Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2

Overview
NameDolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2
Smed IDSMED30004576
Length (bp)2321
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (SMED30004576) t-SNE clustered cells

Violin plots show distribution of expression levels for Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (SMED30004576) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (SMED30004576) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (SMED30004576) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004576

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30004576h1SMcG0002014 dd_Smed_v4_538_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30004576h1SMcG0002014 dd_Smed_v4_538_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004576h1SMcG0002014 dd_Smed_v4_538_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004576h1SMcG0002014 dd_Smed_v4_538_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Human
Match: RPN2 (ribophorin II [Source:HGNC Symbol;Acc:HGNC:10382])

HSP 1 Score: 227.639 bits (579), Expect = 2.692e-64
Identity = 187/651 (28.73%), Postives = 322/651 (49.46%), Query Frame = 3
Query:   87 FTLIFSCIFFSSAL-KSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALMEIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFETSVVYKSEPKV-KVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFYSVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFV---IREGQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            F L  + I  + AL  + YLT  D + +K+     L + FT+ ++   S+ G S L  +    K AC   ++  L+  N++ L+ +A  +  L   + ++    K   L  + + S++  ++  V  +S   L +       +L   L K+ + L+   +   A+ +   +++L+    EIED + + DEL  +Y+ +E+G+ TTA  V + ++L +     P I  +++ +  N + S+++  +L     +A A   LS N+  VP+V+  E S     E  + ++ +TN+    +  A +  E  K++ S AT++ + S T      ++EL+  + +   + G+Y    + + +       V   L VK+ ++V I NV+LS  ++DQ       +++  +        + H    + F    +  G +   PHQ FV+L +  T QE++FVAE D  +VYKF LD  +   +FD+ SG Y + LIIGDA++++P  W  A+V +  P         E   S   S+             T K +I H+F+  EKR   ++S  FT L +  P +++  LW  +G N SNF  A S I+FH+G  A+ GL Y YW+ LNMF TL+YL  LG +T   GNR+L Q A KR
Sbjct:   10 FLLALTIIASTWALTPTHYLTKHDVERLKA----SLDRPFTNLESAFYSIVGLSSLGAQVPDAKKACTYIRSN-LDPSNVDSLFYAAQASQALSGCEISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHL-SQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSASDTHEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQKTSFT--PVGDVFELNFMNVK--FSSGYYDFLVEVEGDNRYIANTVE--LRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAE-LTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPE--------EEAPSTVLSQNLF----------TPKQEIQHLFREPEKRPPTVVSNTFTALILS-PLLLLFALWIRIGANVSNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLAQQAVKR 628          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Human
Match: RPN2 (ribophorin II [Source:HGNC Symbol;Acc:HGNC:10382])

HSP 1 Score: 206.453 bits (524), Expect = 1.048e-56
Identity = 168/577 (29.12%), Postives = 286/577 (49.57%), Query Frame = 3
Query:  318 NINDLYVSAYGASLLQSE----KCNLDVTKKKNALMEIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFETSVVYKSEPKV-KVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFYSVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFV---IREGQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            N+   + S  G S L ++    K ++    K   L  + + S++  ++  V  +S   L +       +L   L K+ + L+   +   A+ +   +++L+    EIED + + DEL  +Y+ +E+G+ TTA  V + ++L +     P I  +++ +  N + S+++  +L     +A A   LS N+  VP+V+  E S     E  + ++ +TN+    +  A +  E  K++ S AT++ + S T      ++EL+  + +   + G+Y    + + +       V   L VK+ ++V I NV+LS  ++DQ       +++  +        + H    + F    +  G +   PHQ FV+L +  T QE++FVAE D  +VYKF LD  +   +FD+ SG Y + LIIGDA++++P  W  A+V +  P         E   S   S+             T K +I H+F+  EKR   ++S  FT L +  P +++  LW  +G N SNF  A S I+FH+G  A+ GL Y YW+ LNMF TL+YL  LG +T   GNR+L Q A KR
Sbjct:   47 NLESAFYSIVGLSSLGAQVPDAKISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHL-SQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSASDTHEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQKTSFT--PVGDVFELNFMNVK--FSSGYYDFLVEVEGDNRYIANTVE--LRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAE-LTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPE--------EEAPSTVLSQNLF----------TPKQEIQHLFREPEKRPPTVVSNTFTALILS-PLLLLFALWIRIGANVSNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLAQQAVKR 596          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Human
Match: RPN2 (ribophorin II [Source:HGNC Symbol;Acc:HGNC:10382])

HSP 1 Score: 89.3521 bits (220), Expect = 1.637e-18
Identity = 79/340 (23.24%), Postives = 160/340 (47.06%), Query Frame = 3
Query:   78 ILGFTLIFSCIFFSSALKSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALMEIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIAT-SIFKNK--------------SELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFETSVVYKSEPKV-KVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLT 1049
            +L  T+I S    +    + YLT  D + +K+     L + FT+ ++   S+ G S L  +    K AC   ++  L+  N++ L+ +A  +  L   + ++    K   L  + + S++  ++  V  +S   L +       +L   L K+ + L++ +S  + + S+F  +              ++L+    EIED + + DEL  +Y+ +E+G+ TTA  V + ++L +     P I  +++ +  N + S+++  +L     +A A   LS N+  VP+V+  E S     E  + ++ +TN+    +  A +  E  K++ S AT++ + S T
Sbjct:   11 LLALTIIASTWALT---PTHYLTKHDVERLKA----SLDRPFTNLESAFYSIVGLSSLGAQVPDAKKACTYIRSN-LDPSNVDSLFYAAQASQALSGCEISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLARVWSTVLESRSLFSKRTVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSASDTHEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQKTSFT 342          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Human
Match: RPN2 (ribophorin II [Source:HGNC Symbol;Acc:HGNC:10382])

HSP 1 Score: 78.9518 bits (193), Expect = 1.010e-16
Identity = 61/185 (32.97%), Postives = 85/185 (45.95%), Query Frame = 3
Query: 1470 LDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            LD  +   +FD+ SG Y + LIIGDA++++P  W  A+V +  P                              P+TV  Q  ++F P ++                       + W  +G N SNF  A S I+FH+G  A+ GL Y YW+ LNMF TL+YL  LG +T   GNR+L Q A KR
Sbjct:    2 LDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEEE--------------------------APSTVLSQ--NLFTPKQE-----------------------IQWIRIGANVSNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLAQQAVKR 135          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Human
Match: RPN2 (ribophorin II [Source:HGNC Symbol;Acc:HGNC:10382])

HSP 1 Score: 66.2402 bits (160), Expect = 4.857e-12
Identity = 41/154 (26.62%), Postives = 81/154 (52.60%), Query Frame = 3
Query:  579 SIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFETSVVYKSEPKV-KVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTR 1037
            S    +++L+    EIED + + DEL  +Y+ +E+G+ TTA  V + ++L +     P I  +++ +  N + S+++  +L     +A A   LS N+  VP+V+  E S     E  + ++ +TN+    +  A +  E  K++ S AT++ +
Sbjct:   12 SHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSASDTHEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQK 165          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Celegans
Match: ostd-1 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:P91390])

HSP 1 Score: 143.28 bits (360), Expect = 6.204e-38
Identity = 94/281 (33.45%), Postives = 154/281 (54.80%), Query Frame = 3
Query: 1197 ISQVSIGNVELSVKERDQITGTLNYK-LSMGSLLSEKLNMNWHHRLDMKFVI--REGQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKRKE 2030
            +  V++ N ++ +  +DQ     N K +++ S L  +L  +   RL + F +  +      KPHQVF++    N  ++++ V   D N  Y ++  L  + K F NLSG +K+ L++GD +I++P NW FAN+   +P     E T +S+             ++   P     +I H+F+  EKR   LIS +FT +C+  P ++++VLWS VG+N  N   +    +FHVG+I IFG+Y+ +W   +MF TL+YL  LG LT   GNRVLR I+  +++
Sbjct:   18 VDDVAVNNFKVGILAKDQQPSDENLKTVALFSKLPNELKADASQRLYVSFTVAKKSDNAKVKPHQVFLRFVAQN-GEDVVVVVNPDANGNYVYDNVLRTAAKSFRNLSGQFKISLLVGDVTIKNPINWQFANIDAALPV--AYEPTPKSQ-------------QVHFEPLN---EISHIFRQPEKRPSALISDLFTIICL-SPLLILVVLWSQVGINFQNAPASPWVPIFHVGLIGIFGIYFMFWVQFDMFVTLKYLAVLGFLTFVAGNRVLRAISESKQK 278          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Celegans
Match: ostd-1 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:P91390])

HSP 1 Score: 143.28 bits (360), Expect = 6.204e-38
Identity = 94/281 (33.45%), Postives = 154/281 (54.80%), Query Frame = 3
Query: 1197 ISQVSIGNVELSVKERDQITGTLNYK-LSMGSLLSEKLNMNWHHRLDMKFVI--REGQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKRKE 2030
            +  V++ N ++ +  +DQ     N K +++ S L  +L  +   RL + F +  +      KPHQVF++    N  ++++ V   D N  Y ++  L  + K F NLSG +K+ L++GD +I++P NW FAN+   +P     E T +S+             ++   P     +I H+F+  EKR   LIS +FT +C+  P ++++VLWS VG+N  N   +    +FHVG+I IFG+Y+ +W   +MF TL+YL  LG LT   GNRVLR I+  +++
Sbjct:   18 VDDVAVNNFKVGILAKDQQPSDENLKTVALFSKLPNELKADASQRLYVSFTVAKKSDNAKVKPHQVFLRFVAQN-GEDVVVVVNPDANGNYVYDNVLRTAAKSFRNLSGQFKISLLVGDVTIKNPINWQFANIDAALPV--AYEPTPKSQ-------------QVHFEPLN---EISHIFRQPEKRPSALISDLFTIICL-SPLLILVVLWSQVGINFQNAPASPWVPIFHVGLIGIFGIYFMFWVQFDMFVTLKYLAVLGFLTFVAGNRVLRAISESKQK 278          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Fly
Match: OstDelta (gene:FBgn0034277 transcript:FBtr0089559)

