPTVECLE 375          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 185.652 bits (470), Expect = 6.754e-53
Identity = 113/346 (32.66%), Postives = 175/346 (50.58%), Query Frame = 2
Query:  230 KVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEA---------HYKRRF--------NKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLG------YFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKV 1198
            K P      Y ++ +DC  F+  +KY +    T++E  F IAYSIV       L+RLLR IY P N+YCIH+D K+   F  AV  +  C    + N+  +     V  ++ S + ADLNCMK+LYR   NWKY INL G +FP+KTNLE+V+ L+   G NN+E           +K+R+        N  I     P     ++GS +  V  E+V ++ E+   + +++  +D + PDE  ++T+   P+  +PGSF  +   +    + +       YF     N   Y   S   VR +C++G GDL  ++   +LFANKF  +  P  ++CL+  +  K 
Sbjct:   84 KRPRRTPHDYINMTRDCASFIRTRKYIVE-PLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 185.652 bits (470), Expect = 6.754e-53
Identity = 113/346 (32.66%), Postives = 175/346 (50.58%), Query Frame = 2
Query:  230 KVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEA---------HYKRRF--------NKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLG------YFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKV 1198
            K P      Y ++ +DC  F+  +KY +    T++E  F IAYSIV       L+RLLR IY P N+YCIH+D K+   F  AV  +  C    + N+  +     V  ++ S + ADLNCMK+LYR   NWKY INL G +FP+KTNLE+V+ L+   G NN+E           +K+R+        N  I     P     ++GS +  V  E+V ++ E+   + +++  +D + PDE  ++T+   P+  +PGSF  +   +    + +       YF     N   Y   S   VR +C++G GDL  ++   +LFANKF  +  P  ++CL+  +  K 
Sbjct:   84 KRPRRTPHDYINMTRDCASFIRTRKYIVE-PLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 185.652 bits (470), Expect = 6.754e-53
Identity = 113/346 (32.66%), Postives = 175/346 (50.58%), Query Frame = 2
Query:  230 KVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEA---------HYKRRF--------NKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLG------YFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKV 1198
            K P      Y ++ +DC  F+  +KY +    T++E  F IAYSIV       L+RLLR IY P N+YCIH+D K+   F  AV  +  C    + N+  +     V  ++ S + ADLNCMK+LYR   NWKY INL G +FP+KTNLE+V+ L+   G NN+E           +K+R+        N  I     P     ++GS +  V  E+V ++ E+   + +++  +D + PDE  ++T+   P+  +PGSF  +   +    + +       YF     N   Y   S   VR +C++G GDL  ++   +LFANKF  +  P  ++CL+  +  K 
Sbjct:   84 KRPRRTPHDYINMTRDCASFIRTRKYIVE-PLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 185.652 bits (470), Expect = 6.754e-53
Identity = 113/346 (32.66%), Postives = 175/346 (50.58%), Query Frame = 2
Query:  230 KVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEA---------HYKRRF--------NKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLG------YFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKV 1198
            K P      Y ++ +DC  F+  +KY +    T++E  F IAYSIV       L+RLLR IY P N+YCIH+D K+   F  AV  +  C    + N+  +     V  ++ S + ADLNCMK+LYR   NWKY INL G +FP+KTNLE+V+ L+   G NN+E           +K+R+        N  I     P     ++GS +  V  E+V ++ E+   + +++  +D + PDE  ++T+   P+  +PGSF  +   +    + +       YF     N   Y   S   VR +C++G GDL  ++   +LFANKF  +  P  ++CL+  +  K 
Sbjct:   84 KRPRRTPHDYINMTRDCASFIRTRKYIVE-PLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt2 (glucosaminyl (N-acetyl) transferase 2, I-branching enzyme [Source:MGI Symbol;Acc:MGI:1100870])

HSP 1 Score: 170.629 bits (431), Expect = 1.629e-47
Identity = 111/333 (33.33%), Postives = 167/333 (50.15%), Query Frame = 2
Query:  299 QKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEA--------------HYKRR-----FNKRIPTINIPFP--IIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNW----GQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGL 1222
            Q +++    +E+E  F +AY +V  +     ERL R IY P N YC+H+D+K+++ F+ AV +L+ C    + N   +     V     S L ADLNCMK+L      WKY +N  GQ+FPLKTN E++  L+ FKG N                  H +R+     F  +   +  P P  +I Y G+ ++ +  +FV+FI    ++  +L+  KD + PDE F+ TLN     RIPG     P    P   + G    R   W     ++     + V  ICI+G GDL  LIN+ +LFANKF  N  P+T++CLE  + ++  NQ    +
Sbjct:   78 QSHYITSPLSEEEAAFPLAYIMVIHKDFDTFERLFRAIYMPQNVYCVHVDSKATDTFKEAVRQLLSC----FPNAFLASKVEQVVYGGFSRLQADLNCMKDLVASKVPWKYVLNTCGQDFPLKTNKEIINHLKRFKGKNITPGVLPPAYIVVRTKYVHQERKGKDGYFMHKTNILKTPPPHQLIIYFGTAYVALTRDFVNFILNDERAIALLEWSKDTYSPDEHFWVTLN-----RIPGV----PGSMPPNASWTGNL--RAVKWMDMEAKHGGCHGHYVHGICIYGNGDLQWLINSQSLFANKFELNTYPLTVECLELRLRERTLNQSEIAI 395          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q09324|GCNT1_MOUSE (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Gcnt1 PE=1 SV=2)

HSP 1 Score: 185.652 bits (470), Expect = 4.724e-52
Identity = 113/346 (32.66%), Postives = 175/346 (50.58%), Query Frame = 2
Query:  230 KVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEA---------HYKRRF--------NKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLG------YFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKV 1198
            K P      Y ++ +DC  F+  +KY +    T++E  F IAYSIV       L+RLLR IY P N+YCIH+D K+   F  AV  +  C    + N+  +     V  ++ S + ADLNCMK+LYR   NWKY INL G +FP+KTNLE+V+ L+   G NN+E           +K+R+        N  I     P     ++GS +  V  E+V ++ E+   + +++  +D + PDE  ++T+   P+  +PGSF  +   +    + +       YF     N   Y   S   VR +C++G GDL  ++   +LFANKF  +  P  ++CL+  +  K 
Sbjct:   84 KRPRRTPHDYINMTRDCASFIRTRKYIVE-PLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q02742|GCNT1_HUMAN (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=GCNT1 PE=1 SV=2)

