Dual specificity protein phosphatase 10

Overview
NameDual specificity protein phosphatase 10
Smed IDSMED30004581
Length (bp)1150
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dual specificity protein phosphatase 10 (SMED30004581) t-SNE clustered cells

Violin plots show distribution of expression levels for Dual specificity protein phosphatase 10 (SMED30004581) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dual specificity protein phosphatase 10 (SMED30004581) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dual specificity protein phosphatase 10 (SMED30004581) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004581

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30004581SMESG000048127.1 Contig4570GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30004581SMESG000030100.1 Contig4570GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30004581SMESG000030100.1 dd_Smed_v4_3551_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30004581SMESG000030100.1 dd_Smed_v4_3551_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004581SMESG000030100.1 dd_Smed_v4_3551_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004581SMESG000030100.1 dd_Smed_v4_3551_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004581SMESG000048127.1 Contig4570GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004581SMESG000030100.1 Contig38682newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004581SMESG000030100.1 Contig38682uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004581SMESG000030100.1 Contig4570GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30004581SMESG000030100.1 dd_Smed_v4_3551_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Human
Match: DUSP10 (dual specificity phosphatase 10 [Source:HGNC Symbol;Acc:HGNC:3065])

HSP 1 Score: 137.887 bits (346), Expect = 7.842e-36
Identity = 96/285 (33.68%), Postives = 151/285 (52.98%), Query Frame = 1
Query:  268 LIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQ-----------VKWMKFHSNKLFS-SIVIYDEKDVLKDRDLFAMKL---INQIQLTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLEC-------SSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFF--ENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            +IID R    +   HI+ A++ +C+ K+  RR Q            +  K    ++FS  I++YDE      R + +  L   +  ++       VL GG S FK   +    +  +  Q+  E     +           ++ D+    ++ I+P FL+LGNE DA+D   ++   I  ++NVT+H+P +   + +F Y R+PA+DS+KQNL QYF+EAF  IE+  +    + IHC AGVSRS+TIV+ YLMK   + + +  K+V+  RPI  PNLNF+GQL
Sbjct:  173 VIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHE-NLCDNSLQLQECREVGGGASAASSLLPQPIPTTPDIENAELTPILP-FLFLGNEQDAQDLDTMQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQL 455          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Human
Match: DUSP1 (dual specificity phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:3064])

HSP 1 Score: 128.642 bits (322), Expect = 3.689e-33
Identity = 92/298 (30.87%), Postives = 149/298 (50.00%), Query Frame = 1
Query:  232 LIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKFH-------SNKLFS----SIVIYDEKDVLKD---RD----LFAMKLINQIQLTCSLVQVLSGGFSEFKA----YADKQYLEKKMS---SQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            L  L+  +    L++D R    F   HI  ++N   ST ++ RR++      H         +L +    ++V+ DE+    D   RD    L A  L  + +   + V  L GG+  F A       KQ     +S   S  + + A S     CS+    +    EI+P FLYLG+   A  K  L    IT ++NV+++ P  FE  ++Y  IP  D+ K ++S +F+EA + I+ ++   GR+F+HC AG+SRS+TI + YLM+T  + + E  ++V++ R I  PN +F+GQL
Sbjct:   13 LRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFST-IVRRRAKGAMGLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREAR--AAQVFFLKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCS-SCSTPLYDQGGPVEILP-FLYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEAIDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQL 305          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Human
Match: DUSP16 (dual specificity phosphatase 16 [Source:HGNC Symbol;Acc:HGNC:17909])

HSP 1 Score: 129.028 bits (323), Expect = 5.476e-32
Identity = 94/296 (31.76%), Postives = 149/296 (50.34%), Query Frame = 1
Query:  232 LIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQ-----VKWMKFHSNK------LFSSIVIYDE--KDVLK-DRDLFAMKLINQIQLTCSLVQVLSGGFSEFKAY-----ADKQYLEKKMSSQKILEYA-ASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVP---FFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            L+ L+++ T+  L+ID R    +   HI  A+N +CS KLM RR Q     +  +  HS K          +V+YD+  +DV     D F   L+ +++ + + V +L+GGF+EF          K  L     SQ  L  A   PTR               I+P  LYLG + D  +K  +++  I  ++N ++  P   F  E+ F   R+P +DS  + +  + D++ + IE  +  NG + +HC AG+SRS+TI + Y+MK   + + E  ++V+E RP   PN NFLGQL
Sbjct:   15 LVALLESGTEKVLLIDSRPFVEYNTSHILEAININCS-KLMKRRLQQDKVLITELIQHSAKHKVDIDCSQKVVVYDQSSQDVASLSSDCFLTVLLGKLEKSFNSVHLLAGGFAEFSRCFPGLCEGKSTLVPTCISQPCLPVANIGPTR---------------ILPN-LYLGCQRDVLNKELMQQNGIGYVLNASNTCPKPDFIPESHF--LRVPVNDSFCEKILPWLDKSVDFIEKAKASNGCVLVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTISPNFNFLGQL 291          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Human
Match: DUSP16 (dual specificity phosphatase 16 [Source:HGNC Symbol;Acc:HGNC:17909])

HSP 1 Score: 129.028 bits (323), Expect = 5.476e-32
Identity = 94/296 (31.76%), Postives = 149/296 (50.34%), Query Frame = 1
Query:  232 LIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQ-----VKWMKFHSNK------LFSSIVIYDE--KDVLK-DRDLFAMKLINQIQLTCSLVQVLSGGFSEFKAY-----ADKQYLEKKMSSQKILEYA-ASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVP---FFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            L+ L+++ T+  L+ID R    +   HI  A+N +CS KLM RR Q     +  +  HS K          +V+YD+  +DV     D F   L+ +++ + + V +L+GGF+EF          K  L     SQ  L  A   PTR               I+P  LYLG + D  +K  +++  I  ++N ++  P   F  E+ F   R+P +DS  + +  + D++ + IE  +  NG + +HC AG+SRS+TI + Y+MK   + + E  ++V+E RP   PN NFLGQL
Sbjct:   15 LVALLESGTEKVLLIDSRPFVEYNTSHILEAININCS-KLMKRRLQQDKVLITELIQHSAKHKVDIDCSQKVVVYDQSSQDVASLSSDCFLTVLLGKLEKSFNSVHLLAGGFAEFSRCFPGLCEGKSTLVPTCISQPCLPVANIGPTR---------------ILPN-LYLGCQRDVLNKELMQQNGIGYVLNASNTCPKPDFIPESHF--LRVPVNDSFCEKILPWLDKSVDFIEKAKASNGCVLVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTISPNFNFLGQL 291          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Human
Match: DUSP4 (dual specificity phosphatase 4 [Source:HGNC Symbol;Acc:HGNC:3070])

HSP 1 Score: 119.013 bits (297), Expect = 2.077e-29
Identity = 74/230 (32.17%), Postives = 123/230 (53.48%), Query Frame = 1
Query:  394 NKLFSSIVIYDEKDVLKD--RDLFAMKLINQI---QLTCSLVQVLSGGFSEFKA-YADKQYLEKKMSS--QKILEYAASPTRLECSSEDVM---KTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            + L+S++++YDE+    +  R+   + L+ Q        + + +L GG+  F + Y +     K +++    +   A  P  L CSS       +    EI+P FLYLG+   A  +  L    IT ++NV+S  P  FE  ++Y  IP  D+ K ++S +F EA   I+ V+   GR+ +HC AG+SRS+TI + YLM  K + + E  ++V++ R I  PN +F+GQL
Sbjct:   99 SGLYSAVIVYDERSPRAESLREDSTVSLVVQALRRNAERTDICLLKGGYERFSSEYPEFCSKTKALAAIPPPVPPSATEPLDLGCSSCGTPLHDQGGPVEILP-FLYLGSAYHAARRDMLDALGITALLNVSSDCPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLMMKKRVRLEEAFEFVKQRRSIISPNFSFMGQL 327          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 110.538 bits (275), Expect = 4.021e-26
Identity = 93/324 (28.70%), Postives = 151/324 (46.60%), Query Frame = 1
Query:  181 LKNSMKISNISHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMN--FSCSTKLMSRR------------SQVKWMKFHSNKLFSS--IVIYDEKDVLKDRDLFAMKLINQIQLTCSL----------------VQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVP--FFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            LKN M + +   IS   L  LI    D  L++D RG   +   H+RH+MN  FS   KL+ RR             Q+        K+     +V+Y E+D  +  +   +   N  + T  +                V VL GGF +F     +QY +   SS+ +     S ++  C S+      ++ I P  +YLG+++D+ D+  L    I+ ++N++   P     +    + RIP +DS ++ LS YF  A+  +E  R+   +  IHC AG+SRS T+ + Y+M+   +   +  +YV+E RP   PN NF+GQL
Sbjct:    2 LKN-MTVLDTVTISTCGLAALIREAPDTTLVVDCRGFTEYNESHVRHSMNAFFS---KLIRRRLFENKLDDNCLIHQLMSCSSGCTKMDEKLDLVLYAEEDKPRG-NKRRIASCNAPESTAKIMRVLRERLEDTDKFRSVMVLEGGFKQFA----QQYPQLCESSEGMTRLPQSLSQ-PCLSQPT-GDGITLITPN-IYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDKNFMRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYMKMGSDDAYRYVKERRPSISPNFNFMGQL 313          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 110.538 bits (275), Expect = 4.021e-26
Identity = 93/324 (28.70%), Postives = 151/324 (46.60%), Query Frame = 1
Query:  181 LKNSMKISNISHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMN--FSCSTKLMSRR------------SQVKWMKFHSNKLFSS--IVIYDEKDVLKDRDLFAMKLINQIQLTCSL----------------VQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVP--FFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            LKN M + +   IS   L  LI    D  L++D RG   +   H+RH+MN  FS   KL+ RR             Q+        K+     +V+Y E+D  +  +   +   N  + T  +                V VL GGF +F     +QY +   SS+ +     S ++  C S+      ++ I P  +YLG+++D+ D+  L    I+ ++N++   P     +    + RIP +DS ++ LS YF  A+  +E  R+   +  IHC AG+SRS T+ + Y+M+   +   +  +YV+E RP   PN NF+GQL
Sbjct:    2 LKN-MTVLDTVTISTCGLAALIREAPDTTLVVDCRGFTEYNESHVRHSMNAFFS---KLIRRRLFENKLDDNCLIHQLMSCSSGCTKMDEKLDLVLYAEEDKPRG-NKRRIASCNAPESTAKIMRVLRERLEDTDKFRSVMVLEGGFKQFA----QQYPQLCESSEGMTRLPQSLSQ-PCLSQPT-GDGITLITPN-IYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDKNFMRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYMKMGSDDAYRYVKERRPSISPNFNFMGQL 313          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 109.383 bits (272), Expect = 8.193e-26
Identity = 90/320 (28.12%), Postives = 148/320 (46.25%), Query Frame = 1
Query:  193 MKISNISHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMN--FSCSTKLMSRR------------SQVKWMKFHSNKLFSS--IVIYDEKDVLKDRDLFAMKLINQIQLTCSL----------------VQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVP--FFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            M + +   IS   L  LI    D  L++D RG   +   H+RH+MN  FS   KL+ RR             Q+        K+     +V+Y E+D  +  +   +   N  + T  +                V VL GGF +F     +QY +   SS+ +     S ++  C S+      ++ I P  +YLG+++D+ D+  L    I+ ++N++   P     +    + RIP +DS ++ LS YF  A+  +E  R+   +  IHC AG+SRS T+ + Y+M+   +   +  +YV+E RP   PN NF+GQL
Sbjct:    1 MTVLDTVTISTCGLAALIREAPDTTLVVDCRGFTEYNESHVRHSMNAFFS---KLIRRRLFENKLDDNCLIHQLMSCSSGCTKMDEKLDLVLYAEEDKPRG-NKRRIASCNAPESTAKIMRVLRERLEDTDKFRSVMVLEGGFKQFA----QQYPQLCESSEGMTRLPQSLSQ-PCLSQPT-GDGITLITPN-IYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDKNFMRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYMKMGSDDAYRYVKERRPSISPNFNFMGQL 309          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 109.383 bits (272), Expect = 8.193e-26
Identity = 90/320 (28.12%), Postives = 148/320 (46.25%), Query Frame = 1
Query:  193 MKISNISHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMN--FSCSTKLMSRR------------SQVKWMKFHSNKLFSS--IVIYDEKDVLKDRDLFAMKLINQIQLTCSL----------------VQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVP--FFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            M + +   IS   L  LI    D  L++D RG   +   H+RH+MN  FS   KL+ RR             Q+        K+     +V+Y E+D  +  +   +   N  + T  +                V VL GGF +F     +QY +   SS+ +     S ++  C S+      ++ I P  +YLG+++D+ D+  L    I+ ++N++   P     +    + RIP +DS ++ LS YF  A+  +E  R+   +  IHC AG+SRS T+ + Y+M+   +   +  +YV+E RP   PN NF+GQL
Sbjct:    1 MTVLDTVTISTCGLAALIREAPDTTLVVDCRGFTEYNESHVRHSMNAFFS---KLIRRRLFENKLDDNCLIHQLMSCSSGCTKMDEKLDLVLYAEEDKPRG-NKRRIASCNAPESTAKIMRVLRERLEDTDKFRSVMVLEGGFKQFA----QQYPQLCESSEGMTRLPQSLSQ-PCLSQPT-GDGITLITPN-IYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDKNFMRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYMKMGSDDAYRYVKERRPSISPNFNFMGQL 309          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 109.383 bits (272), Expect = 8.193e-26
Identity = 90/320 (28.12%), Postives = 148/320 (46.25%), Query Frame = 1
Query:  193 MKISNISHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMN--FSCSTKLMSRR------------SQVKWMKFHSNKLFSS--IVIYDEKDVLKDRDLFAMKLINQIQLTCSL----------------VQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVP--FFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            M + +   IS   L  LI    D  L++D RG   +   H+RH+MN  FS   KL+ RR             Q+        K+     +V+Y E+D  +  +   +   N  + T  +                V VL GGF +F     +QY +   SS+ +     S ++  C S+      ++ I P  +YLG+++D+ D+  L    I+ ++N++   P     +    + RIP +DS ++ LS YF  A+  +E  R+   +  IHC AG+SRS T+ + Y+M+   +   +  +YV+E RP   PN NF+GQL
Sbjct:    1 MTVLDTVTISTCGLAALIREAPDTTLVVDCRGFTEYNESHVRHSMNAFFS---KLIRRRLFENKLDDNCLIHQLMSCSSGCTKMDEKLDLVLYAEEDKPRG-NKRRIASCNAPESTAKIMRVLRERLEDTDKFRSVMVLEGGFKQFA----QQYPQLCESSEGMTRLPQSLSQ-PCLSQPT-GDGITLITPN-IYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDKNFMRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYMKMGSDDAYRYVKERRPSISPNFNFMGQL 309          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Fly
Match: puc (gene:FBgn0243512 transcript:FBtr0339722)