HSP 1 Score: 220.32 bits (560), Expect = 7.032e-62
Identity = 193/669 (28.85%), Postives = 330/669 (49.33%), Query Frame = 3
Query:   78 ILGFTLIFSCIFFSSALKSPYLTTVD-----KDL--IKSVFNQGLSKGFTDAQAVALSVKGYSLLE--QKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALMEIDKISNIENLFKIVKTVSLLNLQID---IDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISF-ETSVVYKSEPKVKVSLTNLWGDQIGDAKLV--AETVKNIQST--ATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFYSVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIREGQQTFKP---HQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            +L   L+  C+  +S   +    TVD     KDL  ++ VF  G   G +D Q++  S     L +  QK    K    L   + LNS   +  Y+ A   +L  S K +  +  K  + +  +  S+ E  +++V T  +L ++I+    + +   L++ LKKD +     +++++A  +  + S +      +ED I QADE+D   + +E G+  T+ I+N  F +   + +  PI  ++  KFAN+ +SRR     K    L  ALK++S      P+ +       +    P + V++ +L G  +  A  V  A+ ++   S+  A  +T  S + D TT  Y  DL+S +   A+G Y  +  A       +G  +  L  KV+ +V + ++E+ + E D    T    ++    L E L+ +   +L +K V+ + + T KP   HQ FV+L +  T +EIIFVAE D +  YKF++D+  + K+F+  SG Y + L +GD+S+ +   WL A V+L                    ++     P+   GP    P+I H F+  +KR  +++S +FT LCI  P +++ V W  +G+N SN  LA S I FH+G   I  L++ +W  LNMF TL+ L+P+ + T   GNR+LR++ ++R
Sbjct:    1 MLKLGLVIFCVLVASG-PTWSARTVDSHLGQKDLSRLQKVFVDGF--GSSDLQSIFFSSLNIQLTDATQKEPLCKKIATLHSESKLNSFEKDYYYIGA-SRNLGCSAKIDEGLLSKVYSSLNSELGSSQEIFYRVV-THKVLGVEINEATQEKLVKRLQELLKKDDTLSGLGYAFNVAPLLGASASFIAN---RVEDAIVQADEVDGKLLQFEGGLSITSLIINGAFGVSKTFNKPVPITADQAVKFANYFLSRRSVQTAKGAHVLIEALKTISGADKIAPVCVQLIGNGQLDAQSPTLNVAVVDLLGKPLSPAPKVINAKVIRKKDSSVLADKITVASKSSDKTT--YVADLASLKP--ARGVYQAELSA-------DGVYTQTLQFKVLGRVKVQSLEVGIAESDASAATRKQSVTYPGKLQEVLSADSTQKLLLKAVLVD-ESTSKPLAVHQAFVRLYNKKTDKEIIFVAEQDSSKAYKFDMDVGNNGKNFNYQSGTYSIYLTVGDSSLSNSFEWLVAEVQLKF------------------NEDKEVKPKNTSGPL---PEIIHQFRVPDKRPPRIVSDIFTGLCIT-PLVLLFVFWGKLGINVSNLTLAPSTIGFHLGFGGILVLFFVFWLQLNMFQTLRLLIPIAVFTFLAGNRLLRRLYAQR 627          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Fly
Match: OstDelta (gene:FBgn0034277 transcript:FBtr0340276)

HSP 1 Score: 219.935 bits (559), Expect = 9.597e-62
Identity = 193/669 (28.85%), Postives = 328/669 (49.03%), Query Frame = 3
Query:   78 ILGFTLIFSCIFFSSALKSPYLTTVD-----KDL--IKSVFNQGLSKGFTDAQAVALSVKGYSLLE--QKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALMEIDKISNIENLFKIVKTVSLLNLQID---IDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISF-ETSVVYKSEPKVKVSLTNLWGDQIGDAKLV--AETVKNIQST--ATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFYSVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIREGQQTFKP---HQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            +L   L+  C+  +S   +    TVD     KDL  ++ VF  G   G +D Q++  S     L +  QK    K    L   + LNS   +  Y+ A   +L  S K +  +  K  + +  +  S+ E  +++V T  +L ++I+    + +   L++ LKKD +     +++++A  +  + S +      +ED I QADE+D   + +E G+  T+ I+N  F +   + +  PI  ++  KFAN+ +SRR     K    L  ALK++S      P+ +       +    P + V++ +L G  +  A  V  A+ ++   S+  A  +T  S + D TT  Y  DL+S +   A+G Y  +  A       +G  +  L  KV+ +V + ++E+ + E D    T    ++    L E L+ +   +L +K V+ + + T KP   HQ FV+L +  T +EIIFVAE D +  YKF++D+  + K+F+  SG Y + L +GD+S+ +   WL A V+L                           P+   GP    P+I H F+  +KR  +++S +FT LCI  P +++ V W  +G+N SN  LA S I FH+G   I  L++ +W  LNMF TL+ L+P+ + T   GNR+LR++ ++R
Sbjct:    1 MLKLGLVIFCVLVASG-PTWSARTVDSHLGQKDLSRLQKVFVDGF--GSSDLQSIFFSSLNIQLTDATQKEPLCKKIATLHSESKLNSFEKDYYYIGA-SRNLGCSAKIDEGLLSKVYSSLNSELGSSQEIFYRVV-THKVLGVEINEATQEKLVKRLQELLKKDDTLSGLGYAFNVAPLLGASASFIAN---RVEDAIVQADEVDGKLLQFEGGLSITSLIINGAFGVSKTFNKPVPITADQAVKFANYFLSRRSVQTAKGAHVLIEALKTISGADKIAPVCVQLIGNGQLDAQSPTLNVAVVDLLGKPLSPAPKVINAKVIRKKDSSVLADKITVASKSSDKTT--YVADLASLKP--ARGVYQAELSA-------DGVYTQTLQFKVLGRVKVQSLEVGIAESDASAATRKQSVTYPGKLQEVLSADSTQKLLLKAVLVD-ESTSKPLAVHQAFVRLYNKKTDKEIIFVAEQDSSKAYKFDMDVGNNGKNFNYQSGTYSIYLTVGDSSLSNSFEWLVAEVQLKF-------------------NEDKVKPKNTSGPL---PEIIHQFRVPDKRPPRIVSDIFTGLCIT-PLVLLFVFWGKLGINVSNLTLAPSTIGFHLGFGGILVLFFVFWLQLNMFQTLRLLIPIAVFTFLAGNRLLRRLYAQR 626          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Zebrafish
Match: rpn2 (ribophorin II [Source:ZFIN;Acc:ZDB-GENE-030131-7928])

HSP 1 Score: 219.55 bits (558), Expect = 2.099e-61
Identity = 191/663 (28.81%), Postives = 331/663 (49.92%), Query Frame = 3
Query:   69 VMSILGFTLIFSCIFFSSALKSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALM--EIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLV-ISFETSVVYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFYSVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIRE---GQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKL-----DMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            V S+L  +L+       +   S +LTT D   +++V +Q L    TD ++   SV G   L          C   K+  L+  ++  L+ +A  +  L    C + V+     L+   + + S +  +   V  +S L L +    V  +L+  + K+ + L+   +   A  +   ++EL     EIED   + D+L  +Y+ +EDG+  TA  V + + L +  +  PP+  E++ +  N + S++   +L     +  A  +LS N   VP++ I+   + V  S+P +++ +T++    +  A ++ E+  ++ S + I+++   T     G++EL+  ++Q     G+Y  +F   I   R        L VKV ++V+I N++LSV ++DQ  G    ++   +        + H    M F + +   G +   PHQ FV+L +  T QE++FVAE D  ++YKF LD  +   +FD++SG Y + L++GDA++E+P  W  A+V L     + PST                 +++  P         KP+I H+F+  EK+   ++S  FT L +  PF+++++LW  +G N SNF L+ S ILFH+G   + GL Y YW+HLNMF TL+YL  +G LT   GNR+L Q A KR
Sbjct:    6 VFSVLVLSLVIET---QTLTPSHHLTTTDVARLQAVLSQPL----TDLKSAYYSVVGLRKLGIFVADADETCRFIKSN-LDPSSVESLFYAAESSQALTG--CEILVSNDTRDLLLATVSEDSTVSQIHHSVSALSSLGLPLASQEVVSALKSRISKEDNVLAIILALQTAARL-SQQAELGDILEEIEDLAARLDDLGGVYLQFEDGLEATALFVTAAYALSDHVDVEPPLKEEQVIQLVNSIFSKKSWDSLSEAFSVVSAAAALSNNHFHVPVIAIAQGPAAVSHSQPFLQLQVTDVLCQPLSSASVLVESASSVSSKSAILSQAPFTFRD--GIFELNFMANQP--TSGYY--QFSVAIAGDRRFVANHVELKVKVSTRVAINNMDLSVVDKDQSIGPKTTRVEYPTKAKSSFMADSHQNFVMTFQLVDEITGVE-LTPHQTFVRLHNQKTGQEVVFVAEPDSKNLYKFELDTAERKAEFDSISGTYALYLMVGDATLENPVLWNVADVVLKFLDEEAPST--------------IQAKTLYIP---------KPEIKHLFREPEKKPPTVVSNTFTALVLS-PFLLLLILWFKLGANISNFTLSPSTILFHIGHATMLGLMYVYWTHLNMFQTLKYLAIIGSLTFLAGNRMLAQKAVKR 626          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Zebrafish
Match: rpn2 (ribophorin II [Source:ZFIN;Acc:ZDB-GENE-030131-7928])

HSP 1 Score: 219.55 bits (558), Expect = 2.099e-61
Identity = 191/663 (28.81%), Postives = 331/663 (49.92%), Query Frame = 3
Query:   69 VMSILGFTLIFSCIFFSSALKSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALM--EIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLV-ISFETSVVYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFYSVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIRE---GQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKL-----DMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            V S+L  +L+       +   S +LTT D   +++V +Q L    TD ++   SV G   L          C   K+  L+  ++  L+ +A  +  L    C + V+     L+   + + S +  +   V  +S L L +    V  +L+  + K+ + L+   +   A  +   ++EL     EIED   + D+L  +Y+ +EDG+  TA  V + + L +  +  PP+  E++ +  N + S++   +L     +  A  +LS N   VP++ I+   + V  S+P +++ +T++    +  A ++ E+  ++ S + I+++   T     G++EL+  ++Q     G+Y  +F   I   R        L VKV ++V+I N++LSV ++DQ  G    ++   +        + H    M F + +   G +   PHQ FV+L +  T QE++FVAE D  ++YKF LD  +   +FD++SG Y + L++GDA++E+P  W  A+V L     + PST                 +++  P         KP+I H+F+  EK+   ++S  FT L +  PF+++++LW  +G N SNF L+ S ILFH+G   + GL Y YW+HLNMF TL+YL  +G LT   GNR+L Q A KR
Sbjct:    6 VFSVLVLSLVIET---QTLTPSHHLTTTDVARLQAVLSQPL----TDLKSAYYSVVGLRKLGIFVADADETCRFIKSN-LDPSSVESLFYAAESSQALTG--CEILVSNDTRDLLLATVSEDSTVSQIHHSVSALSSLGLPLASQEVVSALKSRISKEDNVLAIILALQTAARL-SQQAELGDILEEIEDLAARLDDLGGVYLQFEDGLEATALFVTAAYALSDHVDVEPPLKEEQVIQLVNSIFSKKSWDSLSEAFSVVSAAAALSNNHFHVPVIAIAQGPAAVSHSQPFLQLQVTDVLCQPLSSASVLVESASSVSSKSAILSQAPFTFRD--GIFELNFMANQP--TSGYY--QFSVAIAGDRRFVANHVELKVKVSTRVAINNMDLSVVDKDQSIGPKTTRVEYPTKAKSSFMADSHQNFVMTFQLVDEITGVE-LTPHQTFVRLHNQKTGQEVVFVAEPDSKNLYKFELDTAERKAEFDSISGTYALYLMVGDATLENPVLWNVADVVLKFLDEEAPST--------------IQAKTLYIP---------KPEIKHLFREPEKKPPTVVSNTFTALVLS-PFLLLLILWFKLGANISNFTLSPSTILFHIGHATMLGLMYVYWTHLNMFQTLKYLAIIGSLTFLAGNRMLAQKAVKR 626          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Zebrafish
Match: rpn2 (ribophorin II [Source:ZFIN;Acc:ZDB-GENE-030131-7928])