HSP 1 Score: 179.104 bits (453), Expect = 1.334e-49
Identity = 107/338 (31.66%), Postives = 175/338 (51.78%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVE-----AHYKRRFNKRIPTIN------------IPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYT-------CESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKV 1198
            Y ++  DC+ F+  +KY +     E+ E F IAYSIV       L+RLLR IY P N+YCIH+D KS + +  AV  +  C    + N+  +     V  ++ S + ADLNCMK+LY    NWKY INL G +FP+KTNLE+V+ L+   G NN+E     +H + R+ KR   +N             P     ++GS +  V+ E+V ++ ++ + + +++  +D + PDE  ++T+   P+  +PGS   +   +      +  F+      G  +       C+  + VR +CI+G GDL  ++   +LFANKF  +     ++CL+  +  K 
Sbjct:   93 YINMTSDCSSFIKRRKYIVEPLSKEEAE-FPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASC----FSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIPE--VPGSLPASHKYDLSDMQAVARFVKWQYFEGDVSKGAPYPPCDGVH-VRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q9IZK2|GCNT3_BHV4V (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Bovine herpesvirus 4 (strain V. test) OX=436507 GN=Bo17 PE=1 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 9.011e-49
Identity = 112/350 (32.00%), Postives = 181/350 (51.71%), Query Frame = 2
Query:  215 ETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHY-----KRRFNKR-------IPTINIPFP----IIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQ------YTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKV 1198
            E  K + P++D+  Y +I +DC +F   Q+ F+    +++E +F IAYS+V  E     ERLLR +Y P N YC+H+D KS   F+ AV  ++ C    + N+  +   V V  ++ S + ADLNCM++L +   +WKY +N  G +FP+KTN E+V  L+  KG N++E+       K R+  R        PT  I  P    +  +TG+ +   +  FV  + ++P+S+I+++ +KD + PDE  ++TL   P +  PGS   +P  +      +   +    + G       Y   S    R ICI+G GDL  ++   +L ANKF        L+CLE ++  K 
Sbjct:   93 EVKKKRPPLTDT-YYLNITRDCERFK-AQRKFIQFPLSKEELDFPIAYSMVVHEKIENFERLLRAVYAPQNIYCVHVDVKSPETFKEAVKAIISC----FPNVFMASKLVPVVYASWSRVQADLNCMEDLLQSSVSWKYLLNTCGTDFPIKTNAEMVLALKMLKGKNSMESEVPSESKKNRWKYRYEVTDTLYPTSKIKDPPPDNLPMFTGNAYFVASRAFVQHVLDNPKSQILVEWVKDTYSPDEHLWATLQRAPWM--PGSVPSHPKYHISDMTAIARLVKWQYHEGDVSMGAPYAPCSGIHRRAICIYGAGDLYWILQNHHLLANKFDPRVDDNVLQCLEEYLRHKA 434          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q805R1|GCNT3_BHV4L (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Bovine herpesvirus 4 (strain LVR140) OX=436506 GN=Bo17 PE=1 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 9.390e-49
Identity = 109/350 (31.14%), Postives = 180/350 (51.43%), Query Frame = 2
Query:  215 ETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHY-----KRRFNKRIPTINIPFP-----------IIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQ------YTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKV 1198
            E  K + P++D+  Y +I +DC +F   Q+ F+    +++E +F IAYS+V  E     ERLLR +Y P N YC+H+D KS   F+ AV  ++ C    + N+  +   V V  ++ S + ADLNCM++L +   +WKY +N  G +FP+KTN E+V  L+  KG N++E+       K R+  R    +  +P           +  +TG+ +   +  FV  + ++P+S+I+++ +KD + PDE  ++TL   P +  PGS   +P  +      +   +    + G       Y   S    R ICI+G GDL  ++   +L ANKF        L+CLE ++  K 
Sbjct:   93 EVKKKRPPLTDT-YYLNITRDCERFK-AQRKFIQFPLSKEELDFPIAYSMVVHEKIENFERLLRAVYAPQNIYCVHVDVKSPETFKEAVKAIISC----FPNVFMASKLVPVVYASWSRVQADLNCMEDLLQSSVSWKYLLNTCGTDFPIKTNAEMVLALKMLKGKNSMESEVPSESKKNRWKYRYEVTDTLYPTSKMKDPPPDNLPMFTGNAYFVASRAFVQHVLDNPKSQILVEWVKDTYSPDEHLWATLQRAPWM--PGSVPSHPKYHISDMTAIARLVKWQYHEGDVSMGAPYAPCSGIHRRAICIYGAGDLYWILQNHHLLANKFDPRVDDNVLQCLEEYLRHKA 434          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q92180|GCNT1_BOVIN (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Bos taurus OX=9913 GN=GCNT1 PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.417e-48
Identity = 111/342 (32.46%), Postives = 174/342 (50.88%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVE-----AHYKRRFNKRIPTIN------------IPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGN--PDENQPQNDYLGYFITRYKNWGQYTCE-SKNI--------VRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKV 1198
            Y ++  DC  F+  +KY +    +++E  F IAYSIV       L+RLLR IY P N+YCIH+DAKS   F  A   +  C    + N+  +     V  ++ S + ADLNCM++LY+    WKY INL G +FP+KTNLE+V+ L+   G NN+E     +H K R+ K    +N             P     ++GS H  V+ E+V ++ ++   +  ++  KD + PDE  ++T+   P+  +PGS   +   D +  Q       I R+  W  +  + SK          VR +C++G GDL  L++  +LFANKF  +     ++CL+  +  K 
Sbjct:   93 YINMTGDCASFIKKRKY-ITEPLSKEEAGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDAKSEKSFLAAAVGIASC----FSNVFVASQLESVVYASWSRVQADLNCMQDLYQMNAGWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETEKMPSHKKERWKKHYEVVNGKLTNMGTDKIHPPLETPLFSGSAHFVVSREYVEYVLQNQNIQKFMEWAKDTYSPDEYLWATIQRIPE--VPGSLSLSYKYDTSDMQA------IARFVKWQYFEGDVSKGAPYPPCSVHVRSVCVFGAGDLNWLLHVHHLFANKFDTDIDLFAIQCLDEHLRHKA 421          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2C9JUK0 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 PE=4 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 5.481e-86
Identity = 153/333 (45.95%), Postives = 216/333 (64.86%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYKRRFNKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGLVDVNSDYYSSL 1255
            Y ++  DCT+F  ++ Y +  K T++EE+F IAYS++ ++    +ERLLR IYRP NYYCIH+D KS   F IAV  + +C    ++N+  +  R+ V   T SVL  +L CM++L+R F  WKYFINLTGQEFPL+TN ELV+IL++++GAN++E   KR    R+PT + P  I    GSVHI VN +FV +I     +K +LD +K+  IPDETFF+TLN+NPQL I G++ G P E    +  +  F+TR+KNWG+  C + + VR ICI   GDLP L  A ++FANKF+    P+ + CLE  IY+   ++  +G+   NS YYS L
Sbjct:   79 YINLTTDCTRFKQSRGY-VTCKLTQEEEDFPIAYSLIIYKDVEMMERLLRAIYRPQNYYCIHVDKKSDQNFFIAVSAIAEC----FENVFIAPERLAVHWGTFSVLEPELVCMQQLWR-FRKWKYFINLTGQEFPLRTNWELVQILKSYRGANDLEGTIKR----RLPT-DPPHNITAIKGSVHIAVNRDFVDYILHHRTAKDLLDWVKNTSIPDETFFTTLNHNPQLGIRGTYKGVP-ETDNDDSMIKPFLTRFKNWGEKLC-AGHWVRGICILSTGDLPLLGRAKHMFANKFFLWEDPIAIGCLEEMIYNNTRDE-LSGVKVFNSTYYSQL 397          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A0B7AMK8 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF130617 PE=4 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 9.638e-86
Identity = 153/342 (44.74%), Postives = 221/342 (64.62%), Query Frame = 2
Query:  245 DSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYKRRFNKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALK-DRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGLVDVNSDYYSSLPFVK 1267
            D   Y ++  +C KF   + Y ++   T++EE F +A+SI+ F+    +ERLLR IYRP NYYC+H+D K+S+VF  A+  L KC    + N+I +  R+ V+ +T +VL  +L CM++L+ +F +WKYF  LTGQEFPLKTNLELVKI+ A+ GAN++E   KR   +R  TI  PF I    GSVHITVN  +V ++  +  +K++L+ +K D   PDET+F+TLN+NPQL I GS+ G P+ ++        F+TR+KNWG   C S N VR ICI  +GDLP+L +A + FANKFY     + + CLE  I++   ++   GL + ++ YY+SL FVK
Sbjct:  130 DEAAYINLTSNCNKFQTERGYIMS-SLTKEEEEFPLAFSILVFKEPEMVERLLRAIYRPQNYYCVHVDTKASDVFYNAMLGLSKC----FPNVIIASRRIDVQWATFTVLEPELLCMEDLW-QFPSWKYFFTLTGQEFPLKTNLELVKIMTAYDGANDLEGTIKRANFERWRTI-APFGIRPIKGSVHITVNRNYVDYVLHNNTAKVLLEWVKRDTSFPDETYFATLNHNPQLGIRGSYKGEPETDEETKP----FLTRFKNWGHLPCASGNYVRAICILSLGDLPQLYHAKHYFANKFYLAEDRIVIGCLEEKIFNDTRDE-YLGLKNFDASYYASLDFVK 459          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2T7P144 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_12287 PE=4 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 2.569e-83
Identity = 146/350 (41.71%), Postives = 212/350 (60.57%), Query Frame = 2
Query:  227 PKVPVSDS--KLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYKRRFNKRIPTIN-IPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGLVDVNSDYYSSLPFVK 1267
            P+ P   S  K    + ++C  F+    + +N   TE+E NF IAYSI+ F+ A Q+ +LL+ IYRP N YCIH+D K+   +   +  +  C H    N+  +   V V   T +VL  +L CMK+L+  F  WKYFINLTGQEFPL+TN ELV+IL A+ GAN+VE+  KR   +R  +    P  II   G+VHI VN +FV ++  SP ++  L+  +   IPDETFF++LN+NPQL I GS+ G P+ +         F+TR+KNWG Y C   N +R ICI   GDLP L   P +FANKFY+++  V L+CL + +Y+ + ++   G+++ ++ YY ++ FVK
Sbjct:   29 PQRPACSSHEKDITRLAKNCRNFVRVYGFIMNFL-TEEERNFSIAYSILVFKDAHQVTQLLQAIYRPQNVYCIHVDQKADQSYRDTMAAIADCFH----NVFLTSRSVDVRWGTFTVLEPELICMKDLWH-FKKWKYFINLTGQEFPLRTNFELVRILTAYNGANDVESIVKRANKERWASAGPTPHGIILVKGAVHIAVNRDFVDYVLHSPVAQDFLNWTRRVHIPDETFFASLNHNPQLGIRGSYKGYPETDPVTKP----FLTRFKNWGDYPCAEGNWIRDICILSTGDLPLLDKRPEMFANKFYQDYSRVALECLHQRLYNHMRDE-FLGMMEFDTSYYQNVSFVK 367          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A1S3J731 (beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Lingula unguis OX=7574 GN=LOC106170773 PE=4 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 2.500e-82
Identity = 152/354 (42.94%), Postives = 213/354 (60.17%), Query Frame = 2
Query:  227 PKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYKRRFNKR---IPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWG----QYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGLVDVNSDYYSSLPFVK 1267
            PK  + D  +  D   +C KF+ +++Y ++    E+EE + IAYS+V F+   Q+ERLLR IYRP N YC H+D KS   F IAV ++  C    ++N+  +  R+ V+    SVL ADL CM+EL +K   WKYFINLTGQEFPLKTNLELVKIL+ + GAN++E   KRR   R   +PT   P+ I    GSVHI  +  FV F+   P++K   +  K   IPDE+FF+TLN+NPQL  PG+F G   E  P+      F TR+KNWG     Y C  K  VR +CI+G+GDLP L+     F+NKFY +++P+   C+E   Y++        ++  ++ YY +L +V+
Sbjct:  117 PKKIIPDKDILNDA-SNCDKFVRDRQYIMSTLSREEEE-YPIAYSMVVFKEVEQVERLLRAIYRPQNLYCFHVDKKSPENFYIAVRQISNC----FENVFIASKRIDVQWGQYSVLEADLICMEELLKKSRKWKYFINLTGQEFPLKTNLELVKILKTYNGANDIEGTVKRRNMNRFKDLPT--PPYNITPMKGSVHIVASRPFVDFVLNDPKAKEFHEWDKKAGIPDESFFTTLNHNPQLGAPGAFTGKDPETHPEKK---PFNTRFKNWGDWPFDYPCHGKR-VRMVCIFGIGDLPLLMQRKEFFSNKFYLDYEPLAYDCMEELHYNRT---MAAYMLPFDNSYYKNLSYVR 455          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2T7P154 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_12288 PE=4 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 4.934e-82
Identity = 143/335 (42.69%), Postives = 204/335 (60.90%), Query Frame = 2
Query:  266 IHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYKRRFNKRIPTIN-IPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGLVDVNSDYYSSLPFVK 1267
            + ++C  F+    + +N   TE+E NF IAYSI+ F+ A Q+ +LL+ IYRP N YCIH+D K+   +   +  +  C H    N+  +   V V   T +VL  +L CMK+L+  F  WKYFINLTGQEFPL+TN ELV+IL A+ GAN+VE+  KR   +R  +    P  II   GSVHI VN +FV ++  SP ++  L+  +   +PDETFF++LN+NPQL I GS+ G P+ +         F+TR+KNWG Y C   N  R ICI   GDLP L   P +FANKFY+++  V L+CL   +Y+   ++   G+++ N+ YY ++ FVK
Sbjct:   39 LAKNCRNFVRVYGFIMNFL-TEEERNFPIAYSILVFKDAHQVTQLLQAIYRPQNVYCIHVDQKADQSYRDTMAAIADCFH----NVFLTSRSVDVRWGTFTVLEPELICMKDLWH-FKKWKYFINLTGQEFPLRTNFELVRILTAYNGANDVESIVKRANKERWASAGPTPHGIIPVKGSVHIVVNRDFVDYVLHSPVAQDFLNWTRRVDVPDETFFASLNHNPQLGIRGSYKGYPETDPVTKP----FLTRFKNWGDYPCAEGNFNRDICILSTGDLPLLDTRPEMFANKFYQDYSRVALECLHERLYNHTRDE-FLGMMEFNTSYYQNVSFVK 362          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: ENSAMXT00000050168.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001873.1:355693:357685:-1 gene:ENSAMXG00000033034.1 transcript:ENSAMXT00000050168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 198.364 bits (503), Expect = 7.062e-58
Identity = 123/389 (31.62%), Postives = 204/389 (52.44%), Query Frame = 2
Query:   98 NFLVFTNLIASIQSDSSNEDLICENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEA---------HYKRRF---NKRIPTIN-----IPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYT-----CESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKV 1198
            ++LVF +       DS N D I      +  ++  +   + +K +  ++D   Y ++ QDC +F   +KY +    + +EE F +AYSIV        ERLLR+IY P N+YCIH+D K+S     A+   V C    + N+  +     V  ++ S + AD+NCMK+LY+    WKYFINL GQ+FP+KTNLE+V+ L+   G N++E           +K+R    N  I   N      P  I  ++G  +I V+  F+ F+ E P+++ ++   KD + PDE  ++T+   P   +PG    +   ++   + +   I    + G++      C+  + VR IC++GVGDL  ++   +LFANKF  +F P+ ++CLE+ + +K 
Sbjct:   35 SWLVFGD--DGTPEDSCNCDNIIVGDINEIDRAKILTITKVFKNQTKMTDEH-YIELTQDCERFRVTRKY-MPFTLSAEEEAFPLAYSIVVHHKVQNFERLLRSIYAPQNFYCIHVDKKASESTRAAINATVSC----FDNVFIASQLEEVVYASWSRVQADINCMKDLYQISDRWKYFINLCGQDFPMKTNLEMVRALKGLHGGNSLETETMPSNKEYRWKKRHIVKNGAIQYTNEAKKPPPSRIKMFSGGAYIVVSRAFIRFVLEDPKAQELISWSKDTYSPDEFLWATMQRIPG--VPGYIRAHHKFDRSDMNTISRLIKWAGHEGEFDAVYPPCQGTH-VRAICVYGVGDLQWMLQQDHLFANKFDTDFDPIAIRCLEKHLRNKA 412          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: ENSAMXT00000026751.2 (glucosaminyl (N-acetyl) transferase 1 [Source:NCBI gene;Acc:103024919])