HSP 1 Score: 121.324 bits (303), Expect = 8.333e-31
Identity = 65/147 (44.22%), Postives = 86/147 (58.50%), Query Frame = 1
Query:  622 CSSE---DVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFE-NIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            CSS    D+     S + P  L LGN  DA D  ++    +   +NVT   P        KY +IPASD+  QN+ QYF EA++ IED RK   R+ +HC AG+SRS+TI + Y+M+ K L +LE  K V+  RPI  PNLNF+GQL
Sbjct:   14 CSSPAVYDIETHPASPVFPHLL-LGNGRDADDPSSVGANCV---LNVTCQSPNESHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQL 156          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Fly
Match: puc (gene:FBgn0243512 transcript:FBtr0081792)

HSP 1 Score: 121.324 bits (303), Expect = 4.098e-30
Identity = 65/147 (44.22%), Postives = 86/147 (58.50%), Query Frame = 1
Query:  622 CSSE---DVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFE-NIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            CSS    D+     S + P  L LGN  DA D  ++       ++NVT   P        KY +IPASD+  QN+ QYF EA++ IED RK   R+ +HC AG+SRS+TI + Y+M+ K L +LE  K V+  RPI  PNLNF+GQL
Sbjct:  121 CSSPAVYDIETHPASPVFPHLL-LGNGRDADDPSSV---GANCVLNVTCQSPNESHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQL 263          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Fly
Match: Mkp3 (gene:FBgn0036844 transcript:FBtr0075036)

HSP 1 Score: 104.375 bits (259), Expect = 1.160e-25
Identity = 51/133 (38.35%), Postives = 79/133 (59.40%), Query Frame = 1
Query:  658 EIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFE--NIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            EIIP  L+LGN   + D  AL++  I  ++NVT  +P  F+     KY +IP +D   Q+L+ +F +A   IE+ R  +  + +HC AGVSRS T+ + YLM T+GL + +    V++ +P   PN +F+ QL
Sbjct:   47 EIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFMQQL 179          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Fly
Match: Mkp3 (gene:FBgn0036844 transcript:FBtr0333220)

HSP 1 Score: 104.375 bits (259), Expect = 1.707e-24
Identity = 51/133 (38.35%), Postives = 79/133 (59.40%), Query Frame = 1
Query:  658 EIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFE--NIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            EIIP  L+LGN   + D  AL++  I  ++NVT  +P  F+     KY +IP +D   Q+L+ +F +A   IE+ R  +  + +HC AGVSRS T+ + YLM T+GL + +    V++ +P   PN +F+ QL
Sbjct:  217 EIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFMQQL 349          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Fly
Match: Mkp3 (gene:FBgn0036844 transcript:FBtr0075035)

HSP 1 Score: 104.375 bits (259), Expect = 1.707e-24
Identity = 51/133 (38.35%), Postives = 79/133 (59.40%), Query Frame = 1
Query:  658 EIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFE--NIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            EIIP  L+LGN   + D  AL++  I  ++NVT  +P  F+     KY +IP +D   Q+L+ +F +A   IE+ R  +  + +HC AGVSRS T+ + YLM T+GL + +    V++ +P   PN +F+ QL
Sbjct:  217 EIIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFMQQL 349          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Zebrafish
Match: dusp10 (dual specificity phosphatase 10 [Source:ZFIN;Acc:ZDB-GENE-041014-271])

HSP 1 Score: 147.902 bits (372), Expect = 9.263e-40
Identity = 104/285 (36.49%), Postives = 154/285 (54.04%), Query Frame = 1
Query:  262 MDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQ-----------VKWMKFHSNKLFS-SIVIYDEKDVLKDRDLFAMKL---INQIQLTCSLVQVLSGGFSEFK-AYAD----KQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENI--FKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            + +IID R    F   HIR AM+ +CS K+  RR Q            +  K     +FS  +V+YDE  V   R   +  L   +  ++       VL GG S F+  +AD      +L++       +  + +      S+ D+    ++ ++P FLYLGNE DA+D   L+   I  ++NVT+H+P +  +I  F Y R+PA+DS+KQNL QYF+EAF  IE+  +    + IHC AGVSRS+TIV+ YLMK   + + +  K+V+  RPI  PNLNF+GQL
Sbjct:  149 VPVIIDCRPFLEFNKSHIRGAMHINCSDKISRRRLQQGKITVLDLISCRQSKDSFKGIFSKELVVYDESTVDPGRLTPSQPLHVVLESLRREGKDPIVLKGGLSGFRQTHADLCEHSLHLDEGQDGSGAMGLSGALPHSLPSTPDIENAELTAVLP-FLYLGNERDAQDLELLQRLDIGFVLNVTTHLPLYHYDIARFCYKRLPATDSNKQNLRQYFEEAFEFIEEAHQAGRGLLIHCQAGVSRSATIVIAYLMKHTWMTMTDAYKFVKSRRPIISPNLNFMGQL 432          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Zebrafish
Match: dusp4 (dual specificity phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-709])

HSP 1 Score: 140.198 bits (352), Expect = 1.387e-37
Identity = 92/314 (29.30%), Postives = 155/314 (49.36%), Query Frame = 1
Query:  208 ISHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSR-----------------RSQVKWMKFHSNKLFSSIVIYDEK----DVLKD------------RDLFAMKLINQIQLTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            +  + C  L  L+ +     L++D R    F   H+R A+N  C+T +  R                 RS++K      + L+S++++YDE+    + +KD            RD F+ +           V +L GG+  F        L+ +  S    + +   + L C++    +    EI+P FL+LG+ L A  K  L    I+ ++NV+S+ P  FE  ++Y  IP  D+ K+++S +F EA   I+ V+  NGR+ +HC AG+SRS+TI + YLMK K + + E  ++V++ R I  PN +F+GQL
Sbjct:    7 LCEMDCSVLKRLMKDDGAKCLLLDCRSFLAFSAGHLRGAVNIRCNTIVRRRAKGSVSLDQILSGDDEARSRLK------SGLYSAVILYDERSSDTNTMKDDSTITLVHNALCRDTFSTE-----------VYLLKGGYDRFSTQYPDYCLKTRTLSVSSSQSSMESSCLSCATPQHDQGGPVEILP-FLFLGSALHASKKDMLDRMGISALLNVSSNCPNHFEGDYQYKCIPVEDNHKEDISSWFIEAIEFIDSVKDSNGRVLVHCQAGISRSATICLAYLMKKKRVRLEEAFEFVKQRRSIISPNFSFMGQL 302          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Zebrafish
Match: dusp4 (dual specificity phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-709])

HSP 1 Score: 140.198 bits (352), Expect = 1.387e-37
Identity = 92/314 (29.30%), Postives = 155/314 (49.36%), Query Frame = 1
Query:  208 ISHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSR-----------------RSQVKWMKFHSNKLFSSIVIYDEK----DVLKD------------RDLFAMKLINQIQLTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            +  + C  L  L+ +     L++D R    F   H+R A+N  C+T +  R                 RS++K      + L+S++++YDE+    + +KD            RD F+ +           V +L GG+  F        L+ +  S    + +   + L C++    +    EI+P FL+LG+ L A  K  L    I+ ++NV+S+ P  FE  ++Y  IP  D+ K+++S +F EA   I+ V+  NGR+ +HC AG+SRS+TI + YLMK K + + E  ++V++ R I  PN +F+GQL
Sbjct:    7 LCEMDCSVLKRLMKDDGAKCLLLDCRSFLAFSAGHLRGAVNIRCNTIVRRRAKGSVSLDQILSGDDEARSRLK------SGLYSAVILYDERSSDTNTMKDDSTITLVHNALCRDTFSTE-----------VYLLKGGYDRFSTQYPDYCLKTRTLSVSSSQSSIESSCLSCATPQHDQGGPVEILP-FLFLGSALHASKKDMLDRMGISALLNVSSNCPNHFEGDYQYKCIPVEDNHKEDISSWFIEAIEFIDSVKDSNGRVLVHCQAGISRSATICLAYLMKKKRVRLEEAFEFVKQRRSIISPNFSFMGQL 302          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Zebrafish
Match: dusp4 (dual specificity phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-709])

HSP 1 Score: 140.198 bits (352), Expect = 1.387e-37
Identity = 92/314 (29.30%), Postives = 155/314 (49.36%), Query Frame = 1
Query:  208 ISHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSR-----------------RSQVKWMKFHSNKLFSSIVIYDEK----DVLKD------------RDLFAMKLINQIQLTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            +  + C  L  L+ +     L++D R    F   H+R A+N  C+T +  R                 RS++K      + L+S++++YDE+    + +KD            RD F+ +           V +L GG+  F        L+ +  S    + +   + L C++    +    EI+P FL+LG+ L A  K  L    I+ ++NV+S+ P  FE  ++Y  IP  D+ K+++S +F EA   I+ V+  NGR+ +HC AG+SRS+TI + YLMK K + + E  ++V++ R I  PN +F+GQL
Sbjct:    7 LCEMDCSVLKRLMKDDGAKCLLLDCRSFLAFSAGHLRGAVNIRCNTIVRRRAKGSVSLDQILSGDDEARSRLK------SGLYSAVILYDERSSDTNTMKDDSTITLVHNALCRDTFSTE-----------VYLLKGGYDRFSTQYPDYCLKTRTLSVSSSQSSMESSCLSCATPQHDQGGPVEILP-FLFLGSALHASKKDMLDRMGISALLNVSSNCPNHFEGDYQYKCIPVEDNHKEDISSWFIEAIEFIDSVKDSNGRVLVHCQAGISRSATICLAYLMKKKRVRLEEAFEFVKQRRSIISPNFSFMGQL 302          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Zebrafish
Match: dusp1 (dual specificity phosphatase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2018])