HSP 1 Score: 217.238 bits (552), Expect = 1.118e-60
Identity = 189/655 (28.85%), Postives = 328/655 (50.08%), Query Frame = 3
Query:   93 LIFSCIFFSSAL-KSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALM--EIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLV-ISFETSVVYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFYSVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIRE---GQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKL-----DMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASK 2021
            L+ S +  +  L  S +LTT D   +++V +Q L    TD ++   SV G   L          C   K+  L+  ++  L+ +A  +  L    C + V+     L+   + + S +  +   V  +S L L +    V  +L+  + K+ + L+   +   A  +   ++EL     EIED   + D+L  +Y+ +EDG+  TA  V + + L +  +  PP+  E++ +  N + S++   +L     +  A  +LS N   VP++ I+   + V  S+P +++ +T++    +  A ++ E+  ++ S + I+++   T     G++EL+  ++Q     G+Y  +F   I   R        L VKV ++V+I N++LSV ++DQ  G    ++   +        + H    M F + +   G +   PHQ FV+L +  T QE++FVAE D  ++YKF LD  +   +FD++SG Y + L++GDA++E+P  W  A+V L     + PST                 +++  P         KP+I H+F+  EK+   ++S  FT L +  PF+++++LW  +G N SNF L+ S ILFH+G   + GL Y YW+HLNMF TL+YL  +G LT   GNR+L Q A K
Sbjct:   10 LVLSLVIETQTLTPSHHLTTTDVARLQAVLSQPL----TDLKSAYYSVVGLRKLGIFVADADETCRFIKSN-LDPSSVESLFYAAESSQALTG--CEILVSNDTRDLLLATVSEDSTVSQIHHSVSALSSLGLPLASQEVVSALKSRISKEDNVLAIILALQTAARL-SQQAELGDILEEIEDLAARLDDLGGVYLQFEDGLEATALFVTAAYALSDHVDVEPPLKEEQVIQLVNSIFSKKSWDSLSEAFSVVSAAAALSNNHFHVPVIAIAQGPAAVSHSQPFLQLQVTDVLCQPLSSASVLVESASSVSSKSAILSQAPFTFRD--GIFELNFMANQP--TSGYY--QFSVAIAGDRRFVANHVELKVKVSTRVAINNMDLSVVDKDQSIGPKTTRVEYPTKAKSSFMADSHQNFVMTFQLVDEITGVE-LTPHQTFVRLHNQKTGQEVVFVAEPDSKNLYKFELDTAERKAEFDSISGTYALYLMVGDATLENPVLWNVADVVLKFLDEEAPST--------------IQAKTLYIP---------KPEIKHLFREPEKKPPTVVSNTFTALVLS-PFLLLLILWFKLGANISNFTLSPSTILFHIGHATMLGLMYVYWTHLNMFQTLKYLAIIGSLTFLAGNRMLAQKAVK 625          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Zebrafish
Match: rpn2 (ribophorin II [Source:ZFIN;Acc:ZDB-GENE-030131-7928])

HSP 1 Score: 185.267 bits (469), Expect = 1.000e-49
Identity = 165/610 (27.05%), Postives = 299/610 (49.02%), Query Frame = 3
Query:   93 LIFSCIFFSSAL-KSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALM--EIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLV-ISFETSVVYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFYSVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIRE---GQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKL-----DMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVG 1886
            L+ S +  +  L  S +LTT D   +++V +Q L    TD ++   SV G   L          C   K+  L+  ++  L+ +A  +  L    C + V+     L+   + + S +  +   V  +S L L +    V  +L+  + K+ + L+   +   A  +   ++EL     EIED   + D+L  +Y+ +EDG+  TA  V + + L +  +  PP+  E++ +  N + S++   +L     +  A  +LS N   VP++ I+   + V  S+P +++ +T++    +  A ++ E+  ++ S + I+++   T     G++EL+  ++Q     G+Y  +F   I   R        L VKV ++V+I N++LSV ++DQ  G    ++   +        + H    M F + +   G +   PHQ FV+L +  T QE++FVAE D  ++YKF LD  +   +FD++SG Y + L++GDA++E+P  W  A+V L     + PST                 +++  P         KP+I H+F+  EK+   ++S  FT L +  PF+++++LW  +G N SNF L+ S ILFH+G
Sbjct:   10 LVLSLVIETQTLTPSHHLTTTDVARLQAVLSQPL----TDLKSAYYSVVGLRKLGIFVADADETCRFIKSN-LDPSSVESLFYAAESSQALTG--CEILVSNDTRDLLLATVSEDSTVSQIHHSVSALSSLGLPLASQEVVSALKSRISKEDNVLAIILALQTAARL-SQQAELGDILEEIEDLAARLDDLGGVYLQFEDGLEATALFVTAAYALSDHVDVEPPLKEEQVIQLVNSIFSKKSWDSLSEAFSVVSAAAALSNNHFHVPVIAIAQGPAAVSHSQPFLQLQVTDVLCQPLSSASVLVESASSVSSKSAILSQAPFTFRD--GIFELNFMANQP--TSGYY--QFSVAIAGDRRFVANHVELKVKVSTRVAINNMDLSVVDKDQSIGPKTTRVEYPTKAKSSFMADSHQNFVMTFQLVDEITGVE-LTPHQTFVRLHNQKTGQEVVFVAEPDSKNLYKFELDTAERKAEFDSISGTYALYLMVGDATLENPVLWNVADVVLKFLDEEAPST--------------IQAKTLYIP---------KPEIKHLFREPEKKPPTVVSNTFTALVLS-PFLLLLILWFKLGANISNFTLSPSTILFHIG 580          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Zebrafish
Match: rpn2 (ribophorin II [Source:ZFIN;Acc:ZDB-GENE-030131-7928])

HSP 1 Score: 51.2174 bits (121), Expect = 1.042e-6
Identity = 52/220 (23.64%), Postives = 98/220 (44.55%), Query Frame = 3
Query:   93 LIFSCIFFSSAL-KSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALM--EIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYE 743
            L+ S +  +  L  S +LTT D   +++V +Q L    TD ++   SV G   L          C   K+  L+  ++  L+ +A  +  L    C + V+     L+   + + S +  +   V  +S L L +    V  +L+  + K+ + L+   +   A  +   ++EL     EIED   + D+L  +Y+ +EDG+  TA  V + + L +  +
Sbjct:   10 LVLSLVIETQTLTPSHHLTTTDVARLQAVLSQPL----TDLKSAYYSVVGLRKLGIFVADADETCRFIKSN-LDPSSVESLFYAAESSQALTG--CEILVSNDTRDLLLATVSEDSTVSQIHHSVSALSSLGLPLASQEVVSALKSRISKEDNVLAIILALQTAARL-SQQAELGDILEEIEDLAARLDDLGGVYLQFEDGLEATALFVTAAYALSDHVD 221          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Xenopus
Match: gal3st4.1 (galactose-3-O-sulfotransferase 4, gene1 [Source:Xenbase;Acc:XB-GENE-947534])

HSP 1 Score: 229.565 bits (584), Expect = 5.090e-65
Identity = 177/638 (27.74%), Postives = 313/638 (49.06%), Query Frame = 3
Query:  132 SPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALM--EIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFE-TSVVYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFYSVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIRE--GQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKRKE 2030
            S YL+  D D +K    Q +S      +     V G   L      E++AC+  ++  ++S +++ L+ +A  +  L S  C + ++ +   L+   I + S++  ++  V  +S   L      V  +L   L K+ + L+      +  S    +++L+    EIED + + D+L   Y+ +E+G+  TA  V + + L +     P +  E++    N + SR++  ++     +A A  +LS N   +PL++  +  + V   +P +K+ +TN+    + +AK+     K+  + AT++ + + +    T  +EL+   ++   A G+Y      +  + RF       L VKV ++V IGNV+LS+ ++DQ       +++  S        + H    + F + +     +  PHQ FV+L +  T QE++FVAE D  + Y+F LD  +   +FD+ SG Y + LI+GDA++E+P  W  A+V +  P         E    V    +++  P         KP I H+F+  EKR   ++S  FT L +  P +++ +LW  +G N SN   + S I+FH+G  A+ GL Y YW+ LNMF TL+YL  +G +T   GNR+L   A KR E
Sbjct:   26 SHYLSHADVDRLKDTLEQPVSS----LENAYYYVVGLKALGHTVSDEQAACDFIRSN-VDSGSVDSLFYAAQASQALSS--CEVTISNETRDLLLGAISEDSSVTQIYHAVGALSGFGLPFASQEVVSALTTRLSKEENVLA-TIEALLTASFLSQQADLRGIVEEIEDLVARLDDLGGQYLQFEEGLEATALFVAATYRLSDHVGMEPALKEEQIVPLMNAIFSRKNFDSISEAFSVALAASALSHNHYHIPLIVVPDGPAAVSHKQPLLKLLVTNVLSQPLTEAKVKVNQAKSSSTKATVLQQATFSASGDT--FELNFMDAKP--ASGYYDFSISVE-GDLRFLASQVE-LKVKVSTEVGIGNVDLSIVDKDQSISPKTTRVNFPSKAKGPFTADSHQNFALSFQLTDVNTGASLTPHQTFVRLHNQKTGQEVVFVAEPDNKNTYRFELDPSERKSEFDSASGTYTLYLIVGDATLENPILWNVADVLIKFP---------EEDSPVPIQSKNLFIP---------KPDIQHLFREPEKRPPTVVSNTFTALVLA-PLLLLFILWIKIGANISNISFSPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAMIGTITFLAGNRMLAHKAVKRAE 630          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Xenopus
Match: gal3st4.1 (galactose-3-O-sulfotransferase 4, gene1 [Source:Xenbase;Acc:XB-GENE-947534])

HSP 1 Score: 228.794 bits (582), Expect = 8.453e-65
Identity = 177/644 (27.48%), Postives = 315/644 (48.91%), Query Frame = 3
Query:  108 IFFSSALKSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALM--EIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFE-TSVVYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFYSVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIRE--GQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            +F  +   S YL+  D D +K    Q +S      +     V G   L      E++AC+  ++  ++S +++ L+ +A  +  L S  C + ++ +   L+   I + S++  ++  V  +S   L      V  +L   L K+ + L+      +  S    +++L+    EIED + + D+L   Y+ +E+G+  TA  V + + L +     P +  E++    N + SR++  ++     +A A  +LS N   +PL++  +  + V   +P +K+ +TN+    + +AK+     K+  + AT++ + + +    T  +EL+   ++   A G+Y      +  + RF       L VKV ++V IGNV+LS+ ++DQ       +++  S        + H    + F + +     +  PHQ FV+L +  T QE++FVAE D  + Y+F LD  +   +FD+ SG Y + LI+GDA++E+P  W  A+V +  P         E    V    +++  P         KP I H+F+  EKR   ++S  FT L +  P +++ +LW  +G N SN   + S I+FH+G  A+ GL Y YW+ LNMF TL+YL  +G +T   GNR+L   A KR
Sbjct:   14 VFVQALNPSHYLSHADVDRLKDTLEQPVSS----LENAYYYVVGLKALGHTVSDEQAACDFIRSN-VDSGSVDSLFYAAQASQALSS--CEVTISNETRDLLLGAISEDSSVTQIYHAVGALSGFGLPFASQEVVSALTTRLSKEENVLA-TIEALLTASFLSQQADLRGIVEEIEDLVARLDDLGGQYLQFEEGLEATALFVAATYRLSDHVGMEPALKEEQIVPLMNAIFSRKNFDSISEAFSVALAASALSHNHYHIPLIVVPDGPAAVSHKQPLLKLLVTNVLSQPLTEAKVKVNQAKSSSTKATVLQQATFSASGDT--FELNFMDAKP--ASGYYDFSISVE-GDLRFLASQVE-LKVKVSTEVGIGNVDLSIVDKDQSISPKTTRVNFPSKAKGPFTADSHQNFALSFQLTDVNTGASLTPHQTFVRLHNQKTGQEVVFVAEPDNKNTYRFELDPSERKSEFDSASGTYTLYLIVGDATLENPILWNVADVLIKFP---------EEDSPVPIQSKNLFIP---------KPDIQHLFREPEKRPPTVVSNTFTALVLA-PLLLLFILWIKIGANISNISFSPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAMIGTITFLAGNRMLAHKAVKR 624          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Xenopus
Match: gal3st4.1 (galactose-3-O-sulfotransferase 4, gene1 [Source:Xenbase;Acc:XB-GENE-947534])