HSP 1 Score: 196.052 bits (497), Expect = 5.493e-57
Identity = 124/399 (31.08%), Postives = 205/399 (51.38%), Query Frame = 2
Query:   68 IYYALVSKMLNFLVFTNLIASIQSDSSNEDLICENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEA---------HYKRRF---NKRIPTIN-----IPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYT-----CESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKV 1198
            + Y    K  ++LVF +       DS N D I     ++   +  +   + +K +  ++D   Y ++ QDC +F   +KY +    + +EE F +AYSIV        ERLLR+IY P N+YCIH+D K+S     A+   V C    + N+  +     V  ++ S + AD+NCMK+LY+    WKYFINL GQ+FP+KTNLE+V+ L+   G N++E           +K+R    N  I   N      P  I  ++G  +I V+  F+ F+ E P+++ ++   KD + PDE  ++T+   P   +PG    +   ++   + +   I    + G +      C+  + VR IC++G GDL  ++   +LFANKF  +F P+ ++CLE+ + +K 
Sbjct:   31 VIYRKTQKDYSWLVFGD--DGTPEDSCNCDNIIVGDIEEIKHAKLLTITKVFKNQTKMTDEH-YIELTQDCERFRVTRKY-MPFTLSAEEEAFPLAYSIVVHHKVQNFERLLRSIYAPQNFYCIHVDKKASESTRAAINATVSC----FDNVFIASQLEEVVYASWSRVQADINCMKDLYQISDRWKYFINLCGQDFPMKTNLEMVRALKGLHGGNSLETETMPSNKEYRWKKRHIVKNGDIHNTNEAKKPPPSGIKMFSGGAYIVVSRVFIRFVLEDPKAQELILWSKDTYSPDEFLWATMQRIPG--VPGYIRAHHKFDRTDMNTISRLIKWVYHEGDFDAVYPPCQGTH-VRSICVYGAGDLQWMLQQDHLFANKFDTDFDPIAIRCLEKHLRNKA 418          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: gcnt4b (beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4-like [Source:NCBI gene;Acc:103021884])