HSP 1 Score: 136.732 bits (343), Expect = 2.121e-36
Identity = 102/312 (32.69%), Postives = 159/312 (50.96%), Query Frame = 1
Query:  190 SMKISNISHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKFH-------SNKLFS----SIVIYDE-----KDVLKDRDL-FAMKLINQIQLTCSLVQVLSGGFSEFKA-YADK-------QYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            +M I  +  I    L ++++      L++D R    F + HI  + N   ST ++ RR++      H        N+L S    S+V  D+      +V KD  L  A+  + + Q   S V +L GGF  F A + +K       Q L   +SS      A S     C++    +    EI+P FLYLG+   A  K  L    IT ++NV+S+ P  FE+ ++Y  IP  D+ K N+S +F+EA   I+ VR + GR+F+HC AG+SRS+TI + YLM+T  + + E  ++V++ R I  PN +F+GQL
Sbjct:    9 TMVIMEVPTIDSASLRDMLEGDDPDCLVLDCRSFFSFSVSHISGSSNVRFST-IVRRRARGGLGLEHIVPNEDTRNRLLSGEYQSVVFLDDHSLEMGEVKKDGTLMLAVNALCRKQCGAS-VYLLKGGFDTFSAEFPEKCTKTVPPQGLSLPLSSNCHSNTADSSCN-TCTTPLYDQGGPVEILP-FLYLGSAYHASRKDMLDMLGITALINVSSNCPNHFEDHYQYKSIPVEDNHKANISSWFNEAIEFIDSVRNKGGRVFVHCQAGISRSATICLAYLMRTNRVKLEEAFEFVKQRRSIISPNFSFMGQL 316          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Xenopus
Match: npc1l1 (NPC1 like 1 [Source:Xenbase;Acc:XB-GENE-964011])

HSP 1 Score: 146.747 bits (369), Expect = 4.047e-39
Identity = 79/188 (42.02%), Postives = 116/188 (61.70%), Query Frame = 1
Query:  508 VLSGGFSEFKAYADK---QYLEKKMSSQKILEYAASPTRLEC--SSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFF--ENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            VL GG S FK   +      L+ +  S      A S T  +   ++ D+    ++ I+P FLYLGNE DA+D   ++ + I+ I+NVT+H+P +   + +F Y R+PA+DS+KQNL QYF+EAF  I++  +    + IHC AGVSRS+TIV+ YLMK   + + +  K+V+  RPI  PNLNF+GQL
Sbjct:  251 VLKGGLSSFKQNHESLCDNSLQLQDCSDGGGASAVSITLPQSIPTTPDIENAELTPILP-FLYLGNEHDAQDLETMQTRNISYIVNVTTHLPLYHYEKGVFNYKRLPATDSNKQNLRQYFEEAFEFIDEAHQCGKALLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQL 437          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Xenopus
Match: pcsk1 (proprotein convertase subtilisin/kexin type 1 [Source:Xenbase;Acc:XB-GENE-983314])

HSP 1 Score: 129.413 bits (324), Expect = 2.218e-33
Identity = 76/227 (33.48%), Postives = 125/227 (55.07%), Query Frame = 1
Query:  394 NKLFSSIVIYDEKDVLKD--RDLFAMKLINQI---QLTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDVM---KTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            + L+S+I++YDE+    D  R+   + L+ Q        + + +L GG+  F +   +   + K  +   L  +  P  + CSS       +    EI+P FLYLG+   A  +  L   +IT +MNV++  P  FE  ++Y  IP  D+ K ++S +F EA   I+ V+ +NGR+ +HC AG+SRS+TI + YLM TK + + E  ++V++ R I  PN +F+GQL
Sbjct:   87 SGLYSAIIVYDERSPRADALREDSTVYLVVQALRRDTDSTDICLLKGGYERFHSEYPEFCAKTKSINSISLPASIEPAGIGCSSCTTPLHDQGGPVEILP-FLYLGSAYHAARRDMLDALRITALMNVSADCPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDSVKDQNGRVLVHCQAGISRSATICLAYLMMTKRVKLEEAFEFVKQRRSIISPNFSFMGQL 312          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Xenopus
Match: pcsk1 (proprotein convertase subtilisin/kexin type 1 [Source:Xenbase;Acc:XB-GENE-983314])

HSP 1 Score: 129.413 bits (324), Expect = 2.516e-33
Identity = 76/227 (33.48%), Postives = 125/227 (55.07%), Query Frame = 1
Query:  394 NKLFSSIVIYDEKDVLKD--RDLFAMKLINQI---QLTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDVM---KTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            + L+S+I++YDE+    D  R+   + L+ Q        + + +L GG+  F +   +   + K  +   L  +  P  + CSS       +    EI+P FLYLG+   A  +  L   +IT +MNV++  P  FE  ++Y  IP  D+ K ++S +F EA   I+ V+ +NGR+ +HC AG+SRS+TI + YLM TK + + E  ++V++ R I  PN +F+GQL
Sbjct:   99 SGLYSAIIVYDERSPRADALREDSTVYLVVQALRRDTDSTDICLLKGGYERFHSEYPEFCAKTKSINSISLPASIEPAGIGCSSCTTPLHDQGGPVEILP-FLYLGSAYHAARRDMLDALRITALMNVSADCPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDSVKDQNGRVLVHCQAGISRSATICLAYLMMTKRVKLEEAFEFVKQRRSIISPNFSFMGQL 324          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Xenopus
Match: ibtk (inhibitor of Bruton tyrosine kinase [Source:Xenbase;Acc:XB-GENE-5755983])

HSP 1 Score: 124.405 bits (311), Expect = 1.218e-31
Identity = 76/233 (32.62%), Postives = 126/233 (54.08%), Query Frame = 1
Query:  400 LFSSIVIYDEK----DVLKDRDLFAMKLINQIQLTC-----SLVQVLSGGFSEFKA----YADKQYLEKKMS---SQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            ++ ++V+ DE+    D+L+ +D   M  +N +   C     S +  L GG+  F +    + +K      +S   S   +  +A      C +    +    EI+P FLYLG+   A  K  L    IT ++NV+++ P  FE  F+Y  IP  DS K ++S +F+EA + I+ V+   GR+F+HC AG+SRS+TI + YLM+T  + + E  ++V++ R I  PN +F+GQL
Sbjct:   80 MYEAVVLLDERTSELDMLR-KDSTMMLAVNAL---CRDSRGSSIYFLKGGYETFSSQCPEFCNKSSPPVCLSLPLSTNNVPGSADSNCTPCGTPLYDQGGPVEILP-FLYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHFQYKSIPVEDSHKADISSWFNEAIDFIDSVKNSGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQL 307          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Xenopus
Match: pnpt1 (polyribonucleotide nucleotidyltransferase 1 [Source:Xenbase;Acc:XB-GENE-967251])

HSP 1 Score: 125.946 bits (315), Expect = 4.424e-31
Identity = 93/293 (31.74%), Postives = 145/293 (49.49%), Query Frame = 1
Query:  232 LIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKF-----HSNKL-------FSSIVIYDEKDV---LKDRDLFAMKLINQIQLTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAAS--PTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVP---FFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            L+  ++  T+  L+ID R    F   HI  A+N +CS KLM RR Q   ++      HS K           +V+YD+  V       + F   L+ ++      VQ+LSGGFSEF A               + E  AS  PT +      V     + I+P  LYLG + D  +K  +++ +I  ++N ++  P   F  ++ F   RIP +DS  + +  + D++ + IE  +  N R+ +HC AG+SRS+TI + Y+MK   + + E  ++V+E RP   PN NFLGQL
Sbjct:   16 LVTWMEGGTEKVLLIDSRPFVEFNTAHILEAININCS-KLMKRRLQQDKVQIVELIQHSAKQTVELDCQAQQVVVYDQSSVDVSALPAECFLSVLLGKLDKLFHNVQLLSGGFSEFSACFPG-----------LCEGKASMVPTCISQPCLPVSSVGPTRILP-HLYLGCQRDVLNKELMQQNEIGYVLNASNTCPKPDFISDSHF--LRIPVNDSFCEKILPWLDKSVDFIEKAKASNDRVLVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTISPNFNFLGQL 293          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Mouse
Match: Dusp10 (dual specificity phosphatase 10 [Source:MGI Symbol;Acc:MGI:1927070])

HSP 1 Score: 136.346 bits (342), Expect = 2.437e-35
Identity = 96/285 (33.68%), Postives = 149/285 (52.28%), Query Frame = 1
Query:  268 LIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQ-----------VKWMKFHSNKLFS-SIVIYDEKDVLKDRDLFAMKL---INQIQLTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLEC-------SSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFF--ENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            +IID R    +   HI+ A++ +C+ K+  RR Q            +  K    ++FS  I++YDE      R   +  L   +  ++       VL GG S FK        +  +  Q+  E     +           ++ D+    ++ I+P FL+LGNE DA+D   ++   I  ++NVT+H+P +   + +F Y R+PA+DS+KQNL QYF+EAF  IE+  +    + IHC AGVSRS+TIV+ YLMK   + + +  K+V+  RPI  PNLNF+GQL
Sbjct:  174 VIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVTPSQPLHIVLESLKREGKEPLVLKGGLSSFKQN-HGNLCDNSLQLQECREVGGGASAASSMLPQSVPTTPDIENAELTPILP-FLFLGNEQDAQDLDTMQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQL 456          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Mouse
Match: Dusp1 (dual specificity phosphatase 1 [Source:MGI Symbol;Acc:MGI:105120])

HSP 1 Score: 124.405 bits (311), Expect = 8.643e-32
Identity = 90/286 (31.47%), Postives = 144/286 (50.35%), Query Frame = 1
Query:  268 LIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKFH-------SNKLFS----SIVIYDEKDVLKD---RD----LFAMKLINQIQLTCSLVQVLSGGFSEFKA----YADKQYLEKKMS---SQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            L++D R    F   HI  ++N   ST ++ RR++      H         +L +    ++V+ DE+    D   RD    L A  L  + + T   V  L GG+  F A       KQ     +S   S  + + A S     CS+    +    EI+  FLYLG+   A  K  L    IT ++NV+++ P  FE  ++Y  IP  D+ K ++S +F+EA + I+ ++   GR+F+HC AG+SRS+TI + YLM+T  + + E  ++V++ R I  PN +F+GQL
Sbjct:   25 LLLDCRSFFAFNAGHIAGSVNVRFST-IVRRRAKGAMGLEHIVPNAELRGRLLAGAYHAVVLLDERSASLDGAKRDGTLALAAGALCREARST--QVFFLQGGYEAFSASCPELCSKQSTPTGLSLPLSTSVPDSAESGCS-SCSTPLYDQGGPVEIL-SFLYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEAIDFIDSIKDAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQL 305          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Mouse
Match: Dusp16 (dual specificity phosphatase 16 [Source:MGI Symbol;Acc:MGI:1917936])

HSP 1 Score: 127.102 bits (318), Expect = 1.545e-31
Identity = 94/296 (31.76%), Postives = 149/296 (50.34%), Query Frame = 1
Query:  232 LIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQ-----VKWMKFHSNK------LFSSIVIYDE--KDVLK-DRDLFAMKLINQIQLTCSLVQVLSGGFSEFKAY-----ADKQYLEKKMSSQKILEYA-ASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVP---FFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            L+ L+++ T+  L+ID R    +   HI  A+N +CS KLM RR Q     +  +  HS K          +V+YD+  +DV     D F   L+ +++ + + V +L+GGF+EF          K  L     SQ  L  A   PTR               I+P  LYLG + D  +K  +++  I  ++N ++  P   F  E+ F   R+P +DS  + +  + D++ + IE  +  NG + IHC AG+SRS+TI + Y+MK   + + E  ++V+E RP   PN NF+GQL
Sbjct:   15 LVALLESGTEKVLLIDSRPFVEYNTSHILEAININCS-KLMKRRLQQDKVLITELIQHSAKHKVDIDCNQKVVVYDQSSQDVGSLSSDCFLTVLLGKLERSFNSVHLLAGGFAEFSRCFPGLCEGKSTLVPTCISQPCLPVANIGPTR---------------ILPN-LYLGCQRDVLNKDLMQQNGIGYVLNASNTCPKPDFIPESHF--LRVPVNDSFCEKILPWLDKSVDFIEKAKASNGCVLIHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTISPNFNFMGQL 291          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Mouse
Match: Dusp1 (dual specificity phosphatase 1 [Source:MGI Symbol;Acc:MGI:105120])

HSP 1 Score: 118.242 bits (295), Expect = 2.941e-30
Identity = 68/195 (34.87%), Postives = 106/195 (54.36%), Query Frame = 1
Query:  487 LTCSLVQVLSGGFSEFKA----YADKQYLEKKMS---SQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            LT  L     GG+  F A       KQ     +S   S  + + A S     CS+    +    EI+  FLYLG+   A  K  L    IT ++NV+++ P  FE  ++Y  IP  D+ K ++S +F+EA + I+ ++   GR+F+HC AG+SRS+TI + YLM+T  + + E  ++V++ R I  PN +F+GQL
Sbjct:   22 LTHRLPSFREGGYEAFSASCPELCSKQSTPTGLSLPLSTSVPDSAESGCS-SCSTPLYDQGGPVEIL-SFLYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEAIDFIDSIKDAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQL 214          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Mouse
Match: Dusp4 (dual specificity phosphatase 4 [Source:MGI Symbol;Acc:MGI:2442191])