HSP 1 Score: 229.18 bits (583), Expect = 1.025e-64
Identity = 177/638 (27.74%), Postives = 314/638 (49.22%), Query Frame = 3
Query:  132 SPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALM--EIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFE-TSVVYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFYSVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIRE--GQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKRKE 2030
            S YL+  D D +K    Q +S      +     V G   L      E++AC+  ++  ++S +++ L+ +A  +  L S  C + ++ +   L+   I + S++  ++  V  +S   L      V  +L   L K+ + L+   +  +  S    +++L+    EIED + + D+L   Y+ +E+G+  TA  V + + L +     P +  E++    N + SR++  ++     +A A  +LS N   +PL++  +  + V   +P +K+ +TN+    + +AK+     K+  + AT++ + + +    T  +EL+   ++   A G+Y      +  + RF       L VKV ++V IGNV+LS+ ++DQ       +++  S        + H    + F + +     +  PHQ FV+L +  T QE++FVAE D  + Y+F LD  +   +FD+ SG Y + LI+GDA++E+P  W  A+V +  P         E    V    +++  P         KP I H+F+  EKR   ++S  FT L +  P +++ +LW  +G N SN   + S I+FH+G  A+ GL Y YW+ LNMF TL+YL  +G +T   GNR+L   A KR E
Sbjct:   46 SHYLSHADVDRLKDTLEQPVSS----LENAYYYVVGLKALGHTVSDEQAACDFIRSN-VDSGSVDSLFYAAQASQALSS--CEVTISNETRDLLLGAISEDSSVTQIYHAVGALSGFGLPFASQEVVSALTTRLSKEENVLATIEAL-LTASFLSQQADLRGIVEEIEDLVARLDDLGGQYLQFEEGLEATALFVAATYRLSDHVGMEPALKEEQIVPLMNAIFSRKNFDSISEAFSVALAASALSHNHYHIPLIVVPDGPAAVSHKQPLLKLLVTNVLSQPLTEAKVKVNQAKSSSTKATVLQQATFSASGDT--FELNFMDAKP--ASGYYDFSISVE-GDLRFLASQVE-LKVKVSTEVGIGNVDLSIVDKDQSISPKTTRVNFPSKAKGPFTADSHQNFALSFQLTDVNTGASLTPHQTFVRLHNQKTGQEVVFVAEPDNKNTYRFELDPSERKSEFDSASGTYTLYLIVGDATLENPILWNVADVLIKFP---------EEDSPVPIQSKNLFIP---------KPDIQHLFREPEKRPPTVVSNTFTALVLA-PLLLLFILWIKIGANISNISFSPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAMIGTITFLAGNRMLAHKAVKRAE 650          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Xenopus
Match: gal3st4.1 (galactose-3-O-sulfotransferase 4, gene1 [Source:Xenbase;Acc:XB-GENE-947534])

HSP 1 Score: 227.639 bits (579), Expect = 5.774e-64
Identity = 176/636 (27.67%), Postives = 312/636 (49.06%), Query Frame = 3
Query:  132 SPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALM--EIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFE-TSVVYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFYSVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIRE--GQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            S YL+  D D +K    Q +S      +     V G   L      E++AC+  ++  ++S +++ L+ +A  +  L S  C + ++ +   L+   I + S++  ++  V  +S   L      V  +L   L K+ + L+      +  S    +++L+    EIED + + D+L   Y+ +E+G+  TA  V + + L +     P +  E++    N + SR++  ++     +A A  +LS N   +PL++  +  + V   +P +K+ +TN+    + +AK+     K+  + AT++ + + +    T  +EL+   ++   A G+Y      +  + RF       L VKV ++V IGNV+LS+ ++DQ       +++  S        + H    + F + +     +  PHQ FV+L +  T QE++FVAE D  + Y+F LD  +   +FD+ SG Y + LI+GDA++E+P  W  A+V +  P         E    V    +++  P         KP I H+F+  EKR   ++S  FT L +  P +++ +LW  +G N SN   + S I+FH+G  A+ GL Y YW+ LNMF TL+YL  +G +T   GNR+L   A KR
Sbjct:   46 SHYLSHADVDRLKDTLEQPVSS----LENAYYYVVGLKALGHTVSDEQAACDFIRSN-VDSGSVDSLFYAAQASQALSS--CEVTISNETRDLLLGAISEDSSVTQIYHAVGALSGFGLPFASQEVVSALTTRLSKEENVLA-TIEALLTASFLSQQADLRGIVEEIEDLVARLDDLGGQYLQFEEGLEATALFVAATYRLSDHVGMEPALKEEQIVPLMNAIFSRKNFDSISEAFSVALAASALSHNHYHIPLIVVPDGPAAVSHKQPLLKLLVTNVLSQPLTEAKVKVNQAKSSSTKATVLQQATFSASGDT--FELNFMDAKP--ASGYYDFSISVE-GDLRFLASQVE-LKVKVSTEVGIGNVDLSIVDKDQSISPKTTRVNFPSKAKGPFTADSHQNFALSFQLTDVNTGASLTPHQTFVRLHNQKTGQEVVFVAEPDNKNTYRFELDPSERKSEFDSASGTYTLYLIVGDATLENPILWNVADVLIKFP---------EEDSPVPIQSKNLFIP---------KPDIQHLFREPEKRPPTVVSNTFTALVLA-PLLLLFILWIKIGANISNISFSPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAMIGTITFLAGNRMLAHKAVKR 648          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Xenopus
Match: gal3st4.1 (galactose-3-O-sulfotransferase 4, gene1 [Source:Xenbase;Acc:XB-GENE-947534])

HSP 1 Score: 221.861 bits (564), Expect = 2.663e-62
Identity = 175/636 (27.52%), Postives = 308/636 (48.43%), Query Frame = 3
Query:  132 SPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALM--EIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFE-TSVVYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFYSVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIRE--GQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            S YL+  D D +K    Q +S      +     V G   L      E+  C+  ++  ++S +++ L+ +A  +  L S  C + ++ +   L+   I + S++  ++  V  +S   L      V  +L   L K+ + L+      +  S    +++L+    EIED + + D+L   Y+ +E+G+  TA  V + + L +     P +  E++    N + SR++  ++     +A A  +LS N   +PL++  +  + V   +P +K+ +TN+    + +AK+     K+  + AT++ +       T   +EL+   ++   A G+Y      +  + RF       L VKV ++V IGNV+LS+ ++DQ       +++  S        + H    + F + +     +  PHQ FV+L +  T QE++FVAE D  + Y+F LD  +   +FD+ SG Y + LI+GDA++E+P  W  A+V +  P         E    V    +++  P         KP I H+F+  EKR   ++S  FT L +  P +++ +LW  +G N SN   + S I+FH+G  A+ GL Y YW+ LNMF TL+YL  +G +T   GNR+L   A KR
Sbjct:    8 SHYLSHADVDRLKDTLEQPVSS----LENAYYYVVGLKALGHTVSDEQVTCDFIRSN-VDSGSVDSLFYAAQASQALSS--CEVTISNETRDLLLGAISEDSSVTQIYHAVGALSGFGLPFASQEVVSALTTRLSKEENVLA-TIEALLTASFLSQQADLRGIVEEIEDLVARLDDLGGQYLQFEEGLEATALFVAATYRLSDHVGMEPALKEEQIVPLMNAIFSRKNFDSISEAFSVALAASALSHNHYHIPLIVVPDGPAAVSHKQPLLKLLVTNVLSQPLTEAKVKVNQAKSSSTKATVLQQCMFCFRDT---FELNFMDAKP--ASGYYDFSISVE-GDLRFLASQVE-LKVKVSTEVGIGNVDLSIVDKDQSISPKTTRVNFPSKAKGPFTADSHQNFALSFQLTDVNTGASLTPHQTFVRLHNQKTGQEVVFVAEPDNKNTYRFELDPSERKSEFDSASGTYTLYLIVGDATLENPILWNVADVLIKFP---------EEDSPVPIQSKNLFIP---------KPDIQHLFREPEKRPPTVVSNTFTALVLA-PLLLLFILWIKIGANISNISFSPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAMIGTITFLAGNRMLAHKAVKR 609          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Mouse
Match: Rpn2 (ribophorin II [Source:MGI Symbol;Acc:MGI:98085])

HSP 1 Score: 219.164 bits (557), Expect = 2.140e-61
Identity = 183/637 (28.73%), Postives = 324/637 (50.86%), Query Frame = 3
Query:  138 YLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALM--EIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFETSVVYKSEPKV-KVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTG-LYELDLSSSQDLLAKGFYSVKFDAKI-NETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFV---IREGQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            YLT  D + +K+     L + FTD ++   S+ G S L  +    K AC   K+  L+  N++ L+ +A  + +L    C + V+ +   L+   + + S I  ++  V  +S   L +  +    +L   L K+ + L+   +   A+ +   +++L+    EIED + + DEL  +Y+ +E+G+  TA  V + ++L +     P +  +++ +  N + S+++  +L     +A A  +LS+N+  VP+V+  E S     E  + ++ ++N+    +  A +  E  K+  + AT++ +      S  G ++EL+  + +  L+ G+Y   F  ++  ++R+       L VK+ ++V I NV+LS  ++DQ       +++  +        + H    + F    +  G +   PHQ FV+L +  T QE++FVAE D  +VYKF LD  +   +FD+ SG Y + LIIGDA++++P  W  A+V +  P         E+  +V    +S+  P         K +I H+F+  EKR   ++S  FT L +  P +++  LW  +G N SNF  A S ++FH+G  A+ GL Y YW+ LNMF TL+YL  LG +T   GNR+L Q A KR
Sbjct:   28 YLTKQDVERLKA----SLDRPFTDLESAFYSIVGLSSLGVQVPDVKKACTFIKSN-LDPSNVDSLFYAAQSSQVLSG--CEISVSNETKELLLAAVSEDSPIAQIYHAVAALSGFGLPLASNEALGALTARLGKEETVLATVQALQTASHL-SQQADLRNIVEEIEDLVARLDELGGVYLQFEEGLELTALFVAATYKLMDHVGTEPSMKEDQVIQLMNTIFSKKNFESLSEAFSVASAAAALSQNRYHVPVVVVPEGSTSDTQEQAILRLQVSNVLSQPLAQAAVKLEHAKSAATRATVLQKTPF---SLVGNVFELNFKNVK--LSSGYYD--FSVRVEGDSRYIANTVE-LRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAE-LTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEE-------EAPSTVLS--QSLFTP---------KQEIQHLFREPEKRPPTVVSNTFTALILS-PLLLLFALWIRIGANVSNFTFAPSTVIFHLGHAAMLGLMYIYWTQLNMFQTLKYLAVLGTVTFLAGNRMLAQHAVKR 628          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Mouse
Match: Rpn2 (ribophorin II [Source:MGI Symbol;Acc:MGI:98085])