HSP 1 Score: 170.629 bits (431), Expect = 1.627e-47
Identity = 119/358 (33.24%), Postives = 185/358 (51.68%), Query Frame = 2
Query:  233 VPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHY-----KRRFNKRIPTINI------------------PFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQY-------TCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRT 1216
            VP+ + +   +   DC ++L ++  F +++ ++ E  F +AYS+V  + A+ +ER+L  IY P N YCIH D KSS  F  A+  L  CL     N+  +     V+ ++++ L ADLNC+ +L      W+Y INL GQ+FPL++N+ELV+ L+A KGA+ +E        KRRF+      ++                  P  +  + GS + T++ EFVSF+  SP  K  L   +D + PDE F++TL     +R+PG   G    + P    L    TR   W QY        C   +I R +CI+G G+L  L+N  + FANK      PV ++CLE    +K+  ++RT
Sbjct:   77 VPMLEDEDIANATLDCPRYLASRG-FHSIRTSQIEREFPLAYSLVVHKEAAMVERILWAIYVPHNSYCIHYDLKSSPEFMAAMQGLALCL----PNVFIASKLERVQYASITRLRADLNCLSDLMESKVKWRYVINLCGQDFPLRSNVELVEELKALKGASMLETARPSPLKKRRFSFSYTLKDVGSQYHQHPMKTDQAKSPPPHKLEMFVGSAYFTLSREFVSFVQWSPMVKDFLSWSEDTYSPDEHFWATL-----IRVPG-VPGELSRSDPDVSDLASR-TRLVKW-QYLEGKLYPACTGVHI-RSVCIYGAGELRWLLNDGHWFANKLDPRVDPVLVECLE----EKLAERQRT 416          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 164.851 bits (416), Expect = 3.067e-45
Identity = 101/336 (30.06%), Postives = 164/336 (48.81%), Query Frame = 2
Query:  257 YQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYKRRFNKR----------------IPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNW----------GQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWI 1186
            Y    +DC  ++ +++ FL    + +E +F IA+S+V  E     ERLLR IY P N YC+H+D KSS  F  AV  +  CL     N+  +     V  ++ S + AD+NCM++L +    W+Y +N  G +FP+KTN E+V+ L+   G N++E+     + K+                I   + P     +TG+ +  V+ EFV  +F SP+    ++  KD + PDE  ++TL   P +  PGS    P+    ++D L   I R   W            Y   +      +C++G GD+  ++   +LFANKF      + +KCLE ++
Sbjct:   90 YLSATKDCPAYI-SERGFLTTPLSIEERDFPIAFSMVIHEKIEMFERLLRAIYSPQNIYCVHVDTKSSKEFMEAVKAITSCL----PNVFVASKLESVVYASWSRVQADINCMQDLLKSSVQWRYLLNTCGADFPIKTNAEMVRTLKQLNGRNSMESEATNDYKKQRWVYQHNVTTSVIRTSIKKTDPPIKSPMFTGNAYFVVSREFVEHMFSSPEILNFMEWEKDTYSPDEHMWATLQRMPNM--PGS--NPPNGKYDESDMLA--IARLVKWSYLEGDLRKGAPYPPCTGAHRHAVCVYGAGDIKWIVRQKHLFANKFDPEVDDIAIKCLEAYL 414          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4 [Source:NCBI gene;Acc:103033386])

HSP 1 Score: 163.696 bits (413), Expect = 9.315e-45
Identity = 109/336 (32.44%), Postives = 166/336 (49.40%), Query Frame = 2
Query:  275 DCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYKRRFNKR-------------------IPTINI----PFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFI-GNPDENQPQNDYLGYFITRYKNW-----GQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDK 1195
            DC +++  + Y  ++  T++E+NF +AYS+V  ++   +ER++R IY P N YCIH D KSS  F  AV  L KC    + NI  +     VE + ++ L ADLNC+ +L      WKY INL GQ+FPL++N ELV+ L+   GAN +E+       +                    I T N     P  I  + GS +  ++ +FV ++  +  +K  LD   D + PDE F++TL   P   +PG      PD    ++       TR   W       Y   +   +R +CI+G  +L  L++  + FANKF     PV +KCLE  + +K
Sbjct:  101 DCPRYVKARGYS-DISVTDEEKNFPLAYSLVVHKNMPMVERIIRAIYAPTNIYCIHYDQKSSESFIAAVKNLAKC----FPNIFIASKLESVEYAHITRLNADLNCLSDLMSSEVKWKYAINLCGQDFPLRSNYELVEELKKLNGANMLESSRPSELKRERFVFQHKLQDVPYEYHKLPIKTTNAKSAPPHDIEMFIGSAYFVLSRDFVHYVQTAQVAKDFLDWSADTYSPDEHFWATLARVPG--VPGEIPRSEPDVTDLKSK------TRLVKWEYLEGSLYPGCTGTHMRSVCIYGAAELRWLLDDGHWFANKFDPKVDPVLIKCLEEILEEK 423          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4a [Source:NCBI gene;Acc:324510])

HSP 1 Score: 174.096 bits (440), Expect = 5.656e-50
Identity = 122/361 (33.80%), Postives = 181/361 (50.14%), Query Frame = 2
Query:  206 EFGETWKPK----VPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVE-----AHYKRRFNKR---------IPTIN--------IPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWG-----QYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDK 1195
            E G+T K +    V ++D  +   + +DC  FL  +KYF      E E +F IAYSIV  ++A+ LERLLR I+ P N YC+H+D KSS  F+ AV  L KC    + N+  +     V  + +S L AD+NC+ +L +    WKY INL GQ+FPL++N ELV  L++ +G + +E     A+ ++RF  +         +P +          P  +  + GS +  ++ EFV F   S  +   L    D + PDE F++TL  +PQ    G   G  D +  Q+       TR   W       Y   S   VR +CI+G  +L  L+   + FANKF  +  PV +KCLE  I  +
Sbjct:   14 EIGKTLKIRRKTIVDLTDEDMLL-LTEDCPVFLETRKYFSKHVSAE-ERDFPIAYSIVVHKNAATLERLLRAIFVPQNVYCVHVDTKSSTTFKSAVQSLAKC----FDNVFVASKLEEVHYAHISRLQADINCLADLLKSPVRWKYAINLCGQDFPLRSNRELVSELKSLQGRSMLETGKPSAYKQQRFTHKFVLERRDSSLPALQHTQTALAPAPHGLEVFVGSAYFVLSREFVRFAITSAVAADFLRWCADTYSPDEHFWATLARSPQAPG-GGGGGKADVSDLQSK------TRLVKWSYLEGRLYPVCSGRHVRSVCIYGAAELGWLLRDGHWFANKFDPHVDPVVVKCLEEEISSR 361          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4a [Source:NCBI gene;Acc:324510])

HSP 1 Score: 173.711 bits (439), Expect = 7.227e-50
Identity = 122/361 (33.80%), Postives = 181/361 (50.14%), Query Frame = 2
Query:  206 EFGETWKPK----VPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVE-----AHYKRRFNKR---------IPTIN--------IPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWG-----QYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDK 1195
            E G+T K +    V ++D  +   + +DC  FL  +KYF      E E +F IAYSIV  ++A+ LERLLR I+ P N YC+H+D KSS  F+ AV  L KC    + N+  +     V  + +S L AD+NC+ +L +    WKY INL GQ+FPL++N ELV  L++ +G + +E     A+ ++RF  +         +P +          P  +  + GS +  ++ EFV F   S  +   L    D + PDE F++TL  +PQ    G   G  D +  Q+       TR   W       Y   S   VR +CI+G  +L  L+   + FANKF  +  PV +KCLE  I  +
Sbjct:   13 EIGKTLKIRRKTIVDLTDEDMLL-LTEDCPVFLETRKYFSKHVSAE-ERDFPIAYSIVVHKNAATLERLLRAIFVPQNVYCVHVDTKSSTTFKSAVQSLAKC----FDNVFVASKLEEVHYAHISRLQADINCLADLLKSPVRWKYAINLCGQDFPLRSNRELVSELKSLQGRSMLETGKPSAYKQQRFTHKFVLERRDSSLPALQHTQTALAPAPHGLEVFVGSAYFVLSREFVRFAITSAVAADFLRWCADTYSPDEHFWATLARSPQAPG-GGGGGKADVSDLQSK------TRLVKWSYLEGRLYPVCSGRHVRSVCIYGAAELGWLLRDGHWFANKFDPHVDPVVVKCLEEEISSR 360          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 173.711 bits (439), Expect = 3.836e-49
Identity = 115/374 (30.75%), Postives = 183/374 (48.93%), Query Frame = 2
Query:  167 ENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYK-----RRFNKRIPTIN------------IPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNW----------GQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQ 1207
            E + +  I +  +EF + W+    +++S+  + + +DC  F  +++Y + +  +E+E  F IAYS+VA      LERLLR IY P N YC+H+D KS   ++ AV  L  C    + N+  +  +  V  ++   + ADLNCM++L      WKYFINL G +FP+KTNLE+V+ LRA  G N++E+ +       R+  R   +N             P P   ++G+ +I V   FV  +   P ++ +++  KD F PDE  ++TL   P   +PGS    P +     D +   I R   W            Y       +R ICI    DL  ++   +LF NK   +   + + CLER++  K   Q
Sbjct:   68 ERWAEASILTKTVEFRKRWR----LNESECVR-MTRDCDAFKRDRRY-VTVPLSEEEAAFPIAYSVVAHHRVDMLERLLRAIYAPQNVYCLHVDQKSPPPYQEAVRALAAC----FPNVFMASRQERVVYTSWLRVQADLNCMRDLVAAPQPWKYFINLCGLDFPIKTNLEMVRALRALNGENSMESMHTPGGKVGRWQIRHEIVNDGLRSTGEKKSPPPIPTPMFSGNAYIVVTRAFVEHVLSDPTARALMEWEKDTFSPDEHLWATLQRLPG--VPGS--TPPHDKYDVEDMMA--IARLVRWSYMEGDTLQGAAYPPCRGTHMRAICINSAKDLAWVLKQRHLFVNKLDSDVDELAVHCLERYLRRKALRQ 425          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 170.629 bits (431), Expect = 4.521e-48
Identity = 108/344 (31.40%), Postives = 161/344 (46.80%), Query Frame = 2
Query:  272 QDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKEL--YRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEA-------------HYKRRFN--------KRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQY------------TCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKV 1198
            +DC  F   ++Y L +  + +EE F IAYS+VA      LERLLR +Y P N YC+H+DAKS   +  A   L  C    + N+  + +   V  ++ S + ADLNCM EL    +   W+YFINL G++FP+KTNLE+V+ LR   G N++E               YK   N        KR P    P P   + GS ++ V   FV  +   P ++ +++   D + PDE  ++TL   P   +PGS   +   +      L   +     W  +             C   + VR +C++G GDL  ++   +LFANK       V + CLE  +  K 
Sbjct:  101 RDCDAFRRARRYVL-VPLSREEEAFPIAYSVVAHHRVDMLERLLRAVYAPQNLYCLHVDAKSPRAYLEAARALAAC----FPNVFVAAHLERVVYASWSRVQADLNCMSELVAMAERVPWRYFINLCGRDFPIKTNLEMVRALRTLNGRNSLETVRMPRGKRARWTLSYKVAGNEIRSTGLTKRPP----PIPTPMFAGSAYVVVTRAFVEHVLSDPAARALIEWAGDTYSPDEHLWATLQRMPG--VPGSTPAHRIHDVTDAAALARLV----KWSAFEGDVAGGGAAYPPCRGTH-VRDVCVYGAGDLAWVLRQHHLFANKVDTAVDHVAVHCLEHHLRKKA 428          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: GCNT2 (glucosaminyl (N-acetyl) transferase 2 (I blood group) [Source:HGNC Symbol;Acc:HGNC:4204])