HSP 1 Score: 117.472 bits (293), Expect = 4.623e-29
Identity = 85/289 (29.41%), Postives = 143/289 (49.48%), Query Frame = 1
Query:  268 LIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKW-------------MKFHSNKLFSSIVIYDEKDVLKD--RDLFAMKLINQI---QLTCSLVQVLSGGFSEFKAYADKQYLE--KKMSSQKILEYAASPTR-----LECSSEDVM---KTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            L++D R        +IR ++N  C+T ++ RR++                 +  S  L+S++++YDE+    +  R+   + L+ Q        + + +L GG+  F +    +Y E   K  +   +     P+      L CSS       +    EI+P FLYLG+   A  +  L    IT ++NV+S  P  FE  ++Y  IP  D+ K ++S +F EA   I+ V+   GR+ +HC AG+SRS+TI + YLM  K + + E  ++V++ R I  PN +F+GQL
Sbjct:   50 LLLDCRPFLAHSAGYIRGSVNVRCNT-IVRRRAKGSVSLEQILPAEEEVRARLRSG-LYSAVIVYDERSPRAESLREDSTVSLVVQALRRNAERTDICLLKGGYERFSS----EYPEFCSKTKALAAIPPPVPPSTNESLDLGCSSCGTPLHDQGGPVEILP-FLYLGSAYHAARRDMLDALGITALLNVSSDCPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLMMKKRVRLEEAFEFVKQRRSIISPNFSFMGQL 331          
BLAST of Dual specificity protein phosphatase 10 vs. UniProt/SwissProt
Match: sp|Q0IID7|DUS10_BOVIN (Dual specificity protein phosphatase 10 OS=Bos taurus OX=9913 GN=DUSP10 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.477e-35
Identity = 97/285 (34.04%), Postives = 151/285 (52.98%), Query Frame = 1
Query:  268 LIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQ-----------VKWMKFHSNKLFS-SIVIYDEKDVLKDRDLFAMKL---INQIQLTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLEC-------SSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFF--ENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            +IID R    +   HI+ A++ +C+ K+  RR Q            +  K    ++FS  I++YDE      R + +  L   +  ++       VL GG S FK   +    +  +  Q+  E     +           S+ D+    ++ I+P FL+LGNE DA+D   ++   I  ++NVT+H+P +   + +F Y R+PA+DS+KQNL QYF+EAF  IE+  +    + IHC AGVSRS+TIV+ YLMK   + + +  K+V+  RPI  PNLNF+GQL
Sbjct:  173 VIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVVPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHE-NLCDNSLQLQECREVGGGASAASSMLPQSIPSTPDIENAELTPILP-FLFLGNEQDAQDLETMQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQL 455          
BLAST of Dual specificity protein phosphatase 10 vs. UniProt/SwissProt
Match: sp|Q9Y6W6|DUS10_HUMAN (Dual specificity protein phosphatase 10 OS=Homo sapiens OX=9606 GN=DUSP10 PE=1 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 3.766e-35
Identity = 96/285 (33.68%), Postives = 151/285 (52.98%), Query Frame = 1
Query:  268 LIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQ-----------VKWMKFHSNKLFS-SIVIYDEKDVLKDRDLFAMKL---INQIQLTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLEC-------SSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFF--ENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            +IID R    +   HI+ A++ +C+ K+  RR Q            +  K    ++FS  I++YDE      R + +  L   +  ++       VL GG S FK   +    +  +  Q+  E     +           ++ D+    ++ I+P FL+LGNE DA+D   ++   I  ++NVT+H+P +   + +F Y R+PA+DS+KQNL QYF+EAF  IE+  +    + IHC AGVSRS+TIV+ YLMK   + + +  K+V+  RPI  PNLNF+GQL
Sbjct:  173 VIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHE-NLCDNSLQLQECREVGGGASAASSLLPQPIPTTPDIENAELTPILP-FLFLGNEQDAQDLDTMQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQL 455          
BLAST of Dual specificity protein phosphatase 10 vs. UniProt/SwissProt
Match: sp|Q9ESS0|DUS10_MOUSE (Dual specificity protein phosphatase 10 OS=Mus musculus OX=10090 GN=Dusp10 PE=2 SV=2)

HSP 1 Score: 136.346 bits (342), Expect = 1.704e-34
Identity = 96/285 (33.68%), Postives = 149/285 (52.28%), Query Frame = 1
Query:  268 LIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQ-----------VKWMKFHSNKLFS-SIVIYDEKDVLKDRDLFAMKL---INQIQLTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLEC-------SSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFF--ENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            +IID R    +   HI+ A++ +C+ K+  RR Q            +  K    ++FS  I++YDE      R   +  L   +  ++       VL GG S FK        +  +  Q+  E     +           ++ D+    ++ I+P FL+LGNE DA+D   ++   I  ++NVT+H+P +   + +F Y R+PA+DS+KQNL QYF+EAF  IE+  +    + IHC AGVSRS+TIV+ YLMK   + + +  K+V+  RPI  PNLNF+GQL
Sbjct:  174 VIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVTPSQPLHIVLESLKREGKEPLVLKGGLSSFKQN-HGNLCDNSLQLQECREVGGGASAASSMLPQSVPTTPDIENAELTPILP-FLFLGNEQDAQDLDTMQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQL 456          
BLAST of Dual specificity protein phosphatase 10 vs. UniProt/SwissProt
Match: sp|P28562|DUS1_HUMAN (Dual specificity protein phosphatase 1 OS=Homo sapiens OX=9606 GN=DUSP1 PE=1 SV=3)

HSP 1 Score: 128.642 bits (322), Expect = 1.772e-32
Identity = 92/298 (30.87%), Postives = 149/298 (50.00%), Query Frame = 1
Query:  232 LIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKFH-------SNKLFS----SIVIYDEKDVLKD---RD----LFAMKLINQIQLTCSLVQVLSGGFSEFKA----YADKQYLEKKMS---SQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            L  L+  +    L++D R    F   HI  ++N   ST ++ RR++      H         +L +    ++V+ DE+    D   RD    L A  L  + +   + V  L GG+  F A       KQ     +S   S  + + A S     CS+    +    EI+P FLYLG+   A  K  L    IT ++NV+++ P  FE  ++Y  IP  D+ K ++S +F+EA + I+ ++   GR+F+HC AG+SRS+TI + YLM+T  + + E  ++V++ R I  PN +F+GQL
Sbjct:   13 LRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFST-IVRRRAKGAMGLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREAR--AAQVFFLKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCS-SCSTPLYDQGGPVEILP-FLYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEAIDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQL 305          
BLAST of Dual specificity protein phosphatase 10 vs. UniProt/SwissProt
Match: sp|Q90W58|DUS1B_XENLA (Dual specificity protein phosphatase 1-B OS=Xenopus laevis OX=8355 GN=dusp1-b PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.199e-31
Identity = 75/232 (32.33%), Postives = 124/232 (53.45%), Query Frame = 1
Query:  400 LFSSIVIYDEK----DVLKDRDLFAMKLINQIQ--LTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMS---------EIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            ++ ++V+ DE+    D+L+ +D   M  +N +      S +  L GG+  F +   +     K S    L    SP  +  S++       +         EI+P FLYLG+   A  K  L    IT ++NV+++ P  FE  F+Y  IP  DS K ++S +F+EA + I+ ++   GR+F+HC AG+SRS+TI + YLM+T  + + E  ++V++ R I  PN +F+GQL
Sbjct:   80 MYEAVVLLDERTSELDMLR-KDSTMMLAVNALSRDPRGSRIYFLKGGYETFSSQCPE--FCNKNSPPVALSLPLSPNNVPGSADSNCTPCGTPLYDQGGPVEILP-FLYLGSAYHASRKDMLEALGITALINVSANCPNHFEGHFQYKSIPVEDSHKADISSWFNEAIDFIDSIKTCGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQL 307          
BLAST of Dual specificity protein phosphatase 10 vs. TrEMBL
Match: A0A1S3JB87 (dual specificity protein phosphatase 10 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106171757 PE=3 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 2.407e-45
Identity = 117/316 (37.03%), Postives = 172/316 (54.43%), Query Frame = 1
Query:  178 DLKNS-MKISNISHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKFHSNKLFSS--------------IVIYDEK--DVLKDRDLFAMKLIN-QIQLTCSLVQVLSGGFSEFKA-YADKQYLEKKMSSQKILEYAA---SPTR--LECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFEN-IFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            D K+S M +SN+  IS  EL   +  K    +++D R    F M HI+ A+N +C+ +    + Q++  +     L SS              + IYDE   D+ K      + L+   +      V +L GG +EFK+ Y D    +K + SQ   + +A   SPT   +     D+  TT + I+P FLYLGNE DA D   L++  IT ++NVTSH+P+  E+   KY R+PASDS +QNL+QYF EAF+ IE+ R     + +HC AGVSRS+TI + YL+K   + +++  KYV+  R I  PN NF+GQL
Sbjct:   64 DTKSSRMNLSNVRTISPNELASKM--KRTRPMLLDCRSFLAFNMGHIQGALNVNCADRF--HKKQLQKGRIGLVDLISSSEGKEMFRRYPSKEVYIYDENTTDISKVNPSSPLHLVLLSLMKEGKRVTILKGGLTEFKSSYGD--LCDKSLKSQGTKDSSAPLHSPTTSFIHDQEVDIENTTATAILP-FLYLGNERDAADLQRLKDLNITYVLNVTSHIPYQHEHQGIKYKRLPASDSCQQNLTQYFQEAFDFIEEARNSGANVLVHCHAGVSRSATITIAYLLKHTRMVMVDAYKYVKNKRSIISPNFNFMGQL 372          
BLAST of Dual specificity protein phosphatase 10 vs. TrEMBL
Match: A0A1D1V8C6 (Uncharacterized protein OS=Ramazzottius varieornatus OX=947166 GN=RvY_09117-1 PE=3 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 2.450e-43
Identity = 105/287 (36.59%), Postives = 153/287 (53.31%), Query Frame = 1
Query:  268 LIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKF-----------HSNKLFSSIVIYDEKDVLKDRDLFAMKLINQIQLTCSLVQ-------VLSGGFSEFKAYADKQYLE-------KKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFE-NIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            L++D R    F+M HI  A+N + S +L  RR Q K   F           +  ++   +++YDE  +    D   +  ++ +QL  S ++       VL GGF++F A    QY E       K   +        SPT    +  D+ K   S+++P FLYLGNE DA D + L   K+T ++NVTSH P  +E    +Y R+PASDS +QNL+QYF EAF  I++ R  +  + IHC AGVSRS+TIV+ YLM  K + + E  + V+  R +  PN NF+GQL
Sbjct:  147 LLLDCRPEFMFRMNHIYGAVNVNISDRLTRRRLQGKVSVFDVLSTKEAKALYRKRVLREVIVYDESTM----DWTGLPPVHPLQLLLSSLRNDGKDPAVLIGGFTDFHA----QYRELCDGTVMKPAQNVPTGPLLGSPTN-SPTDIDLEKVEASQVLP-FLYLGNERDAADMNRLASLKVTHVLNVTSHSPCHYEKEGIRYKRLPASDSGQQNLAQYFKEAFEFIDEARNASCNVLIHCQAGVSRSATIVVAYLMHHKKMSMDEAYRLVKAKRSVISPNFNFMGQL 423          
BLAST of Dual specificity protein phosphatase 10 vs. TrEMBL
Match: A0A433TCQ3 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_012860 PE=4 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 3.291e-43
Identity = 113/328 (34.45%), Postives = 163/328 (49.70%), Query Frame = 1
Query:  199 ISNISHISCMELIELIDN-KTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKF---------------HSNKLFSS----------IVIYDEKDVLKDRDLFAMKLINQIQLTCSL---------VQVLSGGFSEFKAYADKQ-----YLEKKMSSQKILEYAA---SPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENI-FKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            ++ +  I+  +L  LI   K    LIIDVR  + FQ  H++ A+N  C+ +   RR Q                     H  +  S           IV+YDE   ++D    A        L   L         V VL GGF  F    D         E  + SQ++LE+ A   SPT    +  ++   T S+++P FLYLGNE DAKD   L+   I  ++NVT+HVP +++ +  +Y RIPASDS +QNL QYF+EA   I+D R+   ++ IHC AGVSRS+T+ + YL+K   + + +  K+V+  R I  PN NF+GQL
Sbjct:  415 VAKLKPIAADDLASLITGVKHKPLLIIDVRSTKAFQRDHVQGALNLCCTDRFARRRLQHGRTSVLDVLASSPREDLPDSHVPRPVSPASLRRVARLDIVVYDEHTSVRDLAGPAQHGDQGAGLRAVLSSLLREGRDVHVLDGGFKSFSVEQDSLCRGGCRGEGTLLSQRVLEHQAMLYSPTN-GVAEPEIEAATASQVLP-FLYLGNERDAKDLARLKRLNIGYVLNVTAHVPQYWDALGIRYKRIPASDSAQQNLKQYFEEAIEYIDDARQNGSKVLIHCHAGVSRSATVTIAYLLKHTRMAMADAYKFVKGKRLIISPNFNFMGQL 740          
BLAST of Dual specificity protein phosphatase 10 vs. TrEMBL
Match: A0A067R7Z7 (Dual specificity protein phosphatase 10 (Fragment) OS=Zootermopsis nevadensis OX=136037 GN=L798_09743 PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.487e-43
Identity = 100/281 (35.59%), Postives = 147/281 (52.31%), Query Frame = 1
Query:  268 LIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKFHS------------NKLFSSIVIYDEKDVLKDRDLFAMKLINQIQLTCSLVQ------VLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECS-SEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENI-FKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            L++D R    + + HIR ++N +CS +   +R Q                     + F  +V+YD  D   D D         + LT +LV+       L GG  EF     +++ E  +         + P+  +C  + D+     S ++P FLYLGN+ DA D +ALR   +T ++NVTSH+P + E     Y ++PASDS  QNL QYF+EAF+ IE+ R     + +HC AGVSRS+TI + Y+MK K L ++E  K V+  RPI  PNLNF+GQL
Sbjct:    1 LVVDCRPFIAYNVNHIRGSINVNCSDRFNRKRLQQGKATLADLATTREGKDLLKKRTFKEVVVYD--DCTTDFDRLPTSHPLFLVLT-TLVEDNRDPAFLLGGHKEFHRR-HREFCEDTLLPPSGRPLLSCPSPSDCVVTPDIDSHPASRVLP-FLYLGNQHDAADLNALRSLGVTRVLNVTSHLPGYHEACGITYKQLPASDSGHQNLKQYFEEAFDFIEEARNSGASVLVHCQAGVSRSATIAIAYIMKHKLLTMVEAYKLVKNARPIISPNLNFMGQL 276          
BLAST of Dual specificity protein phosphatase 10 vs. TrEMBL
Match: U4UP11 (Uncharacterized protein (Fragment) OS=Dendroctonus ponderosae OX=77166 GN=D910_11519 PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 7.396e-43
Identity = 102/280 (36.43%), Postives = 144/280 (51.43%), Query Frame = 1
Query:  268 LIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKFH------------SNKLFSSIVIYDEKDVLKDRDLFAMKLINQIQLTCSLVQ------VLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFEN-IFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            +++D R    + M HI  A+N +CS +   RR Q   +                 + F  ++IYD+    KDR      L+    +  SLV+      +L GG  EF     K++ E  ++ Q +     SP+    S  DV     S+++P FLYLGN  DA D   L     T ++NVTS +P + E     Y +IPA+DS  QNL QYF+EAF  IE  R    R+ +HC AG+SRS+TI + Y+MK K + + E  K V+E RPI  PNLNF+GQL
Sbjct:   53 ILLDCRPFMSYNMNHISGAINLNCSDRFNRRRLQQGKVSLADLATTREGKEVLKKRSFKEVIIYDDSTTGKDRITLGHPLL---LVMVSLVEDQKEPSLLIGGHREFHK-KHKEFCEHTLT-QSLTSRGISPSASCPSLADVDSYPASKVLP-FLYLGNSKDAADLSCLEGLGTTCVLNVTSQLPGYHEERGITYKQIPATDSGHQNLKQYFEEAFEFIEQARLNGSRVLVHCQAGISRSATIAIAYIMKYKQMSMWEAYKKVKEVRPIISPNLNFMGQL 326          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Cavefish
Match: taf1a (TATA-box binding protein associated factor, RNA polymerase I subunit A [Source:NCBI gene;Acc:103041075])