HSP 1 Score: 194.897 bits (494), Expect = 9.439e-53
Identity = 159/545 (29.17%), Postives = 280/545 (51.38%), Query Frame = 3
Query:  408 LMEIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFETSVVYKSEPKV-KVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTG-LYELDLSSSQDLLAKGFYSVKFDAKI-NETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFV---IREGQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            L  + + S I  ++  V  +S   L +  +    +L   L K+ + L+   +   A+ +   +++L+    EIED + + DEL  +Y+ +E+G+  TA  V + ++L +     P +  +++ +  N + S+++  +L     +A A  +LS+N+  VP+V+  E S     E  + ++ ++N+    +  A +  E  K+  + AT++ +      S  G ++EL+  + +  L+ G+Y   F  ++  ++R+       L VK+ ++V I NV+LS  ++DQ       +++  +        + H    + F    +  G +   PHQ FV+L +  T QE++FVAE D  +VYKF LD  +   +FD+ SG Y + LIIGDA++++P  W  A+V +  P         E+  +V    +S+  P         K +I H+F+  EKR   ++S  FT L +  P +++  LW  +G N SNF  A S ++FH+G  A+ GL Y YW+ LNMF TL+YL  LG +T   GNR+L Q A KR
Sbjct:   81 LAAVSEDSPIAQIYHAVAALSGFGLPLASNEALGALTARLGKEETVLATVQALQTASHL-SQQADLRNIVEEIEDLVARLDELGGVYLQFEEGLELTALFVAATYKLMDHVGTEPSMKEDQVIQLMNTIFSKKNFESLSEAFSVASAAAALSQNRYHVPVVVVPEGSTSDTQEQAILRLQVSNVLSQPLAQAAVKLEHAKSAATRATVLQKTPF---SLVGNVFELNFKNVK--LSSGYYD--FSVRVEGDSRYIANTVE-LRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAE-LTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEE-------EAPSTVLS--QSLFTP---------KQEIQHLFREPEKRPPTVVSNTFTALILS-PLLLLFALWIRIGANVSNFTFAPSTVIFHLGHAAMLGLMYIYWTQLNMFQTLKYLAVLGTVTFLAGNRMLAQHAVKR 596          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. UniProt/SwissProt
Match: sp|Q5RBM1|RPN2_PONAB (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Pongo abelii OX=9601 GN=RPN2 PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 2.893e-64
Identity = 190/661 (28.74%), Postives = 326/661 (49.32%), Query Frame = 3
Query:   72 MSILG----FTLIFSCIFFSSAL-KSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALMEIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFETSVVYKSEPKV-KVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFYSVKFDAKI-NETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFV---IREGQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            M+ LG    F L  + I  + AL  + YLT  D + +K+     L + FT+ ++   S+ G S L  +    K AC   ++  L+  N++ L+ +A  +  L   + ++    K   L  + + S++  ++  V  +S   L +       +L   L K+ + L+   +   A+ +   +++L+    EIED + + DEL  +Y+ +E+G+ TTA  V + ++L +     P I  +++ +  N + S+++  +L     +A     LS N+  VP+V+  E S     E  + ++ +TN+    +  A +  E  K++ S AT++ + S T      ++EL+  + +   + G+Y   F  K+  + R+       L VK+ ++V I NV+LS  ++DQ       +++  +        + H    + F    +  G +   PHQ FV+L +  T QE++FVAE D  +VYKF LD  +   +FD+ SG Y + LIIGDA++++P  W  A+V +  P         E   S   S+             T K +I H+F+  EKR   ++S  FT L +  P +++  LW  +G N SNF    S I+FH+G  A+ GL Y YW+ LNMF TL+YL  LG +T   GNR+L Q A KR
Sbjct:    1 MAPLGSSTVFLLALTIIASTRALTPTHYLTKHDVERLKA----SLDRPFTNLESAFYSIVGLSSLGAQVPDAKKACTYIRSN-LDPSNVDSLFYAAQASQALSGCEISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHL-SQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASVAAVLSHNRYHVPVVVVPEGSASDTHEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQKTSFT--PVGDVFELNFMNVK--FSSGYYD--FLVKVEGDNRYIANTVE-LRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAE-LTPHQTFVRLHNQKTGQEVVFVAEPDSKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPE--------EEAPSTVLSQNLF----------TPKQEIQHLFREPEKRPPTVVSNTFTALILS-PLLLLFALWIRIGANVSNFTFTPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLAQQAVKR 628          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. UniProt/SwissProt
Match: sp|Q3SZI6|RPN2_BOVIN (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Bos taurus OX=9913 GN=RPN2 PE=2 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 6.210e-64
Identity = 193/657 (29.38%), Postives = 327/657 (49.77%), Query Frame = 3
Query:   87 FTLIFSCIFFSSAL-KSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALMEIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFETSVVYKSEPKV-KVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFYSVKFDAKI-NETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFV---IREGQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKL-----DMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            F L  + I  + AL  + YLT  D + +K+     L + FT  ++   S+ G S L  +    K AC   K+  L+  N++ L+ +A  +  L   + ++    K   L  + + S++  ++  V  +S   L +       +L   L K+ + L+   +   A S    +++L+    EIED + + DEL  +Y+ +E+G+ TTA  V + ++L +     P I  +++ +  N + S+++  +L     +A A  +LS N+  VP+V+  E S  Y  E  + ++ +TN+    +  A +  E  K++ S AT++ + S T      ++EL+  + +   + G+Y   F  K+  + R+       L VK+ ++V I NV+LS  ++DQ       +++  +        + H    + F    +  G +   PHQ FV+L +  T QE++FVAE D  +VYKF LD  +   +FD+ SG Y + LIIGDA++++P  W  A+V +     D+PST  ++N                         T K +I H+F+  EKR   ++S  FT L +  P +++  LW  +G N SNF  A S I+FH+G  A+ GL Y YW+ LNMF TL+YL  LG +T   GNR+L Q A KR
Sbjct:   10 FLLALTIIASTQALTPTHYLTKHDVERLKA----SLDRPFTSLESAFYSIVGLSSLGAQVPDVKKACTFIKSN-LDPSNVDSLFYAAQSSQALSGCEISISNETKDLLLAAVSEDSSVAQIYHAVAALSGFGLPLASQEALGALTARLSKEETVLATVQALQTA-SYLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAALSENRYHVPVVVVPEGSPSYTQEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQKTSFTL--IGDVFELNFMNVK--FSSGYYD--FSVKVEGDNRYIANTVE-LRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAE-LTPHQTFVRLHNQKTGQEVVFVAEPDSKNVYKFELDTSERKLEFDSASGTYTLYLIIGDATLKNPILWNVADVVIRFPEDDVPSTVLSKNI-----------------------FTPKQEIQHLFREPEKRPPTVVSNTFTALILS-PLLLLFALWIRIGANVSNFTFAPSTIVFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLAQQAIKR 628          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. UniProt/SwissProt
Match: sp|P04844|RPN2_HUMAN (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2 PE=1 SV=3)

HSP 1 Score: 227.639 bits (579), Expect = 1.293e-63
Identity = 187/651 (28.73%), Postives = 322/651 (49.46%), Query Frame = 3
Query:   87 FTLIFSCIFFSSAL-KSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALMEIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFETSVVYKSEPKV-KVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFYSVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFV---IREGQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            F L  + I  + AL  + YLT  D + +K+     L + FT+ ++   S+ G S L  +    K AC   ++  L+  N++ L+ +A  +  L   + ++    K   L  + + S++  ++  V  +S   L +       +L   L K+ + L+   +   A+ +   +++L+    EIED + + DEL  +Y+ +E+G+ TTA  V + ++L +     P I  +++ +  N + S+++  +L     +A A   LS N+  VP+V+  E S     E  + ++ +TN+    +  A +  E  K++ S AT++ + S T      ++EL+  + +   + G+Y    + + +       V   L VK+ ++V I NV+LS  ++DQ       +++  +        + H    + F    +  G +   PHQ FV+L +  T QE++FVAE D  +VYKF LD  +   +FD+ SG Y + LIIGDA++++P  W  A+V +  P         E   S   S+             T K +I H+F+  EKR   ++S  FT L +  P +++  LW  +G N SNF  A S I+FH+G  A+ GL Y YW+ LNMF TL+YL  LG +T   GNR+L Q A KR
Sbjct:   10 FLLALTIIASTWALTPTHYLTKHDVERLKA----SLDRPFTNLESAFYSIVGLSSLGAQVPDAKKACTYIRSN-LDPSNVDSLFYAAQASQALSGCEISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHL-SQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSASDTHEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQKTSFT--PVGDVFELNFMNVK--FSSGYYDFLVEVEGDNRYIANTVE--LRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAE-LTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPE--------EEAPSTVLSQNLF----------TPKQEIQHLFREPEKRPPTVVSNTFTALILS-PLLLLFALWIRIGANVSNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLAQQAVKR 628          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. UniProt/SwissProt
Match: sp|F1PCT7|RPN2_CANLF (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Canis lupus familiaris OX=9615 GN=RPN2 PE=1 SV=3)