HSP 1 Score: 152.525 bits (384), Expect = 1.295e-41
Identity = 111/343 (32.36%), Postives = 165/343 (48.10%), Query Frame = 2
Query:  275 DCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILR-AFKGANNVEA-----HYKRRFN-----------KRIPTINI-----PFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPG-----SFIGNPDENQPQNDYLGYFITRYKNW--GQYT---CESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQ 1207
            +C+ F+  Q Y       E E++F +AY I   +       L R IY P N YCIH+D KSS  F+ ++  L  C    + N+  +     V  +  S L AD+NCM++L  + T WKY +NL GQ+FPL+TN E+V+IL+  ++G N         H K R             K++   N+     P  I    G+ +  V  EFV ++ +  +++ +L+  ++ F PDE +F TLN  P    PG     S+ GN               TR   W  G+ T   C+  + VR IC++G GDL  L    +LFANKF     P+ L+CLE W   +  N+
Sbjct:   70 NCSAFIEKQSYITEALSKE-EQDFPLAYIITVHKDFETFSILFRNIYMPQNIYCIHVDVKSSESFKKSMQRLAGC----FDNVFLASRSETVVYAGFSRLKADINCMRDLATRPTPWKYVLNLCGQDFPLRTNQEIVRILKNKWRGKNITPGIFQPPHMKWRTQYVYKEVVDKDKKQMIRTNVAKGPPPHGINLCFGTAYYAVTREFVQYVLDDKKAQDLLEWSQETFSPDEHYFVTLNSLPD--APGANTVPSWEGN---------------TRAVKWRDGEKTHKGCKG-HYVRDICVYGEGDLEWLTKRSDLFANKFEMQRYPLVLECLEHWARQRTLNE 389          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Match: EDO39617 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9I5])

HSP 1 Score: 152.14 bits (383), Expect = 1.977e-42
Identity = 99/284 (34.86%), Postives = 147/284 (51.76%), Query Frame = 2
Query:  326 TEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEA-----------HYKRRFNKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPN---LFANK 1135
            T  E +F IAY I+ ++     ERLL+ +Y P NYYCIHID K+++ F  A   +V CL     N+  ++ RV V+   +S++ A+L+CM EL  +   WKY+INL GQ+FPL  N+E+V++L++  G NN+E+            + R   K +     P  +I   GSVH  +  +F  F+     ++ +L  L+D F  DE FF+TL Y+     PG   G     QP+       I R K W    C  +  VR IC   + DL  +++  N   LF NK
Sbjct:   13 TRTELDFPIAYGILIYKGLPLFERLLQALYMPQNYYCIHIDKKTNSYFVDAAQRMVACL----PNVFIAKTRVNVKWGEISLVKAELSCMTEL--QTFKWKYYINLVGQDFPLYNNMEIVRVLKSLHGLNNIESIEMPAYNVHRVEFVRHGQKLLRKSPPPHGLIIRKGSVHGILTRKFTEFVLRDKVARDLLKWLEDVFAADEIFFATLQYDQA--TPGGIHG----QQPE------CIARVKRWRPGYCAGR-YVRNICWIDIRDLTWVLSEGNNRKLFVNK 277          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Match: EDO37446 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFS7])

HSP 1 Score: 138.658 bits (348), Expect = 2.877e-37
Identity = 88/299 (29.43%), Postives = 145/299 (48.49%), Query Frame = 2
Query:  335 EENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEA--------------HYKRRFNKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPN---LFANKFYENFQPVTLKCLER 1180
            E +F +A+ I+ +      ERLL+ IY P N YCIHID K+   F  AV +++ CL     N+  +   V V     S++ A +NC++ L +    WKY++++ GQ+FPL TN E+V+ ++     NN+E+              +   R   +I     PF I    G++H  +   FV F+ ES  +   +D   D  +PDETFF+++  +P    PG  +G    +QP       +I +   W  +      I+RQ+C   + DL  +++  N   LF +K   ++    L CL +
Sbjct:    2 ERDFPLAFGIMIYNGLPLFERLLQEIYMPHNVYCIHIDRKTRQSFHKAVKQMISCL----PNVFIASKLVKVYWGEFSIVQAKMNCLRNLLKSPVKWKYYLHMIGQDFPLYTNHEMVRAIKTLNYTNNMESIKVPISNRDRTEYVYIGSRTRTKILKPPPPFNITLRKGNIHAMLTRGFVEFLLESEIANAFIDWCNDTSVPDETFFASMQNHPG--APGGVVG----DQPP------YIFKLIRWYWFDRCYGRIIRQVCWIDIKDLRSVLSQFNLSFLFVHKIPFDYDIELLDCLSQ 284          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Match: EDO36835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI4])

HSP 1 Score: 58.5362 bits (140), Expect = 4.219e-9
Identity = 59/227 (25.99%), Postives = 97/227 (42.73%), Query Frame = 2
Query:  311 LNLKETEDEENFRIAYSIVAFESA-SQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKEL-YRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYK--RRFNK----------------RIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRF----IPDETFFST 919
            LN K        RIAY +     A  Q+ RL + IY   +Y+  HID +S +     V  ++K     + N   +   +       ++L   L  M++L  RK   W +FINL+G +FP+K N  L   LR+ +  N ++ H +   RF K                R+    +P  +    GS  I +N ++  ++  S     ++  LK  +    +P E+FF T
Sbjct:   67 LNDKSAAYGPPIRIAYVLSLHGRALRQIRRLFKVIYHTHHYFYFHIDTRS-DYLRREVSNMIK----DFPNAALAPWSMATIWGGATLLQMLLKSMEDLIARKEWKWDFFINLSGNDFPIKVNTVLSSFLRSHRDVNFLKPHGRDIARFIKKQGLDRTFLQCDEHMWRLGDRKLPADLDIDGGSDWIALNRKYCDYLVTSRDE--LVTGLKHMYRYTLLPAESFFHT 286          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:NCBI gene;Acc:101155272])

HSP 1 Score: 170.629 bits (431), Expect = 2.302e-47
Identity = 110/363 (30.30%), Postives = 178/363 (49.04%), Query Frame = 2
Query:  191 KSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYKRRFNK---------------RIPTINIPFPII--WYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYTCESKNIV----------RQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKV 1198
            ++PE++     + +  +   + Y +  +DC  F+  ++ F+    +E+E+ F IAYS+V  E     ERLLR IY P N YC+H+D KSS  ++ AV  +V C    + NI  +     V  ++ S + ADLNCMK+L      WKY +N  G +FP+KTN E+V  L+   G N++E      + K               R      P PI    Y+G+ +  V+  FV  + +  +++ ++D  KD + PDE  ++TL   PQ  +PGS   N   +   +D L +   R   W  +T + +             R +C++GVGDL  L+   +LFANKF      + ++C+E  +  K 
Sbjct:   61 QNPELDLLLVSRERKSLLSEEFYLNATKDCPAFI-AKRGFITEPLSEEEKKFPIAYSMVIHEKIEMFERLLRAIYAPQNVYCVHVDQKSSPEYQTAVKRIVSC----FPNIFIASKLERVVYASWSRVQADLNCMKDLLNSDVPWKYLLNTCGTDFPIKTNREMVSALKLLNGRNSMETEVTNDYKKGRWEYHHNVTDTSVIRTGVKKSPPPISSPMYSGNAYFIVSRAFVKHLMKDEEAQRLIDWEKDTYSPDEHLWATLQRMPQ--VPGSLPFNSKYD--TSDMLAF--ARAVKWVYHTGDVRKGAPYPPCTGTYRRAVCVYGVGDLLWLLQTHHLFANKFDPEVDDIAIRCMESILRSKA 412          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: ENSORLT00000007218.2 (glucosaminyl (N-acetyl) transferase 1 [Source:NCBI gene;Acc:101157299])