HSP 1 Score: 149.443 bits (376), Expect = 2.727e-40
Identity = 107/287 (37.28%), Postives = 156/287 (54.36%), Query Frame = 1
Query:  262 MDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQ-----------VKWMKFHSNKLFS-SIVIYDEKDVLKDRDLFAMKL---INQIQLTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAAS-------PTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFE--NIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            + +IID R    F   HIR A++ +CS K+  RR Q            +  K     +FS  IV+YDE  V   R   +  L   +  ++       VL GG S F+    ++  E  +  Q+  +  AS       P  L  S+ D+    ++ I+P FL+LGNE DA+D   ++   I  I+NVT+H+P +     +FKY R+PA+DS+KQNL QYF+EAF  IE+  +    + IHC AGVSRS+TIV+ YLMK   + + ++ K+V+  RPI  PNLNF+GQL
Sbjct:  168 VPVIIDCRPFTDFNKSHIRGAVHINCSDKISRRRLQQGKITVLDLISCRQSKDSFRGIFSKEIVVYDESTVDPGRLSLSQPLHVVLESLRREGKDPVVLRGGLSSFRQ-GHEELCEHSLHLQEGQDPGASVGLSGALPHSLP-STPDIENAEITPILP-FLFLGNEQDAQDHDLMQRLNIGYILNVTTHLPLYHYSLGLFKYKRLPATDSNKQNLRQYFEEAFEFIEEAHQAGRGLLIHCQAGVSRSATIVIAYLMKHTWMTMTDSYKFVKTRRPIISPNLNFMGQL 451          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Cavefish
Match: dusp4 (dual specificity phosphatase 4 [Source:NCBI gene;Acc:103029669])

HSP 1 Score: 135.961 bits (341), Expect = 3.753e-36
Identity = 87/281 (30.96%), Postives = 147/281 (52.31%), Query Frame = 1
Query:  268 LIIDVRGNRFFQMQHIRHAMNFSCSTKLMSR-RSQVKWMKFHSN----------KLFSSIVIYDEKDVLKDRDLFAMKLINQIQLTCSL---------VQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            L++D R    F   HIR A+N   +T +  R +  V   +  S            L+S++++YDE+     +D  A+K  + + L  +          V +L GG+  F +    QY +  + S + L   ++ +   C +    +    EI+P FL+LG+ L A  K  L    I+ ++NV+S+ P  FE  ++Y  IP  D+ K+++S +F EA   I+ ++  NGR+ +HC AG+SRS+TI + YLMK K + + E  ++V++ R I  PN +F+GQL
Sbjct:   29 LLLDCRSFLAFSAGHIRGAVNARANTIVRRRAKGSVSLEQILSGDDEARSRLLAGLYSAVILYDERT----QDARAVKEDSTLTLVLNALGRDTFRTDVYLLKGGYDRFCS----QYPDYCLKS-RTLPVPSTVSSTSCGTPHHDQGGPVEILP-FLFLGSALHASKKDMLDGMGISALLNVSSNCPNHFEGAYQYKCIPVEDNHKEDISSWFIEAIEFIDSIKDSNGRVLVHCQAGISRSATICLAYLMKKKRVRLEEAFEFVKQRRSIISPNFSFMGQL 299          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Cavefish
Match: dusp1 (dual specificity phosphatase 1 [Source:NCBI gene;Acc:103038437])

HSP 1 Score: 129.798 bits (325), Expect = 7.807e-34
Identity = 96/314 (30.57%), Postives = 151/314 (48.09%), Query Frame = 1
Query:  181 LKNSMKISNISHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKFH-------SNKLFS----SIVIYDEKD-----VLKDRDLFAMKLINQIQLTCSL-VQVLSGGF----SEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDVM---KTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            L  +M I  +  I C  L  L+D      L++D R    F   HI  + N   ST ++ RR++      H        + L S    ++V+ DE+        KD  L  + +    +  C   +  L GGF    SEF     K    + +S        +  T   C++       +    EI+P FLYLG+   A  K  L    IT ++NV+++ P  FE  ++Y  IP  D+ K ++S +F+EA   I+ VR + GR+F+HC AG+SRS+TI + YLM+T  + + E  ++V++ R I  PN +F+GQL
Sbjct:    7 LCPTMVIMEVPSIDCSALRALLDGDEPGCLVLDCRSFFSFSSSHIPGSTNVRFST-IVRRRARGGLGLEHIVPNEDTRSGLLSGRVRTVVLLDERSSDLGQAKKDGTLM-LAVTALCRNPCGAEIVFLKGGFETFVSEFPEMCTKPVPPQGLSLPLSDSCQSDTTESGCNTCATPLYDQGGPVEILP-FLYLGSAYHASRKDMLDMLGITALINVSANCPNHFEEHYQYKSIPVEDNHKADISSWFNEAIEFIDSVRNKGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQL 317          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Cavefish
Match: dusp16 (dual specificity phosphatase 16 [Source:NCBI gene;Acc:103024574])

HSP 1 Score: 122.094 bits (305), Expect = 6.497e-30
Identity = 92/310 (29.68%), Postives = 147/310 (47.42%), Query Frame = 1
Query:  187 NSMKISNISHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRR-----SQVKWMKFHSNK-----LFSSIVIYDEKDVLKDR---DLFAMKLINQIQLTCSLVQVLSGGFSEFKAY-----ADKQYLEKKMSSQKILEYAAS-PTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVP---FFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
              + ++++  I    L+ L++   D  L+ID R    +   HI  A+N +CS KLM RR      Q+  +  HS K         +V+YD+          + F   L+ +++     V +LSGGF EF          K  L     SQ  L   +S PTR               I+P  LYLG + D  ++  +++  I  ++N ++  P   F  E+ F   R+P +DS  + +  + D++   IE  +  N R+ +HC AG+SRS+TI + Y+MK   + + E  ++V+E RP   PN NFLGQL
Sbjct:    6 GEVALASVRVIGPEGLVALLEGGLDCVLLIDSRPFVDYNASHILEAVNVNCS-KLMKRRLQQDKVQITELLQHSAKKKLELQGQEVVVYDQSSSDPSSLSSEAFLSVLLAKLERCFPSVHLLSGGFVEFSHLFPGLCEGKSTLVPSCISQPCLPINSSGPTR---------------ILP-HLYLGCQRDVLNRDLMQQNDIAYVLNASNTCPKPDFILESHF--LRVPVNDSFCEKILPWLDKSVEFIEKAKACNARVLVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTISPNFNFLGQL 296          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Cavefish
Match: si:dkey-175m17.7 (uncharacterized LOC103045335 [Source:NCBI gene;Acc:103045335])

HSP 1 Score: 118.242 bits (295), Expect = 1.563e-28
Identity = 67/144 (46.53%), Postives = 95/144 (65.97%), Query Frame = 1
Query:  628 SEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFF--ENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGR-IFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            + DV    +S I+P  L+LGNE DA+D   L    I  ++NVT+H+P +     + +Y R+PA+D+ KQNL QYF+E F  IE+  + NGR + +HC AGVSRS+TIV+ YLMK   + + +  KYV+  RP+  PNLNF+GQL
Sbjct:  731 TPDVENAVVSPILP-LLFLGNERDAQDLDLLLRLNIGYVVNVTTHLPLYHVDTGLVRYKRLPATDNSKQNLRQYFEEVFEFIEEAHQ-NGRGVLVHCQAGVSRSATIVIAYLMKHTLMTMTDAYKYVRGRRPVVSPNLNFMGQL 872          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Sea Lamprey
Match: dusp4 (dual specificity phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-709])

HSP 1 Score: 130.954 bits (328), Expect = 3.389e-35
Identity = 85/288 (29.51%), Postives = 144/288 (50.00%), Query Frame = 1
Query:  268 LIIDVRGNRFFQMQHIRHAMNFSC-------------STKLMSRRSQVKWMKFHSNKLFSSIVIYDEKDVLKDRDLFAMKLINQIQLTC---------SLVQVLSGGFSEFKAYADKQYLEKKMSSQ-KILEYA---ASPTRLECSSEDVM-KTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            L++D R    +   H+R ++N                +T+L+        ++     L++++V+ DE+     R+L A++  + + +           + V  L GG+ +F     +  L+  ++S  K    A     P RL  +      +    EI+P FLYLG+   A  +  L    IT ++NV++ +P  FE +F Y  IP  D+ K ++  +F EA + I+  R+  GR+F+HC AGVSRS+TI + YLMKT+ L + E  ++V++ R +  PN NFLGQL
Sbjct:   47 LLLDCRSFLAYSASHVRGSLNVHTNPILLRRRRRGIRATQLLPSAEARARLQ---AGLYAAVVLVDERT----RELSALRADSTLAMVALALGRETRGTPVYFLRGGYEKFHRDFSELCLDAALTSPCKTTPPALLPPVPIRLHTAGTPTYDQGGPVEILP-FLYLGSAYHASRRELLDAIGITALLNVSADLPNHFEGLFTYKSIPVEDNHKADIGAWFLEAIDFIDSTRRGGGRVFVHCHAGVSRSATICLAYLMKTRRLRLDEAFEFVRQRRSVISPNFNFLGQL 326          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Sea Lamprey
Match: dusp10 (dual specificity phosphatase 10 [Source:ZFIN;Acc:ZDB-GENE-041014-271])