HSP 1 Score: 222.246 bits (565), Expect = 1.310e-61
Identity = 188/651 (28.88%), Postives = 323/651 (49.62%), Query Frame = 3
Query:   87 FTLIFSCIFFSSAL-KSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALMEIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFETSVVYKSEPKV-KVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFYSVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFV---IREGQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            F L  + +  + AL  + YLT  D + +++     L + FT  ++   S+ G S L  +    K AC   K+  L+  N++ L+ +A  +  L   + ++    K   L  + + S++  ++  V  +S   L +       +L   L K+ + L+   +   A+ +   +++L+    EIED + + DEL  +Y+ +E+G+ TTA  V + ++L +     P I  +++ +  N + S+++  +L     +A A  +LS+N+  VP+V+  E +     E  + ++ +TN+    +  A +  E  K++ S AT++ + S T      ++EL+  + +   + G+Y   F  K+         S  L VK+ ++V I NV+LS  ++DQ       +++  +        + H    + F    +  G +   PHQ FV+L +  T QE++FVAE D  +VYKF LD  +   +FD+ SG Y + LIIGDA++++P  W  A+V +  P         E   S   SK             T K +I H+F+  EKR   ++S  FT L +  P +++  LW  +G N SNF  A S I+FH+G  A+ GL Y YW+ LNMF TL+YL  LG +T   GNR+L Q A KR
Sbjct:   10 FLLALTILAGTQALTPTHYLTKPDVERLRA----SLDRPFTSLESAFYSIVGLSSLGVQVPDVKKACAFIKSN-LDPGNVDSLFYAAQSSQALSGCEISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHL-SQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAALSQNRYHVPVVVVPEGTPSDTHEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQKTSFT--PVGDVFELNFMNVK--FSSGYYD--FSVKVEGDNRYIANSVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAE-LTPHQTFVRLHNQKTGQEVVFVAEPDSKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPE--------EDAPSTVLSKNLF----------TPKQEIQHLFREPEKRPPTVVSNTFTALILS-PLLLLFALWIRIGANVSNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLAQQAIKR 628          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. UniProt/SwissProt
Match: sp|Q9DBG6|RPN2_MOUSE (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Mus musculus OX=10090 GN=Rpn2 PE=1 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.497e-60
Identity = 183/637 (28.73%), Postives = 324/637 (50.86%), Query Frame = 3
Query:  138 YLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALM--EIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFETSVVYKSEPKV-KVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTG-LYELDLSSSQDLLAKGFYSVKFDAKI-NETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFV---IREGQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            YLT  D + +K+     L + FTD ++   S+ G S L  +    K AC   K+  L+  N++ L+ +A  + +L    C + V+ +   L+   + + S I  ++  V  +S   L +  +    +L   L K+ + L+   +   A+ +   +++L+    EIED + + DEL  +Y+ +E+G+  TA  V + ++L +     P +  +++ +  N + S+++  +L     +A A  +LS+N+  VP+V+  E S     E  + ++ ++N+    +  A +  E  K+  + AT++ +      S  G ++EL+  + +  L+ G+Y   F  ++  ++R+       L VK+ ++V I NV+LS  ++DQ       +++  +        + H    + F    +  G +   PHQ FV+L +  T QE++FVAE D  +VYKF LD  +   +FD+ SG Y + LIIGDA++++P  W  A+V +  P         E+  +V    +S+  P         K +I H+F+  EKR   ++S  FT L +  P +++  LW  +G N SNF  A S ++FH+G  A+ GL Y YW+ LNMF TL+YL  LG +T   GNR+L Q A KR
Sbjct:   28 YLTKQDVERLKA----SLDRPFTDLESAFYSIVGLSSLGVQVPDVKKACTFIKSN-LDPSNVDSLFYAAQSSQVLSG--CEISVSNETKELLLAAVSEDSPIAQIYHAVAALSGFGLPLASNEALGALTARLGKEETVLATVQALQTASHL-SQQADLRNIVEEIEDLVARLDELGGVYLQFEEGLELTALFVAATYKLMDHVGTEPSMKEDQVIQLMNTIFSKKNFESLSEAFSVASAAAALSQNRYHVPVVVVPEGSTSDTQEQAILRLQVSNVLSQPLAQAAVKLEHAKSAATRATVLQKTPF---SLVGNVFELNFKNVK--LSSGYYD--FSVRVEGDSRYIANTVE-LRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAE-LTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEE-------EAPSTVLS--QSLFTP---------KQEIQHLFREPEKRPPTVVSNTFTALILS-PLLLLFALWIRIGANVSNFTFAPSTVIFHLGHAAMLGLMYIYWTQLNMFQTLKYLAVLGTVTFLAGNRMLAQHAVKR 628          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. TrEMBL
Match: V3ZNV9 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_220939 PE=3 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 7.199e-119
Identity = 242/657 (36.83%), Postives = 374/657 (56.93%), Query Frame = 3
Query:   81 LGFTLIFSCIFFSSAL-KSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALM-EIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFETSV-VYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDST-TGLYELDLSSSQDLLAKGFYSVKFDAKINET--RFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVI--REGQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKRK 2027
            L  TL+F+ +    AL  S +LTT+D++ +KSVF    +  FTD       + G SLL     + + AC    +  ++  +I  LY ++  A  L    C L+V   ++ L   I    ++ N+F  V  +  L L++D      +LE+ LKKD SALS  +S+ IA  +  +K     +F  IED I QADE+D+ Y+ +E G+Y T+FI++S ++L  K  +AP I  +K+ KF+N+ ++R+H + L+A      A+K+L+ NK  VPL ++  + V V KS+P V+V +TNL G  +G  K+VA+  KNI   + ++ +K  T +S    L+EL++  S+   AKGFY +   A  ++T  R  G   +I+ +KV + VS+  VE+ V ++DQ +   +  L      +  L  ++H ++ MKF +  +   Q+   HQ FV+ T+  TKQEIIFVAE D +++ KF LD+    KDF   SG Y MELIIGD  IE+P +W  A+VKL       T   G+++   + ++ S             KP+I H F   EKR   ++S  F+ L ++ P +++ +LW  +GVN SNF +++S I FHV + AIFGLYYCYW+ LNMF TL++L  L + T  FGNR+L  +ASKRK
Sbjct:   10 LSVTLLFAVVVVGQALTPSTFLTTLDQNRLKSVFEA--AHPFTDVTNAHYGILGLSLLGSTVPNAQEACKNINSN-VDKTSIASLYHASSAAKHLTG--CKLNVGDVQSLLEGAIKSDGDVVNIFHAVFALKNLGLKVDNKKTLQTLEEALKKDDSALSYGYSFQIAAELSGSK-----FFDHIEDVIAQADEVDDKYLQFEGGLYVTSFIIDSAYKLGTKLNKAPTISADKVIKFSNYFLTRKHIHQLRAAAYFLSAIKTLADNKFHVPLAVTLASPVAVSKSQPVVQVRVTNLMGGSLGSLKVVADNAKNIGEGSVVLNKKPFTENSKDKSLFELNMLDSKP--AKGFYEISISATPSKTDKRLLGTTGAIVKIKVTTTVSLEGVEIGVADKDQTSVPRSTNLQYPKRSANVLEADFHQKIVMKFKLLDKTTSQSLSAHQTFVRFTNQKTKQEIIFVAESDSSNLNKFELDVGARGKDFGFQSGQYGMELIIGDPVIENPISWTMADVKL-------TFQEGQAKTKPSTNQYS------------KKPEIQHQFNKPEKRPPAVVSLAFSGLVLL-PVLILFILWIKLGVNISNFPVSLSAIGFHVCLAAIFGLYYCYWTQLNMFQTLRWLGILAVPTFLFGNRLLSGLASKRK 634          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. TrEMBL
Match: A0A0L8GP29 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Octopus bimaculoides OX=37653 GN=OCBIM_22030915mg PE=3 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 3.803e-114
Identity = 239/654 (36.54%), Postives = 359/654 (54.89%), Query Frame = 3
Query:  105 CIF--FSSAL---KSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKK--KNALMEIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFETSV-VYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFYSVKFDAKIN--ETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIREGQ--QTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKRKE 2030
            CIF  F++ L    S YLTT+D    KSVF   L+    D Q    S+ GY LL +   + +  CN  K    ++ +I  +Y  +  A LL++ K  +DV K    NA+     + +I + F  +K      +  D  AV  +L + LKKD S  S  +++ +AT +    +++ K++  IED I QADE+D  Y+ +E G+Y T+ +V+  ++L  K  +AP I  +K+ K  N+ +SR+H + LK+   L   +K+L+ N   VP+ I+  +SV V    P+V+V +TNL G  IG   + AE+ ++I   A ++++K  +  S   LYEL+    Q+   +GFY +   A     + RF G   + + VKV + VS+ N+E+ V ++DQ T T   KL   +  +  L  ++H ++ MKF +++    Q    HQ FV+LT+  TKQEIIFV E D +   KF+LD+    KDF +LSG Y MELIIGDA IE+P +W  A+  L  P     E T  S+  V                 + KP I H FK  EKR  +L+S +FT L ++P FI+ I LW  +GVN SNF +++S I FHV +  IFG Y  YW  LNMF TL+Y+  L + T  FGNR+L  IA++RK+
Sbjct:    5 CIFALFTACLALTPSSYLTTLDLARFKSVFEAALTS--KDVQNTHYSLAGYFLLGETPTNPEEICNSLKA---DTSSIASMYHVSSAAKLLKTCKVKIDVGKTLLTNAIKPESPVLDIFHAFYALKNS---GIPFDESAVLAALTESLKKDDSPASHGYAFIMATEL---SADVSKFYDSIEDIIAQADEVDEKYLQFEGGLYVTSLVVDGAYKLAEKMNKAPAISEDKVIKLTNYFLSRKHVHQLKSACHLLCVIKTLTVNSFHVPIAITRASSVAVSPISPQVQVRVTNLMGAAIGKLSVTAESARHISDDAVVLSKKPFSPTSDKALYELNFL--QNKPTRGFYKIIVSAAPTKPDKRFIGITGAEVQVKVTTHVSLENIEIGVADKDQTTATRTTKLQYPNKAANPLVADYHQKILMKFQLKDKSNGQLMTAHQAFVRLTNLKTKQEIIFVTEADNSMTNKFDLDVGSGAKDFGSLSGRYSMELIIGDAVIENPFSWYLADTVLTFP-----ETTVPSKAPV--------------NQYSPKPTIHHEFKRPEKRPPKLVSFIFTALVVLPMFILFI-LWGKIGVNISNFPMSVSAIGFHVCLAGIFGCYSLYWKSLNMFQTLKYVGLLSIPTFLFGNRLLSNIAAQRKK 625          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. TrEMBL
Match: A0A210QMZ0 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT23475 PE=3 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 4.103e-108
Identity = 227/655 (34.66%), Postives = 364/655 (55.57%), Query Frame = 3
Query:   96 IFSCIFFSSAL-KSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALMEIDKISNIENLFKIVKTV-SLLNLQIDIDAVKV--SLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFETSV-VYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDST-TGLYELDLSSSQDLLAKGFY--SVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIREGQQTFKP---HQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKRK 2027
            +F+      AL  S +LTTVD+  + +VF    ++ +TDA +   S+ G  LL     + K  C    T+ +  +++     S Y AS   +   N  VT      +    I +   +  I +   +L NL +  D  K+  +L + LKKD + LS  +++ +A  +    SE  K F  IED I QADE+D+ Y+ +E G++ T+ I++  ++L  K ++AP +  +K+ KF+N+ +SR+H + L+A        K+L+ NK  +P+ ++  + V V +S   V+V +TNL G+ +GD  + A++ +++   A ++++K  T   T + LYEL+   ++   A+GFY  ++    K  ++R  G   + + VKV +QVS+ NVE+ V ++DQ T     K+   +  +     ++H ++ MKF ++E + + KP   HQ FVK+T+ NT QEIIFVAE    D YKF+LD+  S  DF + SG Y MELI+GDA IE+P +W  A+V L  P   T + T E+R +                    KP+I HMF+ AEKR   ++S  FT L  +P  I ++ LW  +G N SNF +++S I FH+ + A+F LYYCYW+HL+MF TL+YL  + +    FGNR+L  IA+KRK
Sbjct:   10 LFAVAIVGQALTPSTFLTTVDQKRLTNVFKA--AQPYTDAASAHYSILGLKLLGSPVANAKETCKTV-TSLVQPDDV----ASLYHASAAAAALGNCKVTAAGAEALLGAAIKDTAPVMDIFQAFFALKNLGLKADNAKIGTALTEALKKDDTPLSYGYAFLVAAEL---PSE-NKMFDSIEDIIAQADEVDDKYLQFEGGLFVTSLIIDGAYKLAQKAKKAPTLSPDKVMKFSNYFLSRKHVHQLRAACHFVSVSKTLTDNKYHIPVAVTLASPVAVSQSSAVVQVRVTNLMGNSLGDLTVTADSARHLGDEAIVLSKKPFTASKTDSSLYELNFMQTKP--ARGFYKLTISVAPKKADSRLIGTTGAEVEVKVTTQVSVENVEVGVADKDQTTAARTTKIQHPNKAANPFEADYHQKMVMKFQLKE-KVSGKPLTAHQTFVKMTNQNTNQEIIFVAET-TGDSYKFDLDVGSSASDFGHQSGKYTMELIVGDAVIENPFSWTLADVNLIFPERTTEKETAENRYA-------------------KKPEIKHMFREAEKRPPAMVSMTFTALVFLPALI-LLFLWMQIGTNISNFPMSMSAIGFHLCLGAVFALYYCYWTHLSMFETLKYLGLVCIPLFIFGNRLLSGIAAKRK 629          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. TrEMBL
Match: A0A2C9K018 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Biomphalaria glabrata OX=6526 GN=106074714 PE=3 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 2.232e-107
Identity = 226/658 (34.35%), Postives = 371/658 (56.38%), Query Frame = 3
Query:   69 VMSILGFTLIFSCIFFSSALKSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALME-IDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFETSV-VYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDST-TGLYELDLSSSQDLLAKGFY--SVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIREGQ--QTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASK 2021
            V+SI+G   I   +   +   S +LTT+D++ +K+VF    +  ++D QA   S+ G  LL     + + AC    +  L+  N+  +Y  A  A  L +  C ++V + K  L + I + S+++++      +  L L  D +AV  +L   L  D S  S  +++  A+ +     ++ K+   IED + QADE+D+ Y+ +E G++ TA +V+S ++L  K  +AP I  +K+ KFAN+ +SRRH + LK+      A+K+L+ NK  VP+ ++  + V V ++EP V+V +T+L G  +G+  + A++ ++++  A ++++K  +  S    ++EL+   ++   AKGFY  ++    K  + R  G   + + VKV +++SI NVE+ V ++DQ T     +L   +  +  +  ++H ++ MKF +++    Q    HQ FV+LT+  TKQEIIFV E D     KF+LD+  S K+F ++SG Y MELIIGDA IE+P +WL A+V +  P         ES    A S    A           KP+I H F   EKR    +S  FT L ++ P ++++VLW  +GVN SNF L++S + FH+ + AIFGLYYCYW+ LNMF TL++L  + + T FFGNR+L  +ASK
Sbjct:    4 VLSIIGVLAI--AVVGQALTPSSFLTTIDQNRLKAVFEA--ASPYSDTQAAHYSILGLKLLGATIPNAQDACKDI-SKLLDGTNVASIYYGATAAKALGN--CKIEVPEFKKTLTDAIKEDSSVQDITFAFLALKSLGLPADDNAVSKALLAALNTDDSPSSHGYAFLAASQL---TGDISKFVDNIEDVVAQADEVDDKYLQFEGGLFATALVVDSAYKLAEKNNKAPTIAQDKVLKFANYFLSRRHVHQLKSAYYFLSAIKTLTTNKFHVPVAVTLASPVAVTQTEPSVRVQVTDLLGGNLGEMTVTADSARHLEDGAVVLSKKQFSPSSADKSIFELNFLEAKP--AKGFYKLTISVAPKKADPRLIGTTGAEVEVKVTTKISIENVEIGVADKDQATAARTTRLVHPNKAASVIEADYHQKIVMKFQLKDKATGQLMTAHQAFVRLTNTETKQEIIFVTEADNTLTSKFDLDVGSSAKEFASVSGKYNMELIIGDAVIENPFSWLVADVSITFP---------ESGDVPADSSSQYAK----------KPEIKHKFNEPEKRPPATVSIAFTALVLL-PLLILLVLWIRIGVNISNFPLSLSAVGFHICLGAIFGLYYCYWTQLNMFQTLRWLGVIAVPTFFFGNRLLSALASK 629          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. TrEMBL
Match: K1QHM2 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Crassostrea gigas OX=29159 GN=CGI_10009177 PE=3 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 7.947e-104
Identity = 239/710 (33.66%), Postives = 369/710 (51.97%), Query Frame = 3
Query:   96 IFSCIFFSSAL-KSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALMEIDKIS-NIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMY-----------------------------YEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFETSV-VYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLT-HDSTTGLYELDLSSSQDLLAKGFYSVKFDAKINE--------TRFNG-GVSSILV----------------------VKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIREGQQTFK--PHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKRK 2027
            +F+      AL  S +LTT+D+D +K VF    S  +TD   V  S+ G  LL     + +  C+   T  ++++++  LY ++  A  + +  C   V   +  L +  K S  + ++F     +  L LQ+D   V  +L + LKKD S  S  + + +A+ +     + KK F  IED + QADE+D+ Y+                              +E G+YTTA +V+  ++L  K ++AP +  +K+ KFAN+ +SR+H + L+A  +L   +K+L+ N+  +P+ I+  + V V  S P VKV +TNL G  IG   + A++ K+I S A ++++K  T  DS+T  YEL+   ++ +  +GFY +   AK ++        T   G GV   L                       VKV +QVSI NVE+ V ++DQ T     K+      S     ++H ++ +KF +++     K   HQ F+KLT+  T QEIIFVA+   N   KF+LD+  S   F +LSG Y MELIIGDA IE+P +W    V L+ P   T ++ G  R +                    KP+I H+F+  EKR   ++STVFTFL ++ P +++++LW  +GVN SNF +++S + FH+ + AIFGLYY YW  LNMF T++YL  L L T  FGNR+L  IASKRK
Sbjct:   11 LFAVAVVGQALTPSTFLTTIDQDRLKKVFKS--STPYTDLPTVHYSILGLKLLGDTSINNQEICSTI-TKLVDNKSVASLYHASAAAKGVGN--CKFPVGDAQKVLSDAIKDSVPVADIFYAFSALKNLGLQVDNAKVTSALTEALKKDDSPQSAGYGFFVASQL---TGDTKKIFDSIEDVVAQADEVDDKYLQGLGVDRALYIPSPSQMSLCDDDWGEKPYRFEGGLYTTALVVDGAYKLAAKEKKAPTMSDDKVVKFANYFLSRKHVHQLRAAYQLVSVIKTLTDNQFHIPVAITLASPVAVTSSSPNVKVQVTNLLGGSIGSLTVTADSAKHISSEAIVLSKKPFTSKDSST--YELNFMQAKPV--RGFYKIIISAKPSKEDKKLLGLTGAEGSGVDRALYIPSPSQMSLCDDDWGEKPYRVEVKVTTQVSIENVEIGVADKDQTTAARTTKVQYPGKASTVFEADYHQKIIVKFQLKDKADGTKMSAHQTFLKLTNQKTNQEIIFVADAASN---KFDLDIGSSAGQFGHLSGKYSMELIIGDAVIENPFSWALGEVSLNFPEGQTPKDKGLDRYA-------------------KKPEIKHLFREPEKRPAAVVSTVFTFL-VLAPVLILVLLWMKIGVNVSNFPMSLSAVGFHLCLAAIFGLYYLYWVELNMFQTVRYLGLLALPTFIFGNRLLSGIASKRK 685          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Cavefish
Match: rpn2 (ribophorin II [Source:NCBI gene;Acc:103034914])