HSP 1 Score: 169.859 bits (429), Expect = 3.925e-47
Identity = 106/359 (29.53%), Postives = 180/359 (50.14%), Query Frame = 2
Query:  203 MEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVE--------------AH------YKRRFNKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQ-------YTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKV 1198
            +     ++ ++ +SD + Y +  +DC  F+  +KY +    +++EE+F +AYS++        ERLLR IY P N+YC+H+D K+    E +V   +  + S + N+      V V  +    + ADLNCM +LY     WKYF+NL GQ+FPLKTNLE+V+IL+   G N++E              AH       + +   + P+   PF +   +G+ +I  +  ++  +    + + +++ +KD + PDE  ++T+   P   +PGS   N   +    + L   +    + G        Y     N VR IC++G GDL  L+   + FANKF  +  P+ + CLER++  K 
Sbjct:   75 LTLTRAFQKRIKISD-EYYINATEDCRLFIKTRKY-ITFPLSKEEEDFPLAYSMIVHHKVQNFERLLRAIYAPQNFYCVHVDKKA----EPSVFAAILAISSCFPNVFLVSQSVDVVYAGWPRVQADLNCMADLYNTSRRWKYFLNLCGQDFPLKTNLEMVRILKTLNGGNSMESENMPPEKKWRVTNAHQIVDGKIQAKGEAKSPS---PFNLPIMSGNAYIVASRGYIHSVLHDKRIQALIEWMKDTYSPDEAIWATIQRIPG--VPGSTRPNRKYDVSDINALARLVKWQWHEGSQDSLDALYPVCHGNHVRAICVYGAGDLQWLLENHHFFANKFDTDTDPIAIYCLERYLRKKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: si:dkeyp-87d8.8 (glucosaminyl (N-acetyl) transferase 4 [Source:NCBI gene;Acc:101166645])

HSP 1 Score: 162.925 bits (411), Expect = 1.889e-44
Identity = 116/361 (32.13%), Postives = 180/361 (49.86%), Query Frame = 2
Query:  239 VSDSKLYQDIHQDCTKFLFNQKYFLNLKETED------EENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHY-----KRRFN------------KRIPTIN------IPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQ-NDYLGYFITRYKNWGQ-----YTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRT 1216
            +  +K  +D  +   +F  N   F+ ++  +D      E++F +AYS+V  ++A  +ERLLR  Y P N YCIH D KS+  F  A+  L +CL     N+  +  R  V  +++S L ADLNC+ +L      WKY INL GQ+FPLK+N+ELV  LR   G+N +E        K RF+            +++P          P  I  + G+ +  ++ EF+  +  S  +    D  KD + PDE F++TL     +R+PG F G     +P   D +    TR   W       Y   +   VR +CI+G G+L  L+N  + FANKF     PV ++CLE    +++E ++R+
Sbjct:   76 IRKNKEREDTDESLAEFTENCPSFIKIRGYDDVCFSDQEKDFPLAYSLVVHKNAWMVERLLRATYSPVNVYCIHYDQKSTPQFTAAMEGLARCL----PNVFIASKRESVFYASISRLQADLNCLHDLVESEVKWKYVINLCGQDFPLKSNMELVSELRKLNGSNMLETSRPSNIKKDRFSFHHELKDASFEYQKLPVRTDQAKSPPPHGIEMFIGNAYFVLSREFILHMTSSVIAMDFFDWSKDTYSPDEHFWATL-----VRVPG-FPGEVAREKPDITDLMSK--TRLVKWSYLEGSLYPLCTGEHVRSVCIYGCGELRWLLNYGHWFANKFEPKVDPVLIQCLE----ERLEEKQRS 420          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: gcnt7 (beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 7-like [Source:NCBI gene;Acc:101157298])

HSP 1 Score: 162.54 bits (410), Expect = 2.277e-44
Identity = 114/369 (30.89%), Postives = 180/369 (48.78%), Query Frame = 2
Query:  197 PEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRA-----------------------FKGANNVEAHYKRRFNKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNY---NPQLRIPGSFIGNPD----ENQPQNDYLGYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRR 1213
            P +E    W  +     + + +D +Q C + L    +F+    +++EE++ +A+ +   +      R LR IY P N YCIHIDAK+   ++  V  LV C    ++NI  S     V     S L ADLNCMK+L R    WK  +NL GQ+FP+K+NLELV+ +++                       F+    V +H  ++  K+ P    P  +  Y G+ +  +   FV F+ +SP +  +L   KD + PDE ++ TLN+    P  R+ G + G+      ++Q   ++ G             C+  + VR IC++G+GD+  +IN  N+FANKF  N  P  L CLE+W   KV NQ +
Sbjct:   55 PGLETAAQWYRRDCQVVNHILKD-NQPCVE-LIRDLHFITRPLSQEEEDYPLAFIMTIHKDLEMFVRTLRAIYMPQNVYCIHIDAKAPLEYKKVVRGLVGC----FENIFLSSQSETVTYGGYSRLQADLNCMKDLIRSNVGWKKVVNLCGQDFPIKSNLELVQYMQSKEWRDKNLTPGVKQPAHIRSRTEFQHQEIVGSHVIQKGEKKEPP---PDNLQIYFGTAYYALTRAFVDFVLKSPIALNLLKWSKDAYSPDEHYWVTLNHLKEAPGSRVDGGWEGDIRAIKWKDQEGTNHQG-------------CKG-HYVRDICVYGMGDIEWIINNNNMFANKFESNAYPEALDCLEQWHRSKVLNQAK 400          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: ENSORLT00000033084.1 (xylosyltransferase 1 [Source:NCBI gene;Acc:100049491])

HSP 1 Score: 66.6254 bits (161), Expect = 3.433e-11
Identity = 79/297 (26.60%), Postives = 128/297 (43.10%), Query Frame = 2
Query:  350 IAYSIVAFESAS-QLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFT-NWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYK--RRFNK----------------RIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRF-----IPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQY---TCESKNIVRQICI----WGVGDLPKL--INAPNLFANKF 1138
            IA+ +V    AS QL+RL + IY   +YY IH+D +S  +        V  L  +Y N+  +  R+       S+LT  L  M++L      +W +FINL+  +FP++TN +LV  L   +  N +++H +   RF +                R+    IP  I    GS    ++  FV ++  S     +++++K RF     +P E+FF T+                 EN    + +     R  NW +     C+ K+IV         +   DLP+L   + P  FA KF
Sbjct:  347 IAFVLVVHGRASRQLQRLFKAIYHTSHYYYIHVDQRSDFLHR-----EVLSLARQYPNVRVTPWRMATIWGGASLLTMYLRSMEDLLSMTDWSWDFFINLSAADFPIRTNEQLVAFLSKHRSKNFIKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRKIPEGIAVDGGSDWFLLSRSFVDYVVNS--GDELVNSMK-RFYAYTLLPAESFFHTVL----------------ENSAHCETMVDNNLRLTNWNRKLGCKCQYKHIVDWCGCSPNDFKPSDLPRLQQTSRPTFFARKF 619          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000043063.1 (SMESG000043063.1)

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 316/408 (77.45%), Postives = 345/408 (84.56%), Query Frame = 2
Query:   56 MKNCIYYALVSKMLNFLVFTNLIASIQSDSSNEDLICENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYKRRFNKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGLVDVNSDYYSSLPFVKYRYV 1279
            MKNCIYYALVSKMLNFLVFTNLIASIQSDSSNEDLICENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTN ELVKIL+A+KGANN+E  YK R    IP    PFP+IW+ G VHI VN  FV FIFES   K++L  L ++  PDE FFSTLNYNPQ RI GSF+G+PDE        G ++ RYKN GQ+TC S+   R ICI G+ DL  LIN+P+LFA+KFYE+FQP  L+CLE+W YDKV  + ++G   V   +Y+S  FVK++YV
Sbjct:    1 MKNCIYYALVSKMLNFLVFTNLIASIQSDSSNEDLICENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNAELVKILKAYKGANNIEGTYKNRDENIIPKEQTPFPVIWFKGDVHIIVNRNFVEFIFESSIPKVILQFLNNQQFPDEQFFSTLNYNPQFRIAGSFLGDPDELDS-----GIYLGRYKNKGQFTCGSRFFNRSICILGIQDLNMLINSPHLFAHKFYEHFQPGALRCLEKWYYDKVTEEIKSGYARVKESFYTSQVFVKHQYV 403          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000008972.1 (SMESG000008972.1)