HSP 1 Score: 124.79 bits (312), Expect = 3.415e-34
Identity = 70/146 (47.95%), Postives = 96/146 (65.75%), Query Frame = 1
Query:  619 ECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFF--ENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            + S+ DV    M+ ++P FL+LGNE DA+D   L+   I  I+NVTSH+P +       +Y R+PA+DS KQNL QYF+EAF  IE+  +    + IHC AGVSRS+TIV+ YLMK   + + +  K+V+  RPI  PNLNF+GQL
Sbjct:   36 DASTPDVENAEMTAVLP-FLFLGNEQDAQDLAQLQRLNIGYIINVTSHLPLYHYERGALRYKRLPATDSCKQNLRQYFEEAFEFIEEAYQSGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQL 180          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004127.1 (pep scaffold:Pmarinus_7.0:GL482725:7128:13243:-1 gene:ENSPMAG00000003769.1 transcript:ENSPMAT00000004127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.25 bits (308), Expect = 1.208e-32
Identity = 85/281 (30.25%), Postives = 135/281 (48.04%), Query Frame = 1
Query:  268 LIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQ---VKWMKFHSNKLFSS----------IVIYDEKDVLK---DRDLFAMKLINQIQLTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDV-MKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVP---FFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            L+ID R    F   H+R A+N  CS KL+ RR Q   V  ++   +   S           +V+YD++           F   L+ +++ T S V +L GGF+ F+         +   +   ++    P  L  SS  + ++ T    I  +LYLG++ D  +K    +  IT ++N +   P   F  E    + R+P  DS  + +  + D   N IE VR R  R+ +HC AG+SRS+T+ + Y+M+ K L   +  ++V+E RP   PN NFLGQL
Sbjct:   30 LVIDGRTFAEFNSCHVRSALNVCCS-KLVQRRLQQDKVSVLELVQHAATSGSQVEAGGPVVVVVYDQRSPSAASLPPHGFVSVLLGKLRRTFSDVYLLDGGFAAFQLL-----FPQLCENASRVDTRTPPLALPVSSPSLHLRDTGPTCILPYLYLGSQRDVLNKAIRVQSGITHVLNASVGCPRPDFIPEG--NFLRVPVHDSYCEKILPWLDCTANFIEGVRARGSRVLVHCLAGISRSATVAIAYVMRCKRLSSDDAYRFVKEKRPSISPNFNFLGQL 302          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Sea Lamprey
Match: dusp10 (dual specificity phosphatase 10 [Source:ZFIN;Acc:ZDB-GENE-041014-271])

HSP 1 Score: 123.25 bits (308), Expect = 1.882e-32
Identity = 87/307 (28.34%), Postives = 142/307 (46.25%), Query Frame = 1
Query:  250 NKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKFHSNKLFSS--------------------IVIYDEKDVLKDRDLFAMKLI-NQIQLTCSLVQVLSGGFSEFKAY---------------ADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENI--FKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQLSL 1056
            ++    +++D R    +   HIR A++ +CS +L  RR  +   K    +L S+                    +V+YD           A+KL+   ++   +   VL GG S+F+A                A   +          L  +++P      S DV     S ++P +L++G E  A+D   LR   +  ++NVT+HVP +        Y R+PASD+  Q+L QYF  AF +IE+ R+    + +HC AGVSRS T+ + Y+M+ +GL   +   +V+  R    PNL+F+GQL L
Sbjct:   36 SEPPPPMLLDCRPFGEYTRSHIRGALHVNCSDRLSRRR--LAQGKLRVTQLASATSAPAAAAAAVAAAGPPRRDMVLYDGS---SGDPAAALKLVLESLRREGADPLVLRGGLSDFRALHESLCEHHGVEDVSEATSPFDAHVNGRAGALLRSSAPLDERSESSDV-----SRLLP-YLFVGGERAARDLPTLRRLNVGLVLNVTAHVPHYHAGAGSIAYRRLPASDTHGQDLRQYFRPAFLLIEEARRCGCSVLLHCQAGVSRSPTVAIAYVMRIRGLGASDAYAFVRARRAAVAPNLSFMGQLLL 331          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Sea Lamprey
Match: dusp10 (dual specificity phosphatase 10 [Source:ZFIN;Acc:ZDB-GENE-041014-271])

HSP 1 Score: 118.242 bits (295), Expect = 1.984e-32
Identity = 54/137 (39.42%), Postives = 84/137 (61.31%), Query Frame = 1
Query:  652 MSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENI--FKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQLSL 1056
            +S ++P +L++G E  A+D   LR   +  ++NVT+HVP +        Y R+PASD+  Q+L QYF  AF +IE+ R+    + +HC AGVSRS T+ + Y+M+ +GL   +   +V+  R    PNL+F+GQL L
Sbjct:   18 VSRLLP-YLFVGGERAARDLPTLRRLNVGLVLNVTAHVPHYHAGAGSIAYRRLPASDTHGQDLRQYFRPAFLLIEEARRCGCSVLLHCQAGVSRSPTVAIAYVMRIRGLGASDAYAFVRARRAAVAPNLSFMGQLLL 153          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Yeast
Match: YVH1 (Dual specificity protein phosphatase; regulates growth, sporulation, and glycogen accumulation in a cAMP-dependent protein kinase cascade dependent manner; mutants are defective in 60S ribosome assembly; positively regulates pre-autophagosomal structure (PAS) formation upon nitrogen starvation or rapamycin treatment [Source:SGD;Acc:S000001465])

HSP 1 Score: 63.5438 bits (153), Expect = 1.213e-11
Identity = 47/148 (31.76%), Postives = 68/148 (45.95%), Query Frame = 1
Query:  676 LYLGNELDAKDKHAL-REKKITDIMNVTSH--VP-FFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIE---------------DVRKR--NGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQLSL 1056
            +YLG      D   L  E  IT I++V     +P +     +    IP  D D  ++ QYFDE    I+               D +K+   G +F HC AG+SRS T ++ YLM   GL +   +  V+  +P  +PN NF+ QL L
Sbjct:   19 IYLGGIRPIIDHRPLGAEFNITHILSVIKFQVIPEYLIRKGYTLKNIPIDDDDVTDVLQYFDETNRFIDQCLFPNEVEYSPRLVDFKKKPQRGAVFAHCQAGLSRSVTFIVAYLMYRYGLSLSMAMHAVKRKKPSVEPNENFMEQLHL 166          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Nematostella
Match: EDO45432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTA2])

HSP 1 Score: 121.324 bits (303), Expect = 1.446e-31
Identity = 89/301 (29.57%), Postives = 154/301 (51.16%), Query Frame = 1
Query:  268 LIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKFHS-----------NK---LFSSIVIYDE--KDV--LKDRDLFAMKLINQIQLTCS--LVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYA----------ASPTRL--------ECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENI--FKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            L++D R    F   HI+ A+N +  + ++ R  +     F S           NK   + +++V+YD   KD+  +    + A+ LI ++   C+   +++L GGFS+F+          + S + +L  +          A P+R+           + +V    ++EI+P+ LYLG+E DA +   LR+ KI+ ++NVT   P  F +I  FKY  +P  D+   NL++ F EAF  I++ R+++  + +HC AG+SRS TI + YLM ++ L + E   +V+  +    PN NF+GQL
Sbjct:   21 LLLDCRPFAEFVRSHIQGAINLTIPSLMLRRMKKGNNFSFTSLISSEEGKEQFNKNLHMATAVVLYDSNTKDIASIGINSVMAV-LIKKLADECASGTLRLLEGGFSKFEERFPSFCEPGEESGRPLLSLSGLTIREASEQAVPSRILLPNVQPSTPENRNVSNCELAEILPR-LYLGSEKDASNIELLRKHKISYVLNVTHDRPNTFAHIEGFKYKNLPVEDNLMANLTELFPEAFAFIDEGRQKSSNVLVHCLAGISRSVTITIAYLMSSQHLSLNEAYDFVKARKSNVSPNFNFMGQL 319          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Nematostella
Match: EDO37000 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGZ1])

HSP 1 Score: 108.227 bits (269), Expect = 1.665e-28
Identity = 56/133 (42.11%), Postives = 84/133 (63.16%), Query Frame = 1
Query:  661 IIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFF---ENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            I+P FL+LG+E  A D+  +    I  I+N+T   P FF   E+I  Y RI  +DS ++++ Q+FDEA   I++ R R   + +HC AGVSRS+T+ + Y+M+  GL + E  ++V+E RP   PNLNF+G L
Sbjct:    1 ILP-FLFLGSEEGAADEDLIDRLAIKFILNLTPVCPNFFSEREDII-YKRIQINDSYQEDIGQHFDEAIAFIDEARSRGSSVLVHCHAGVSRSATVTVAYVMQHLGLSLNEAYQFVKEKRPTISPNLNFMGHL 131          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Nematostella
Match: EDO49250 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGX7])

HSP 1 Score: 112.079 bits (279), Expect = 2.628e-28
Identity = 85/295 (28.81%), Postives = 137/295 (46.44%), Query Frame = 1
Query:  271 IIDVRGNRFFQMQHIRHAMNFSCSTKLMSR--RSQVKWMKFHS---NKLF----SSIVIYDE-----KDVLKDRDL-FAMKLINQIQLTCSLVQVLSGGFSEFKAY-------------ADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMS-------EIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            ++D R    F + HIR A+N  C   L  R  R         S   +K+      +I+ YD+     KD+  D  +    KL+   +   +L  +  GGF  F A              +    L+ K+ +        SP     + +D +    S       E++P  LYLG+EL A  +  L+   I+ I+NV+ ++P  FE+ F Y  IP  D+   ++  +F+EA   I+ V+   GR+ +HC AG+SRS+TI + YL+      + E  +YV++ R +  PN NF+GQL
Sbjct:   11 LVDCRSFMAFNVAHIRGAVNIHCPPILKRRLLRGSATLSALVSCPESKVILEEADTIIFYDDRTCDWKDLENDSTMKIVAKLLRWEKRKATLFYI-KGGFERFSALFSTMCEFIKPCNSSLTSPLKLKLMTSADGRKPFSPRWDTDNKDDQLPRAHSNSVNEPVELLPH-LYLGSELHASRRDVLKRLGISAIVNVSRNIPNTFEDSFTYKTIPVDDTYNADIGVWFEEAAGFIDSVKASGGRVLVHCQAGISRSATICLAYLISRLNFRLDEAYEYVKKRRSVISPNFNFMGQL 303          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Nematostella
Match: EDO43689 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV7])

HSP 1 Score: 99.3673 bits (246), Expect = 5.349e-24
Identity = 76/261 (29.12%), Postives = 128/261 (49.04%), Query Frame = 1
Query:  229 ELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRR------SQVKWMKFHSN---KLFSSIVIYDE--KDVLK-DRDLFAMKLINQIQLTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECS---SEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFF--FENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMK 960
            +L E + N     LIID R    +   H+ +++N  CS KL+ RR      S  + +K   N        +++YD+  +D+    +D F   + +++  +   V  L GGFS F     +++        K+ E  ++P R       S+  + T     I  FLYLG +  + D+  L    I  ++N++   P     EN  +Y RIP  D+  +N+  +F  AF+ I+ VR+ +GR+ +HC+AG SRS+TI + Y+MK
Sbjct:    8 QLAECLVNSVQSLLIIDSRSFLEYNDAHVINSINIGCS-KLIKRRLITNKISIQELLKTGENVQPNQLGKVIVYDQDTQDMEGLSKDNFMSVVFSKLTSSYKDVCFLKGGFSFFA----REF-------PKLCESRSNPGRCGVRAVLSQPCLSTEAPTHILPFLYLGTQEHSLDEEFLNATGINYVLNISCSCPALPGLENTGRYLRIPVKDTINENILDWFPTAFDFIDKVREVHGRVLLHCYAGKSRSATIAIGYIMK 256          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Nematostella
Match: EDO34920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN01])

HSP 1 Score: 93.2041 bits (230), Expect = 6.483e-23
Identity = 55/143 (38.46%), Postives = 78/143 (54.55%), Query Frame = 1
Query:  640 MKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQLSLMSNK 1068
            M   M++IIP  LYLGN  D+KD   L+E  IT I+++  +     E+I  Y  I A+DS  Q+L  +F E    I   R +     +HC AG+SRS+TI   Y+M    L   +TL+ ++ +R IA+PN  F  QL    NK
Sbjct:    1 MGNGMNKIIPG-LYLGNIRDSKDAEQLQEHNITHILSIHDNANPLREDIM-YKCIHAADSPDQDLMPFFQECIEFIHSCRVKEMNCLVHCIAGISRSTTICAAYIMTITELSWRQTLQAIRANRSIANPNYGFKRQLQDFYNK 141          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Medaka
Match: dusp10 (dual specificity phosphatase 10 [Source:NCBI gene;Acc:101167166])