HSP 1 Score: 228.024 bits (580), Expect = 1.301e-64
Identity = 191/661 (28.90%), Postives = 342/661 (51.74%), Query Frame = 3
Query:   93 LIFSCIFFSSAL-KSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALME--IDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVIS-FETSVVYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFY----SVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIREGQQ--TFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKL-----DMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKRKE 2030
            L+F     + AL  S +L+  D D ++++    LS+ FTD ++   S+ G S L         AC+  K   ++S ++  L+ +A  +  L S  C + V+ +   L+   + + S +  + + V  +S   L +    V  +L+  + K+ + L+   +   A+ +   ++EL +   EIED   + D+L  +Y+ +E+G+  TA  V++ + L +  +  PP+  +++ +  N + S++   +L  +  +A A  + S N+   P+++S    + V  S+P +++ +T++    +  A +V E+  ++ S A I+++   T     G++EL+  +S+   A G+Y    +VK D+++            L VKV ++V+I N++LSV ++DQ  GT   ++   S        + H    M F + +        PHQ FV+L +  T QE++FVAE D  ++YKF LD  +   +FD++SG Y + L++GDA++E+P  W  A++ L     + PST  ++N                           KP+I H+F+  EKR   ++S  FT L +  P +++++LW  +G N SNF L+ S +LFH+G  A+ GL Y YW+HL+MF TL+YL  +G LT   GNR+L Q A KR E
Sbjct:   10 LVFMLALGAQALTPSHHLSPSDVDRLQAI----LSQPFTDLKSAYFSIVGLSKLGLSVADANGACSFIKAN-VDSSSVESLFYAAEASQALAS--CEIHVSNETRDLLHAAVSEDSTVSQIHQAVSALSSFGLPLASQEVVSALKARISKEDNVLAITLALQTASRL-SQQAELGEILEEIEDLAARLDDLGGVYLQFEEGLEATALFVSAAYALSDHVDVEPPLKEDQVIQLVNSIFSKKSWDSLSEIFSVASAAAAFSNNRFHKPVIVSALGPATVSHSQPLLQLQVTDVLCQPLSSADVVVESASSVASKAAILSKTPFTLRD--GIFELNFMASKP--ASGYYQFSVAVKGDSRLVANHVE------LKVKVSTKVAINNMDLSVVDKDQSIGTKTTRVEYPSKSKASFVADSHQNFAMTFQLVDETTGVELTPHQTFVRLHNQKTGQEVVFVAEPDSKNLYKFELDTAERKTEFDSMSGTYALYLMVGDATLENPVLWNVADLVLKFLEEEAPSTIQSKNL-----------------------YVPKPEIQHLFREPEKRPPTVLSNTFTALILS-PLLLLLILWFKLGANISNFSLSPSSLLFHIGHAAMLGLMYVYWTHLDMFQTLKYLAIIGSLTFLAGNRMLAQKAVKRLE 628          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Cavefish
Match: rpn2 (ribophorin II [Source:NCBI gene;Acc:103034914])

HSP 1 Score: 226.483 bits (576), Expect = 5.222e-64
Identity = 190/659 (28.83%), Postives = 341/659 (51.75%), Query Frame = 3
Query:   93 LIFSCIFFSSAL-KSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALME--IDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVIS-FETSVVYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFY----SVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIREGQQ--TFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKL-----DMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            L+F     + AL  S +L+  D D ++++    LS+ FTD ++   S+ G S L         AC+  K   ++S ++  L+ +A  +  L S  C + V+ +   L+   + + S +  + + V  +S   L +    V  +L+  + K+ + L+   +   A+ +   ++EL +   EIED   + D+L  +Y+ +E+G+  TA  V++ + L +  +  PP+  +++ +  N + S++   +L  +  +A A  + S N+   P+++S    + V  S+P +++ +T++    +  A +V E+  ++ S A I+++   T     G++EL+  +S+   A G+Y    +VK D+++            L VKV ++V+I N++LSV ++DQ  GT   ++   S        + H    M F + +        PHQ FV+L +  T QE++FVAE D  ++YKF LD  +   +FD++SG Y + L++GDA++E+P  W  A++ L     + PST  ++N                           KP+I H+F+  EKR   ++S  FT L +  P +++++LW  +G N SNF L+ S +LFH+G  A+ GL Y YW+HL+MF TL+YL  +G LT   GNR+L Q A KR
Sbjct:   10 LVFMLALGAQALTPSHHLSPSDVDRLQAI----LSQPFTDLKSAYFSIVGLSKLGLSVADANGACSFIKAN-VDSSSVESLFYAAEASQALAS--CEIHVSNETRDLLHAAVSEDSTVSQIHQAVSALSSFGLPLASQEVVSALKARISKEDNVLAITLALQTASRL-SQQAELGEILEEIEDLAARLDDLGGVYLQFEEGLEATALFVSAAYALSDHVDVEPPLKEDQVIQLVNSIFSKKSWDSLSEIFSVASAAAAFSNNRFHKPVIVSALGPATVSHSQPLLQLQVTDVLCQPLSSADVVVESASSVASKAAILSKTPFTLRD--GIFELNFMASKP--ASGYYQFSVAVKGDSRLVANHVE------LKVKVSTKVAINNMDLSVVDKDQSIGTKTTRVEYPSKSKASFVADSHQNFAMTFQLVDETTGVELTPHQTFVRLHNQKTGQEVVFVAEPDSKNLYKFELDTAERKTEFDSMSGTYALYLMVGDATLENPVLWNVADLVLKFLEEEAPSTIQSKNL-----------------------YVPKPEIQHLFREPEKRPPTVLSNTFTALILS-PLLLLLILWFKLGANISNFSLSPSSLLFHIGHAAMLGLMYVYWTHLDMFQTLKYLAIIGSLTFLAGNRMLAQKAVKR 626          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000082.1 (pep scaffold:Pmarinus_7.0:GL480542:1893:6981:-1 gene:ENSPMAG00000000075.1 transcript:ENSPMAT00000000082.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 1.892e-14
Identity = 62/249 (24.90%), Postives = 119/249 (47.79%), Query Frame = 3
Query:  228 SVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTK--KKNALMEIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSS--ALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPI--PIE-KLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFE-TSVVYKSEPKVKVSLT 950
            +  G + L ++   E+SAC  F    L+  +++ +Y +A  + +L    C L V+   ++  L  I + + +  +   V  +  L+L +       +L   L ++ S  A  QA    +A S    +++L + + E+ED + +ADE   LY+ +E+G+  T   V++ + L      AP I  PI+ ++ + +N ++ R     L     +A A   LS N+  VPLV+  +  S +   +P ++V  T
Sbjct:   53 AATGLAALGEQLPDEQSACE-FINAELDPSDVHSVYYAARTSKVL--SDCELSVSNETREGLLALISEDATVAEVAHAVGALVALDLPLSSQQAVTALAVALAREDSPPATIQAL---LAASYLSQQADLNRIYQEVEDLVARADEHGGLYLQFEEGLEVTGRFVHAAYSLAEHMGTAPNIKPPIQNQVVQLSNAVLGRSSLATLAQASSVALAAAKLSNNRFHVPLVVQPDGASALSHKQPTLRVRGT 295          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Nematostella
Match: EDO36671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI16])