HSP 1 Score: 533.487 bits (1373), Expect = 0.000e+0
Identity = 249/375 (66.40%), Postives = 305/375 (81.33%), Query Frame = 2
Query:  164 CENFFKQYIKSPEMEFGETWK--PKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYKRRFNKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGLVDVNSDYYSSLPFVKYRYVP 1282
            C   F+  I    +     WK  P    +D ++YQ I++ C+ F+ N+KYFL  + +++E++FRIA+SIV ++SASQ+ERLLRTIYRPWNYYCIH+D KS   F  A+G+L +CL+SK+ N+IN++NRV V+   MSVLTADLNCMKELY+++ NWKYFINLTGQEFPLKTN ELVKIL+AF+GAN+VEAHYKRRF+ RIPT+ +PFPIIWYTGSVHITVNF FVSFIFESP SK++LD+LK+ FIPDETFFSTLNYNPQLRI GS++GNPDE Q QND LGY  TRYKNWGQY CESK  VR ICI GVGDLP+++NAPNLFANKFYE FQP TL+CLERWIYDKV+ + R G V ++  +Y  LPFVK+RY+P
Sbjct:  145 CNELFRTDISKSVINSSINWKLFPNESFTDYQMYQVINKSCSNFIMNKKYFLK-ELSKEEKDFRIAFSIVVYKSASQVERLLRTIYRPWNYYCIHVDTKSKPEFVKAIGKLTECLNSKHNNVINTDNRVDVQWGKMSVLTADLNCMKELYQRYKNWKYFINLTGQEFPLKTNAELVKILKAFRGANHVEAHYKRRFDVRIPTVKMPFPIIWYTGSVHITVNFHFVSFIFESPVSKVLLDSLKNHFIPDETFFSTLNYNPQLRISGSYVGNPDEIQSQNDSLGYMKTRYKNWGQYPCESKKFVRDICILGVGDLPRIVNAPNLFANKFYEEFQPATLRCLERWIYDKVDKEFRKGTVAIDDSFYKLLPFVKFRYIP 518          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000051787.1 (SMESG000051787.1)

HSP 1 Score: 523.472 bits (1347), Expect = 0.000e+0
Identity = 250/393 (63.61%), Postives = 311/393 (79.13%), Query Frame = 2
Query:  104 LVFTNLIASIQSDSSNEDLICENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYKRRFNKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGLVDVNSDYYSSLPFVKYRYVP 1282
            L+F NL  ++   + NE L   +  K  I S        W P    +D ++YQ I++ C+ F+ N+KY L  + +++E++FRIA+SIV +++ASQ+ERLLRTIYRPWNYYCIH+D KS   F  A+G+L +CL+SK+ N+IN++NRV V+   MSVLTADLNCMKELY+++ NWKYFINLTGQEFPLKTN ELVKIL+AFKGAN+VEA+YKRRF+ RIPT+ +PFPIIWYTGSVHI VN +FVSFIFESP SK++LD+L + FIPDETFFSTLNYNPQLRI GS++GNPDE Q QND LGY  TRYKNWGQY CESK IVR ICI GVGDLP+++NAPNLFANKFYE FQP TL+CLERWIYDKV+ + R G   ++  +Y  LPFVK+RY+P
Sbjct:   37 LIFANLNIALTEPNCNE-LFRTDISKSVINS---SINWKWFPNESFTDYQMYQVINKSCSNFIMNKKYLLK-ELSKEEKDFRIAFSIVVYKNASQVERLLRTIYRPWNYYCIHVDTKSKPEFVKAIGKLTECLNSKHNNVINTDNRVDVQWGKMSVLTADLNCMKELYQRYKNWKYFINLTGQEFPLKTNAELVKILKAFKGANHVEAYYKRRFDNRIPTVKMPFPIIWYTGSVHIIVNLDFVSFIFESPVSKVLLDSLNNHFIPDETFFSTLNYNPQLRISGSYVGNPDEIQSQNDSLGYMKTRYKNWGQYPCESKKIVRDICILGVGDLPRIVNAPNLFANKFYEEFQPATLRCLERWIYDKVDKEFRKGTAAIDDSFYKLLPFVKFRYIP 424          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000051787.1 (SMESG000051787.1)

HSP 1 Score: 523.472 bits (1347), Expect = 0.000e+0
Identity = 250/393 (63.61%), Postives = 311/393 (79.13%), Query Frame = 2
Query:  104 LVFTNLIASIQSDSSNEDLICENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYKRRFNKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGLVDVNSDYYSSLPFVKYRYVP 1282
            L+F NL  ++   + NE L   +  K  I S        W P    +D ++YQ I++ C+ F+ N+KY L  + +++E++FRIA+SIV +++ASQ+ERLLRTIYRPWNYYCIH+D KS   F  A+G+L +CL+SK+ N+IN++NRV V+   MSVLTADLNCMKELY+++ NWKYFINLTGQEFPLKTN ELVKIL+AFKGAN+VEA+YKRRF+ RIPT+ +PFPIIWYTGSVHI VN +FVSFIFESP SK++LD+L + FIPDETFFSTLNYNPQLRI GS++GNPDE Q QND LGY  TRYKNWGQY CESK IVR ICI GVGDLP+++NAPNLFANKFYE FQP TL+CLERWIYDKV+ + R G   ++  +Y  LPFVK+RY+P
Sbjct:   36 LIFANLNIALTEPNCNE-LFRTDISKSVINS---SINWKWFPNESFTDYQMYQVINKSCSNFIMNKKYLLK-ELSKEEKDFRIAFSIVVYKNASQVERLLRTIYRPWNYYCIHVDTKSKPEFVKAIGKLTECLNSKHNNVINTDNRVDVQWGKMSVLTADLNCMKELYQRYKNWKYFINLTGQEFPLKTNAELVKILKAFKGANHVEAYYKRRFDNRIPTVKMPFPIIWYTGSVHIIVNLDFVSFIFESPVSKVLLDSLNNHFIPDETFFSTLNYNPQLRISGSYVGNPDEIQSQNDSLGYMKTRYKNWGQYPCESKKIVRDICILGVGDLPRIVNAPNLFANKFYEEFQPATLRCLERWIYDKVDKEFRKGTAAIDDSFYKLLPFVKFRYIP 423          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000051810.1 (SMESG000051810.1)