HSP 1 Score: 144.436 bits (363), Expect = 1.985e-38
Identity = 105/287 (36.59%), Postives = 155/287 (54.01%), Query Frame = 1
Query:  262 MDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQ-----------VKWMKFHSNKLFS-SIVIYDEKDVLKDRDLFAMKL---INQIQLTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAAS-------PTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFF--ENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            + +IID R    +   HIR A++ +CS K+  RR Q            +  K     +FS  IV+YDE  V  +R      L   +  ++       +L GG S F+  + +   E  +   + L+  A+       P  L  S+ D+    ++ I+P FLYLGNE DA+D + L+   I  I+NVT+H+P +     +F Y R+PA+DS+KQNL QYF+EAF  IE+  +    + IHC AGVSRS+TIV+ YLMK   + + +  K+V+  RPI  PNLNF+GQL
Sbjct:  162 VPVIIDCRPFLEYNKSHIRGAVHINCSDKISRRRLQQGKITVLDLISCREGKDSFKGIFSKEIVVYDESTVDPNRLTSNQPLHAVLESLRREGKDPIILKGGLSYFRQ-SHENLCEHSLHLHEGLDPGAAAGLTGPLPHSLP-STPDIENAELTPILP-FLYLGNEQDAQDANLLQRLNIGYILNVTTHLPLYHYDTGLFIYKRLPATDSNKQNLRQYFEEAFEFIEEAHQAGMGLLIHCQAGVSRSATIVIAYLMKHTWMTMTDAYKFVKTRRPIISPNLNFMGQL 445          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Medaka
Match: dusp4 (dual specificity phosphatase 4 [Source:NCBI gene;Acc:101166402])

HSP 1 Score: 135.961 bits (341), Expect = 4.578e-36
Identity = 87/299 (29.10%), Postives = 150/299 (50.17%), Query Frame = 1
Query:  208 ISHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKFHS-------------NKLFSSIVIYDEK--DVLKDRDLFAMKLINQIQLTCSL---VQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            +  + C  L  L+ + +   L++D R    +   HIR A+N  C+T ++ RR++   +                 + ++S++V+YDE+  D    ++   M L+       SL     +L GG+  F +   +  +  K       + +   +   C +    +    EI+P FLYLG+ L A  K  L    I+ ++NV++  P  FE  ++Y  IP  D+ K+++S +F EA   I+ VR  +GR+ +HC AG+SRS+TI + YLMK K + + E  ++V+  R I  PN +F+GQL
Sbjct:    8 LGEMDCTVLKRLLKDDSAKCLLLDCRSFLAYSAGHIRGAVNARCNT-IVRRRAKGSALSLDQILAGDDEVRSRLRSGMYSAVVVYDERTPDTEAVKEDSTMMLVLNALFRDSLGTRTYLLKGGYDRFFSEYPEFCMRTKSLPSLTSQSSIDSSCSSCGTPHNDQGGPVEILP-FLYLGSALHASKKEVLDAIGISALLNVSADCPNHFEGAYQYKCIPVEDNHKEDISCWFLEAIEFIDSVRDSSGRVLVHCQAGISRSATICLAYLMKRKRIRLDEAFEFVRRRRSIISPNFSFMGQL 304          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Medaka
Match: dusp1 (dual specificity phosphatase 1 [Source:NCBI gene;Acc:101173794])

HSP 1 Score: 135.576 bits (340), Expect = 5.147e-36
Identity = 97/310 (31.29%), Postives = 153/310 (49.35%), Query Frame = 1
Query:  193 MKISNISHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKFH-------SNKLFS----SIVIYDEKDV----LKDRDLFAMKLINQIQLTCSL-VQVLSGGFSEFKA-YAD-------KQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            M I  +  +    L  L+D      L++D R    F   HI  + N   ST ++ RR++      H        N+L S    S+V+ D++ +    +K      + +    +  C   V +L GGF  F   Y D        Q L   +SS+     + SP    C++    +    EI+P FLYLG+   A  K  L    IT ++NV+++ P  FE+ F Y  IP  D+ K ++S +F+EA   I+ VR + GR+F+HC AG+SRS+TI + YLM+T  + + E  ++V++ R I  PN +F+GQL
Sbjct:    1 MVIMEVLTVDSASLRALLDRDVPDCLVLDCRSFLSFNSSHISGSSNVRFST-IVRRRARGGLGLEHIVPNEDTRNRLLSGDYKSVVLLDDRSLDLGQVKKDGTLMLAVTALCRDPCGANVYILKGGFDAFSTEYPDMCTKSSPPQGLSLPLSSRNPDSASYSP----CNTPLYDQGGPVEILP-FLYLGSAYHASRKDMLEMLGITALINVSANCPNHFEDSFLYKSIPVEDNYKADISSWFNEAIEFIDSVRNKGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKKRRSIISPNFSFMGQL 304          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Medaka
Match: dusp16 (dual specificity phosphatase 16 [Source:NCBI gene;Acc:111946967])

HSP 1 Score: 127.487 bits (319), Expect = 8.437e-32
Identity = 94/303 (31.02%), Postives = 143/303 (47.19%), Query Frame = 1
Query:  211 SHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRR-----SQVKWMKFHSNK------LFSSIVIYDEK---DVLKDRDLFAMKLINQIQLTCSLVQVLSGGFSEFKAY-----ADKQYLEKKMSSQKILEYAA-SPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVP---FFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            + I    L+ L++   +  ++ID R    F   HI  A+N +CS KLM RR      Q+  +  HS K          +V+YD+          D F   L+ +++   + V +LSGGFS F          +  L     SQ  L  ++  PTR               I+P  LYLG + D  +   +RE  I  ++N ++  P   F  E+ F   R+P +DS  + +  + D +   IE  +  NGR+ +HC AG+SRS+TI + Y+MK   L + E  ++V+E RP   PN NFLGQL
Sbjct:    4 ASIGVQALVALLEGGLERAVLIDSRPFVDFNAAHILEAVNVNCS-KLMKRRLQQDKVQITELLQHSAKKELDLQAAQEVVVYDQSSSDPAALGSDCFLSVLLVKLEKNFTSVHLLSGGFSTFSRLFPGLCEGRSALVPSCVSQPCLPISSPGPTR---------------ILP-HLYLGCQRDVLNTDLMRENDIAYVLNASNTCPKPDFIPESHF--LRVPVNDSFCEKILPWLDRSVEFIERAKASNGRVLVHCLAGISRSATIAIAYIMKRMDLSLDEAYRFVKEKRPTISPNFNFLGQL 287          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Medaka
Match: si:dkey-175m17.7 (dual specificity protein tyrosine phosphatase CCP1 [Source:NCBI gene;Acc:101166327])

HSP 1 Score: 119.013 bits (297), Expect = 8.462e-29
Identity = 65/142 (45.77%), Postives = 92/142 (64.79%), Query Frame = 1
Query:  628 SEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENI-FKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            + D     +S I+P FL+LGNE DA+D   L    I  ++NVT+H+P +  N   +Y R+PA+D+ KQNL QYF+E F  IE+  +    + +HC AGVSRS+TIV+ YLMK   + + +  KYV+  RP+  PNLNF+GQL
Sbjct:  714 TPDAENAVISPILP-FLFLGNERDAQDLDLLLRLNIGYVVNVTTHLPLYHINSGLRYKRLPATDNSKQNLRQYFEEVFEFIEEAYQSGQGVLVHCQAGVSRSATIVIAYLMKHTLMTMTDAYKYVRSRRPVVSPNLNFMGQL 854          
BLAST of Dual specificity protein phosphatase 10 vs. Planmine SMEST
Match: SMESG000030100.1 (SMESG000030100.1)

HSP 1 Score: 662.529 bits (1708), Expect = 0.000e+0
Identity = 333/335 (99.40%), Postives = 334/335 (99.70%), Query Frame = 1
Query:   70 MYISTISKQTRPQQLKLDHCXXXXXXXXXXXXXEYQDLKNSMKISNISHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKFHSNKLFSSIVIYDEKDVLKDRDLFAMKLINQIQLTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQLSLMSNKRS 1074
            MYISTISKQTRPQQLKLDHCSNSGSSSLFDSDDEYQDLKNSMKISNISHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKFHSNKLFSSIVIYDEKD+LKDRDLFAMKLINQIQLTCSLVQVLSGGFSEFK YADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQLSLMSNKRS
Sbjct:    1 MYISTISKQTRPQQLKLDHCSNSGSSSLFDSDDEYQDLKNSMKISNISHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKFHSNKLFSSIVIYDEKDILKDRDLFAMKLINQIQLTCSLVQVLSGGFSEFKTYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQLSLMSNKRS 335          
BLAST of Dual specificity protein phosphatase 10 vs. Planmine SMEST
Match: SMESG000078269.1 (SMESG000078269.1)

HSP 1 Score: 220.705 bits (561), Expect = 5.958e-68
Identity = 107/261 (41.00%), Postives = 170/261 (65.13%), Query Frame = 1
Query:  271 IIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKFHSNKL-FSSIVIYDEKDVLKDRDLFAMKLINQIQLTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            +ID R  R F+  HI  A  F+C+T+ M  +++  W KF   +  F +IV+Y+++    ++ +  +  I+ ++     V  ++GG+ E+  Y  K ++E  +  +KI +Y  SPT     S DV+  T+SEI+P FL+LGNE+D+ D   L+EKKIT I+NVT++VPF+ E++F Y R+ A+D ++Q++  Y+DEA   I++   +NG++ +HCWAGVSRS+TIV  YL+K   L VL+T+ ++Q  RPI +PN NFLGQL
Sbjct:  100 LIDTRDVRTFKNGHIIGAELFNCTTRTMMMKAKKNWDKFSQRRCDFETIVLYNQRG---EKTVHLIDFIDNLKKDFDSVYFVTGGYEEYIKYFSKGFIESSIPEEKIDQYHYSPTNESNRSTDVLNATISEILP-FLFLGNEMDSNDIEVLQEKKITHILNVTTNVPFYREDLFVYKRLSATDCNRQDMRAYYDEAIQFIDEAYSKNGKVLVHCWAGVSRSATIVAAYLLKHTKLSVLQTIMFLQSKRPIVEPNFNFLGQL 356          
BLAST of Dual specificity protein phosphatase 10 vs. Planmine SMEST
Match: SMESG000063504.1 (SMESG000063504.1)

HSP 1 Score: 212.616 bits (540), Expect = 2.187e-65
Identity = 116/286 (40.56%), Postives = 174/286 (60.84%), Query Frame = 1
Query:  205 NISHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQVKWMKF-HSNKLFSSIVIYDEKDVLKDRDLFAMKLINQIQLTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECS-SEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFEN--IFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            N   I+ + L   ++N      I+D+R +R FQ  HI+ A   +C+TKLMS+++ + W +  + N+     ++YD++  L   +   + LI+ + L    +  L GG+ EFK    +  +E  +  +K+  Y  SPT +  + SEDV+  T S+I P F+++GNE D+ D   L+E +IT I+NVTS  PF+F+N  IF+Y R+PA DS  QNL   ++EAFN I+  R  NGR+ +HCWAGVSRS +IV+ YL+K     VLE LK+VQ  R I  PN++FLGQL
Sbjct:   62 NFHTITSILLNRCLENNDFKGFILDLRDSRHFQNGHIKGAKTANCTTKLMSKKTLMDWKRSDYDNE--DHYILYDQQSDLPAANSPQIVLIDYLLLNNKQITYLQGGYDEFKKVCKESLIETSLPKEKLQSYNYSPTNVHINNSEDVLNATASQIFP-FIFIGNERDSSDLELLKELEITHILNVTSTSPFYFKNLNIFQYQRLPACDSHMQNLRVLYNEAFNFIDAARFSNGRVLVHCWAGVSRSPSIVIAYLLKHSNNSVLEILKFVQGKRSIVAPNIHFLGQL 344          
BLAST of Dual specificity protein phosphatase 10 vs. Planmine SMEST
Match: SMESG000035381.1 (SMESG000035381.1)