HSP 1 Score: 520.39 bits (1339), Expect = 0.000e+0
Identity = 249/393 (63.36%), Postives = 310/393 (78.88%), Query Frame = 2
Query:  104 LVFTNLIASIQSDSSNEDLICENFFKQYIKSPEMEFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIAYSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLHSKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQEFPLKTNLELVKILRAFKGANNVEAHYKRRFNKRIPTINIPFPIIWYTGSVHITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGSFIGNPDENQPQNDYLGYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKLINAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGLVDVNSDYYSSLPFVKYRYVP 1282
            L+F NL  ++   + NE L   +  K  I S        W P    +D ++YQ I++ C+ F+ N+KY L  + +++E++FRIA+SIV +++ASQ+ERLLRTIYRPWNYYCIH+D KS   F  A+G+L +CL+SK+ N+IN++NRV V+   MSVLTADLNCMKELY+++ NWKYFINLTGQEFPLKTN ELVKIL+AFKGAN+VEA+YKRRF+ RIPT+ +PFPIIWYTGSVHI VN +FVSFIFESP SK++LD+L + FIPDETFFSTLNYNPQLRI GS++GNPDE Q QND LGY  TRYKNWGQY CESK IV  ICI GVGDLP+++NAPNLFANKFYE FQP TL+CLERWIYDKV+ + R G   ++  +Y  LPFVK+RY+P
Sbjct:   37 LIFANLNIALTEPNCNE-LFRTDISKSVINS---SINWKWFPNESFTDYQMYQVINKSCSNFIMNKKYLLK-ELSKEEKDFRIAFSIVVYKNASQVERLLRTIYRPWNYYCIHVDTKSKPEFVKAIGKLTECLNSKHNNVINTDNRVDVQWGKMSVLTADLNCMKELYQRYKNWKYFINLTGQEFPLKTNAELVKILKAFKGANHVEAYYKRRFDNRIPTVKMPFPIIWYTGSVHIIVNLDFVSFIFESPVSKVLLDSLNNHFIPDETFFSTLNYNPQLRISGSYVGNPDEIQSQNDSLGYMKTRYKNWGQYPCESKKIVPDICILGVGDLPRIVNAPNLFANKFYEEFQPATLRCLERWIYDKVDKEFRKGTAAIDDSFYKLLPFVKFRYIP 424          
The following BLAST results are available for this feature:
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GCNT12.778e-5031.66glucosaminyl (N-acetyl) transferase 1 [Source:HGNC... [more]
GCNT12.778e-5031.66glucosaminyl (N-acetyl) transferase 1 [Source:HGNC... [more]
GCNT12.778e-5031.66glucosaminyl (N-acetyl) transferase 1 [Source:HGNC... [more]
GCNT21.187e-4732.66glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
GCNT21.187e-4732.66glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gly-153.508e-3430.89GLYcosylation related [Source:UniProtKB/TrEMBL;Ac... [more]
gly-167.880e-3427.19GLY-16; GLYcosylation related [Source:UniProtKB/T... [more]
gly-181.463e-3327.68GLYcosylation related [Source:UniProtKB/TrEMBL;Ac... [more]
gly-171.177e-3228.01GLYcosylation related [Source:UniProtKB/TrEMBL;Ac... [more]
gly-12.183e-3126.33GLY-1; GLYcosylation related [Source:UniProtKB/Tr... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oxt2.799e-1526.88gene:FBgn0015360 transcript:FBtr0072904[more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcnt4b4.091e-4833.05glucosaminyl (N-acetyl) transferase 4b [Source:ZFI... [more]
si:dkeyp-87d8.81.014e-4734.48si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-1... [more]
si:dkeyp-87d8.81.323e-4733.53si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-1... [more]
gcnt4b1.534e-4733.53glucosaminyl (N-acetyl) transferase 4b [Source:ZFI... [more]
si:dkeyp-87d8.82.008e-4733.53si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-1... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccdc771.833e-5133.92coiled-coil domain containing 77 [Source:Xenbase;A... [more]
cnksr24.602e-5032.85connector enhancer of kinase suppressor of Ras 2 [... [more]
gcnt2.22.544e-4533.04glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
GCNT47.292e-4534.23glucosaminyl (N-acetyl) transferase 4 [Source:NCBI... [more]
adsl1.885e-4432.81adenylosuccinate lyase [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gcnt16.754e-5332.66glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt16.754e-5332.66glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt16.754e-5332.66glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt16.754e-5332.66glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt21.629e-4733.33glucosaminyl (N-acetyl) transferase 2, I-branching... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q09324|GCNT1_MOUSE4.724e-5232.66Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q02742|GCNT1_HUMAN1.334e-4931.66Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q9IZK2|GCNT3_BHV4V9.011e-4932.00Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q805R1|GCNT3_BHV4L9.390e-4931.14Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q92180|GCNT1_BOVIN1.417e-4832.46Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JUK05.481e-8645.95Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A0B7AMK89.638e-8644.74Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A2T7P1442.569e-8341.71Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1S3J7312.500e-8242.94beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
A0A2T7P1544.934e-8242.69Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000050168.17.062e-5831.62pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000026751.25.493e-5731.08glucosaminyl (N-acetyl) transferase 1 [Source:NCBI... [more]
gcnt4b1.627e-4733.24beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
gcnt33.067e-4530.06glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
gcnt4a9.315e-4532.44glucosaminyl (N-acetyl) transferase 4 [Source:NCBI... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcnt4a5.656e-5033.80glucosaminyl (N-acetyl) transferase 4a [Source:NCB... [more]
gcnt4a7.227e-5033.80glucosaminyl (N-acetyl) transferase 4a [Source:NCB... [more]
gcnt33.836e-4930.75glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
gcnt34.521e-4831.40glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
GCNT21.295e-4132.36glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO396171.977e-4234.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374462.877e-3729.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368354.219e-925.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcnt32.302e-4730.30glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
ENSORLT00000007218.23.925e-4729.53glucosaminyl (N-acetyl) transferase 1 [Source:NCBI... [more]
si:dkeyp-87d8.81.889e-4432.13glucosaminyl (N-acetyl) transferase 4 [Source:NCBI... [more]
gcnt72.277e-4430.89beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
ENSORLT00000033084.13.433e-1126.60xylosyltransferase 1 [Source:NCBI gene;Acc:1000494... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043063.10.000e+077.45SMESG000043063.1[more]
SMESG000008972.10.000e+066.40SMESG000008972.1[more]
SMESG000051787.10.000e+063.61SMESG000051787.1[more]
SMESG000051787.10.000e+063.61SMESG000051787.1[more]
SMESG000051810.10.000e+063.36SMESG000051810.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004585 ID=SMED30004585|Name=beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1513bp
TTTATTTTTCACAATTTATTAGTGTGATTGTTTTAACGATATTTTAAAAG
ACAAAATGAAAAACTGCATTTACTATGCATTAGTTTCAAAAATGCTAAAT
TTTCTTGTATTCACAAACCTAATTGCCTCAATTCAATCTGACAGTTCGAA
TGAAGATTTAATTTGTGAAAATTTCTTCAAACAATACATCAAATCTCCGG
AAATGGAATTCGGTGAAACTTGGAAACCAAAAGTTCCTGTCTCTGATTCT
AAACTTTATCAAGACATCCATCAAGACTGTACAAAATTTTTATTTAATCA
AAAGTATTTTCTCAATTTAAAGGAAACAGAAGACGAAGAAAATTTTCGAA
TCGCTTACTCGATTGTTGCATTTGAAAGTGCATCTCAACTGGAAAGATTG
CTGAGAACAATTTATCGTCCATGGAATTATTATTGCATTCACATTGATGC
CAAGTCTTCCAATGTGTTTGAAATAGCTGTTGGAGAATTGGTAAAATGTC
TTCATTCAAAATACAAGAACATAATTAATAGTGAAAATCGAGTCTTTGTC
GAAAGAAGTACAATGTCTGTATTGACTGCAGATTTGAACTGTATGAAAGA
ACTGTATAGAAAGTTTACAAACTGGAAATATTTCATTAATTTAACCGGAC
AAGAATTTCCATTAAAAACAAACTTAGAGTTAGTAAAGATTTTAAGAGCA
TTCAAAGGTGCCAACAATGTAGAAGCGCATTATAAAAGAAGATTTAATAA
AAGAATTCCTACAATTAACATTCCATTTCCGATAATTTGGTACACTGGAT
CAGTTCATATCACAGTTAATTTCGAATTCGTTTCGTTCATATTTGAGTCT
CCACAATCTAAAATTATGCTCGATGCATTGAAAGACCGATTTATTCCAGA
TGAAACTTTCTTTTCGACTTTAAATTACAATCCGCAATTGAGAATTCCTG
GCTCATTTATTGGAAATCCAGATGAAAATCAGCCACAAAACGATTATTTG
GGATACTTCATTACCCGATATAAAAACTGGGGTCAATATACTTGCGAGAG
TAAAAATATTGTTCGGCAAATTTGCATTTGGGGTGTCGGTGATTTACCGA
AATTGATTAATGCGCCAAATCTTTTTGCCAATAAGTTCTATGAGAATTTC
CAACCAGTCACTCTAAAGTGTCTCGAAAGGTGGATTTATGATAAAGTTGA
AAACCAAAGGAGAACTGGCCTTGTTGATGTGAACAGTGATTACTACAGTT
CATTGCCATTTGTGAAATATCGCTATGTTCCATCATCAGAATGAATATTA
CATATTAGACTGCTTTCACTGGATTTCTGATAACAATTCTGACATCTATT
TCCATAACCGATCTTAATTCCATAAGCATGAAAACCTTCGTACGCAATAT
CTAGTTGCAGATAGCATTGATAAATATTTGATTTCAATTTGACAATTAAC
GAAATCGGTGACTTCCATGTTTTGTGCATATCATAATGTCATTATCATTT
CGAAATTCTGAAT
back to top

protein sequence of SMED30004585-orf-1

>SMED30004585-orf-1 ID=SMED30004585-orf-1|Name=SMED30004585-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=413bp
MKNCIYYALVSKMLNFLVFTNLIASIQSDSSNEDLICENFFKQYIKSPEM
EFGETWKPKVPVSDSKLYQDIHQDCTKFLFNQKYFLNLKETEDEENFRIA
YSIVAFESASQLERLLRTIYRPWNYYCIHIDAKSSNVFEIAVGELVKCLH
SKYKNIINSENRVFVERSTMSVLTADLNCMKELYRKFTNWKYFINLTGQE
FPLKTNLELVKILRAFKGANNVEAHYKRRFNKRIPTINIPFPIIWYTGSV
HITVNFEFVSFIFESPQSKIMLDALKDRFIPDETFFSTLNYNPQLRIPGS
FIGNPDENQPQNDYLGYFITRYKNWGQYTCESKNIVRQICIWGVGDLPKL
INAPNLFANKFYENFQPVTLKCLERWIYDKVENQRRTGLVDVNSDYYSSL
PFVKYRYVPSSE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
Vocabulary: INTERPRO
TermDefinition
IPR003406Glyco_trans_14
Vocabulary: molecular function
TermDefinition
GO:0008375acetylglucosaminyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003406Glycosyl transferase, family 14PFAMPF02485Branchcoord: 99..195
e-value: 2.0E-14
score: 53.7
NoneNo IPR availablePANTHERPTHR19297GLYCOSYLTRANSFERASE 14 FAMILY MEMBERcoord: 54..195
NoneNo IPR availablePANTHERPTHR19297:SF181coord: 54..195
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..28
score: 0.525