HSP 1 Score: 132.109 bits (331), Expect = 9.908e-35
Identity = 105/284 (36.97%), Postives = 143/284 (50.35%), Query Frame = 1
Query:  208 ISHISCMELIELIDNKTDMDLII-DVRGNRFFQMQHIRHAMNFSCSTKLMSRRS-QVKWMKFHSNKLFSSIVIYDEKDVLKDRDLFAMKLINQIQLTCSLVQVLSGGFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMK-TKGLDVLETLKYVQEHRPIADPNLNFLGQL 1050
            I  I   EL +LI   TD  +II D+R    F   HI  A   +CS+K+ SRR+ Q+      ++     IV+Y E  +   +D     LI  +         L+  F +F+        E   S+   L    S         D+  T  S I+P FLYLGNELDA +   L   KIT ++NVT    F  E  FK  RI  +D++ Q+L Q+F +AF  IE  RK NGRI +HC AG+SRS+TIV+ YLM     LD+    ++V+  R I  PN NF+GQL
Sbjct:   71 IDKIESAELEKLI--STDCSVIILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILKTSIDLHRIVLYTEFGLPFKQDDPITVLIQFLIGRSINCLYLTDSFKKFET-TYPNLCESGSSNVLCLHIPKSVPDFT----DIYFTKASLILP-FLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCNDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQL 346          
BLAST of Dual specificity protein phosphatase 10 vs. Planmine SMEST
Match: SMESG000016231.1 (SMESG000016231.1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.502e-22
Identity = 50/131 (38.17%), Postives = 78/131 (59.54%), Query Frame = 1
Query:  670 KFLYLGNELDAKDKHALREKKITDIMNVTSH---VPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQLS 1053
            K L LG++ DA +   +++ KIT ++NV++     PF    I  + RIP  D+    ++ YF +AF+ +++VR  NGR  +HC AG+SRS T+ + YLMK + + V +    V+  R    PN NFLGQL+
Sbjct:  253 KHLLLGSQRDAMNLSCIQQHKITHVINVSTDGLVCPFI--PIQNFLRIPVLDNFTDRITNYFPKAFDFLDNVRAVNGRALVHCSAGISRSPTLAIGYLMKAQNISVTDAYNIVKLSRSSVSPNFNFLGQLT 381          
The following BLAST results are available for this feature:
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DUSP107.842e-3633.68dual specificity phosphatase 10 [Source:HGNC Symbo... [more]
DUSP13.689e-3330.87dual specificity phosphatase 1 [Source:HGNC Symbol... [more]
DUSP165.476e-3231.76dual specificity phosphatase 16 [Source:HGNC Symbo... [more]
DUSP165.476e-3231.76dual specificity phosphatase 16 [Source:HGNC Symbo... [more]
DUSP42.077e-2932.17dual specificity phosphatase 4 [Source:HGNC Symbol... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vhp-14.021e-2628.70Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
vhp-14.021e-2628.70Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
vhp-18.193e-2628.13Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
vhp-18.193e-2628.13Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
vhp-18.193e-2628.13Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
puc8.333e-3144.22gene:FBgn0243512 transcript:FBtr0339722[more]
puc4.098e-3044.22gene:FBgn0243512 transcript:FBtr0081792[more]
Mkp31.160e-2538.35gene:FBgn0036844 transcript:FBtr0075036[more]
Mkp31.707e-2438.35gene:FBgn0036844 transcript:FBtr0333220[more]
Mkp31.707e-2438.35gene:FBgn0036844 transcript:FBtr0075035[more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp109.263e-4036.49dual specificity phosphatase 10 [Source:ZFIN;Acc:Z... [more]
dusp41.387e-3729.30dual specificity phosphatase 4 [Source:ZFIN;Acc:ZD... [more]
dusp41.387e-3729.30dual specificity phosphatase 4 [Source:ZFIN;Acc:ZD... [more]
dusp41.387e-3729.30dual specificity phosphatase 4 [Source:ZFIN;Acc:ZD... [more]
dusp12.121e-3632.69dual specificity phosphatase 1 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npc1l14.047e-3942.02NPC1 like 1 [Source:Xenbase;Acc:XB-GENE-964011][more]
pcsk12.218e-3333.48proprotein convertase subtilisin/kexin type 1 [Sou... [more]
pcsk12.516e-3333.48proprotein convertase subtilisin/kexin type 1 [Sou... [more]
ibtk1.218e-3132.62inhibitor of Bruton tyrosine kinase [Source:Xenbas... [more]
pnpt14.424e-3131.74polyribonucleotide nucleotidyltransferase 1 [Sourc... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dusp102.437e-3533.68dual specificity phosphatase 10 [Source:MGI Symbol... [more]
Dusp18.643e-3231.47dual specificity phosphatase 1 [Source:MGI Symbol;... [more]
Dusp161.545e-3131.76dual specificity phosphatase 16 [Source:MGI Symbol... [more]
Dusp12.941e-3034.87dual specificity phosphatase 1 [Source:MGI Symbol;... [more]
Dusp44.623e-2929.41dual specificity phosphatase 4 [Source:MGI Symbol;... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0IID7|DUS10_BOVIN1.477e-3534.04Dual specificity protein phosphatase 10 OS=Bos tau... [more]
sp|Q9Y6W6|DUS10_HUMAN3.766e-3533.68Dual specificity protein phosphatase 10 OS=Homo sa... [more]
sp|Q9ESS0|DUS10_MOUSE1.704e-3433.68Dual specificity protein phosphatase 10 OS=Mus mus... [more]
sp|P28562|DUS1_HUMAN1.772e-3230.87Dual specificity protein phosphatase 1 OS=Homo sap... [more]
sp|Q90W58|DUS1B_XENLA2.199e-3132.33Dual specificity protein phosphatase 1-B OS=Xenopu... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JB872.407e-4537.03dual specificity protein phosphatase 10 isoform X1... [more]
A0A1D1V8C62.450e-4336.59Uncharacterized protein OS=Ramazzottius varieornat... [more]
A0A433TCQ33.291e-4334.45Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A067R7Z73.487e-4335.59Dual specificity protein phosphatase 10 (Fragment)... [more]
U4UP117.396e-4336.43Uncharacterized protein (Fragment) OS=Dendroctonus... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf1a2.727e-4037.28TATA-box binding protein associated factor, RNA po... [more]
dusp43.753e-3630.96dual specificity phosphatase 4 [Source:NCBI gene;A... [more]
dusp17.807e-3430.57dual specificity phosphatase 1 [Source:NCBI gene;A... [more]
dusp166.497e-3029.68dual specificity phosphatase 16 [Source:NCBI gene;... [more]
si:dkey-175m17.71.563e-2846.53uncharacterized LOC103045335 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp43.389e-3529.51dual specificity phosphatase 4 [Source:ZFIN;Acc:ZD... [more]
dusp103.415e-3447.95dual specificity phosphatase 10 [Source:ZFIN;Acc:Z... [more]
ENSPMAT00000004127.11.208e-3230.25pep scaffold:Pmarinus_7.0:GL482725:7128:13243:-1 g... [more]
dusp101.882e-3228.34dual specificity phosphatase 10 [Source:ZFIN;Acc:Z... [more]
dusp101.984e-3239.42dual specificity phosphatase 10 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YVH11.213e-1131.76Dual specificity protein phosphatase; regulates gr... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO454321.446e-3129.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370001.665e-2842.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492502.628e-2828.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436895.349e-2429.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349206.483e-2338.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp101.985e-3836.59dual specificity phosphatase 10 [Source:NCBI gene;... [more]
dusp44.578e-3629.10dual specificity phosphatase 4 [Source:NCBI gene;A... [more]
dusp15.147e-3631.29dual specificity phosphatase 1 [Source:NCBI gene;A... [more]
dusp168.437e-3231.02dual specificity phosphatase 16 [Source:NCBI gene;... [more]
si:dkey-175m17.78.462e-2945.77dual specificity protein tyrosine phosphatase CCP1... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030100.10.000e+099.40SMESG000030100.1[more]
SMESG000078269.15.958e-6841.00SMESG000078269.1[more]
SMESG000063504.12.187e-6540.56SMESG000063504.1[more]
SMESG000035381.19.908e-3536.97SMESG000035381.1[more]
SMESG000016231.12.502e-2238.17SMESG000016231.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004581 ID=SMED30004581|Name=Dual specificity protein phosphatase 10|organism=Schmidtea mediterranea sexual|type=transcript|length=1150bp
GTTTGTTGCTAAAAATAGAATTTTTATATGATTTATTTCAAGAAATTATT
TTTCAAATAATCACAATTTATGTATATTTCTACGATTTCAAAACAAACTC
GTCCTCAACAATTAAAATTAGATCACTGCAGTAACAGTGGTTCTAGCTCG
TTATTTGATTCCGACGATGAATATCAAGATTTGAAAAACTCAATGAAAAT
TTCTAATATTTCCCATATAAGTTGTATGGAATTAATCGAGCTAATAGATA
ATAAAACTGATATGGATTTAATTATTGATGTTCGTGGTAATCGTTTTTTT
CAAATGCAGCATATCAGGCATGCGATGAACTTTAGTTGTTCAACCAAACT
TATGTCGAGAAGATCGCAAGTTAAATGGATGAAATTTCATTCAAATAAAT
TATTCAGCTCAATAGTTATTTATGATGAAAAAGATGTATTGAAAGATCGA
GACTTGTTCGCAATGAAACTTATCAATCAAATTCAGCTCACGTGCTCATT
AGTTCAAGTATTATCGGGTGGATTTTCTGAATTTAAGGCTTATGCTGATA
AACAGTACCTGGAAAAGAAAATGAGTAGTCAAAAAATCCTAGAATATGCT
GCCAGTCCTACTCGGTTAGAATGCAGTTCGGAAGATGTAATGAAAACAAC
AATGTCAGAAATAATTCCAAAATTTTTATACTTGGGAAATGAATTAGATG
CCAAAGATAAACATGCTTTGCGGGAAAAGAAAATTACAGACATCATGAAT
GTTACCTCCCATGTACCATTCTTTTTTGAGAATATTTTCAAATATTATAG
AATTCCAGCAAGTGATTCAGATAAACAAAATCTATCTCAATATTTTGATG
AAGCCTTTAATATAATTGAAGATGTAAGAAAAAGAAACGGCAGAATATTT
ATTCACTGTTGGGCTGGAGTTAGCAGGTCGTCGACTATTGTTATGATGTA
CCTAATGAAGACTAAAGGTTTGGACGTGCTAGAAACACTCAAATATGTAC
AAGAACATCGTCCAATCGCCGATCCAAATTTGAACTTTCTTGGACAATTG
TCATTAATGTCAAATAAGAGATCGTAACAATTTTCATCACTATTTTTGTT
TCATTATTAACTAATACCCCTAGAGATTATGTTTATTATTATTATTATTA
back to top

protein sequence of SMED30004581-orf-1

>SMED30004581-orf-1 ID=SMED30004581-orf-1|Name=SMED30004581-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=336bp
MYISTISKQTRPQQLKLDHCSNSGSSSLFDSDDEYQDLKNSMKISNISHI
SCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRSQ
VKWMKFHSNKLFSSIVIYDEKDVLKDRDLFAMKLINQIQLTCSLVQVLSG
GFSEFKAYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIP
KFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDS
DKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKG
LDVLETLKYVQEHRPIADPNLNFLGQLSLMSNKRS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0008138protein tyrosine/serine/threonine phosphatase activity
GO:0004725protein tyrosine phosphatase activity
GO:0016791phosphatase activity
GO:0017017MAP kinase tyrosine/serine/threonine phosphatase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036873Rhodanese-like_dom_sf
IPR001010Thionin
IPR003595Tyr_Pase_cat
IPR020422TYR_PHOSPHATASE_DUAL_dom
IPR001763Rhodanese-like_dom
IPR000340Dual-sp_phosphatase_cat-dom
IPR029021Prot-tyrosine_phosphatase-like
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
Vocabulary: biological process
TermDefinition
GO:0006952defense response
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0000188inactivation of MAPK activity
GO:0035335peptidyl-tyrosine dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020422Dual specificity protein phosphatase domainSMARTSM00195dsp_5coord: 194..333
e-value: 3.7E-39
score: 146.1
IPR020422Dual specificity protein phosphatase domainPROSITEPS50054TYR_PHOSPHATASE_DUALcoord: 199..335
score: 36.079
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 239..333
e-value: 0.003
score: 17.7
IPR000340Dual specificity phosphatase, catalytic domainPFAMPF00782DSPccoord: 203..331
e-value: 8.2E-33
score: 113.1
IPR036873Rhodanese-like domain superfamilyGENE3DG3DSA:3.40.250.10coord: 46..162
e-value: 5.5E-12
score: 48.1
IPR036873Rhodanese-like domain superfamilySUPERFAMILYSSF52821Rhodanese/Cell cycle control phosphatasecoord: 42..158
IPR001763Rhodanese-like domainPFAMPF00581Rhodanesecoord: 54..156
e-value: 7.5E-6
score: 26.4
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 188..335
e-value: 3.1E-46
score: 158.8
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 193..329
NoneNo IPR availablePANTHERPTHR10159DUAL SPECIFICITY PROTEIN PHOSPHATASEcoord: 67..328
NoneNo IPR availableCDDcd14498DSPcoord: 195..327
e-value: 1.04747E-53
score: 170.805
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 278..288
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 256..315
score: 14.401