HSP 1 Score: 273.092 bits (697), Expect = 1.945e-81
Identity = 214/677 (31.61%), Postives = 350/677 (51.70%), Query Frame = 3
Query:   72 MSILGFTLIFSCIFFSSALKSP--YLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQS-EKCNLDVTKKKNALME-IDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQA-FSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFETSVVYKSEPKV-KVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTR--KSLTHDSTTGL-------------YELDLSSSQDLLAKGFYSVKFDAKIN--ETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIREGQ--QTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKD-FDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            M+  G  L+   +F  S    P   L+  ++  ++  F +  +  F D +    ++KG    +      ++ C  F    ++  +I  +Y   + +S+++    C L++   +  L + I + +    +F  V ++S L L+ID  AV  ++      D  ++S A F+ +IA  + K  +++      +EDT+ QADE+DN Y+ ++ G+  TA +V   ++L    +  P I  E+L KFAN+++SR+H   +K    L  +L  LS N+  VP+V+    S +  ++  V KV +TN+    +G   + A +  + + T+ +  +  K  + D    L             YELD  S +   + G Y++  + K    + R  G   + L VKV+++VSI  VELS+ +++      + K    + + + L  ++H R+ MKF I+     +   PHQ FV+LT+  TKQEI FV E D + ++KF+LD+  + KD F +LSG Y M+LI+GDA IE+P  W   ++ L     P      +S++     K+ +  P         KPQI HMF   EKR  Q++S  FT L  + P +VMIV+W  +GVN SNFQ ++  ILFHVG+ AIF LYY +W  LNMFTTLQ L  +G LT   GN +L  IA++R
Sbjct:    1 MAARGVCLVLLALFGCSLAAKPASVLSVAEQARLRQTFQE--AAPFRDLETAHYALKGLKFFKAPMPPNQNVCK-FVEDNVDRSSILSVY---HASSIIKVLGNCQLNLKDAEQMLADSIQEGAPTSTIFYAVSSLSNLGLKIDSAAVLKAVRAASSSDEDSVSSAIFAMNIAIQLPKG-ADINFIVDMVEDTVAQADEIDNTYLQFDGGLVPTAEVVTGAYKLGEYVKRTPTISEEQLVKFANYILSRKHVQEVKDCFFLLRSLNVLSNNEFHVPVVMQVYGSPLISNDNTVFKVRVTNVMDKALGKMTVTAVSAVDSEGTSILSNQNFKDGSEDDYIVLKADLGNSYFAAHSYELDFMSFKP--SPGIYTLTVNVKPQKADPRLIGTSGAELKVKVVTKVSIDQVELSIIDKEHSHVVKSLKADFPTSVDKVLEADFHQRVVMKFAIKSTSDGELMTPHQAFVRLTNKKTKQEIFFVPEPDSSKMFKFDLDVGATAKDSFGSLSGKYSMDLIVGDAVIENPFEWNVGSIALTFADEP-----AKSKK----EKQKMYAP---------KPQIDHMFNKPEKRPPQVVSNAFTALIFL-PLLVMIVVWMKLGVNVSNFQFSLGAILFHVGLGAIFVLYYLFWIKLNMFTTLQLLTVIGGLTFLGGNSLLSSIAARR 649          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Medaka
Match: rpn2 (ribophorin II [Source:NCBI gene;Acc:101167531])

HSP 1 Score: 224.172 bits (570), Expect = 2.834e-63
Identity = 175/625 (28.00%), Postives = 318/625 (50.88%), Query Frame = 3
Query:  189 LSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALM--EIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFE-TSVVYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKS--LTHDSTTGLYELDLSSSQDLLAKGFY----SVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIREGQQTFK--PHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKRKE 2030
            L + F+D ++   SV G S +E      K  C   K+  L+  +++ L+ +A  +  L    C + V+ +   ++   + + S++  + + V  +S L L +    V  +L   + K+ + ++   +   A+ +   ++EL     EIED   + D+L  +Y+ +E+G+  TA  V + + L +  +  PP   +++ +  N + S++   +L     +A A  +LS N+  VP++++    + V  S+P +++ +T++    +  A ++ E+   + S + ++++    L  D    ++EL+  + Q   A G+Y    +V  D+++   +        L VKV ++V++ N++LSV ++DQ  GT   ++   S        + H    M F + +     +  PHQ FV+L ++ T QE++FVAE D  + YKF LD  +   +FD+ SG Y + LI+GDA++E+P  W  A+V L            E         +++  P         KP+I H+F+  EK+   ++S  FT L +  P +++++LW  +G N SNF  + S ILFH G  A+ GL Y YW+HLNMF TL+YL  +G +T   GNR+L Q A KR E
Sbjct:   40 LGRPFSDLESAYYSVVGLSKIEAAVPDHKEVCQFLKSQ-LDPTSVDSLFFAAETSQALSG--CEIPVSNETRDILLAVVSEDSSMTQIHRAVSALSSLGLPLASQEVVGALTARINKEDNVVAITLALQTASRL-SQQAELGGILEEIEDLTARLDDLGGVYLQFEEGLEATALFVTAAYALSDHMDIEPPFKEDQVIQLVNSIFSKKSWDSLAEAFSVATAAAALSNNRFHVPVLVNTRGPATVSHSQPTLQLLVTDVLSRPLRSASVLLESAHAVPSKSVVLSQAPFILKDD----VFELNFMAKQP--ASGYYQFSVAVTGDSRLVANQVE------LKVKVSTEVAVTNMDLSVVDKDQSIGTKTTRVDYPSKAKSSFTADSHQNFAMSFQLVDVNTGLELIPHQTFVRLHNHKTGQEVVFVAEPDSKNQYKFELDTAERKSEFDSTSGTYSLYLIVGDATLENPILWNVADVVLKF---------AEEEAPATIQSKTLYIP---------KPEIQHLFREPEKKPPTVVSNTFTGLVLS-PLLLLLILWLKLGANISNFSFSPSTILFHGGHAALLGLLYVYWTHLNMFQTLKYLAIVGGVTFLAGNRMLAQKAVKRME 629          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Medaka
Match: rpn2 (ribophorin II [Source:NCBI gene;Acc:101167531])

HSP 1 Score: 223.016 bits (567), Expect = 1.000e-62
Identity = 174/623 (27.93%), Postives = 317/623 (50.88%), Query Frame = 3
Query:  189 LSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALM--EIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFE-TSVVYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKS--LTHDSTTGLYELDLSSSQDLLAKGFY----SVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIREGQQTFK--PHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKR 2024
            L + F+D ++   SV G S +E      K  C   K+  L+  +++ L+ +A  +  L    C + V+ +   ++   + + S++  + + V  +S L L +    V  +L   + K+ + ++   +   A+ +   ++EL     EIED   + D+L  +Y+ +E+G+  TA  V + + L +  +  PP   +++ +  N + S++   +L     +A A  +LS N+  VP++++    + V  S+P +++ +T++    +  A ++ E+   + S + ++++    L  D    ++EL+  + Q   A G+Y    +V  D+++   +        L VKV ++V++ N++LSV ++DQ  GT   ++   S        + H    M F + +     +  PHQ FV+L ++ T QE++FVAE D  + YKF LD  +   +FD+ SG Y + LI+GDA++E+P  W  A+V L            E         +++  P         KP+I H+F+  EK+   ++S  FT L +  P +++++LW  +G N SNF  + S ILFH G  A+ GL Y YW+HLNMF TL+YL  +G +T   GNR+L Q A KR
Sbjct:   40 LGRPFSDLESAYYSVVGLSKIEAAVPDHKEVCQFLKSQ-LDPTSVDSLFFAAETSQALSG--CEIPVSNETRDILLAVVSEDSSMTQIHRAVSALSSLGLPLASQEVVGALTARINKEDNVVAITLALQTASRL-SQQAELGGILEEIEDLTARLDDLGGVYLQFEEGLEATALFVTAAYALSDHMDIEPPFKEDQVIQLVNSIFSKKSWDSLAEAFSVATAAAALSNNRFHVPVLVNTRGPATVSHSQPTLQLLVTDVLSRPLRSASVLLESAHAVPSKSVVLSQAPFILKDD----VFELNFMAKQP--ASGYYQFSVAVTGDSRLVANQVE------LKVKVSTEVAVTNMDLSVVDKDQSIGTKTTRVDYPSKAKSSFTADSHQNFAMSFQLVDVNTGLELIPHQTFVRLHNHKTGQEVVFVAEPDSKNQYKFELDTAERKSEFDSTSGTYSLYLIVGDATLENPILWNVADVVLKF---------AEEEAPATIQSKTLYIP---------KPEIQHLFREPEKKPPTVVSNTFTGLVLS-PLLLLLILWLKLGANISNFSFSPSTILFHGGHAALLGLLYVYWTHLNMFQTLKYLAIVGGVTFLAGNRMLAQKAVKR 627          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Planmine SMEST
Match: SMESG000027526.1 (SMESG000027526.1)

HSP 1 Score: 1297.72 bits (3357), Expect = 0.000e+0
Identity = 648/654 (99.08%), Postives = 651/654 (99.54%), Query Frame = 3
Query:   72 MSILGFTLIFSCIFFSSALKSPYLTTVDKDLIKSVFNQGLSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALMEIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFETSVVYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFYSVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIREGQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFXXXXXXXXXXXXXAFFGNRVLRQIASKRKEL 2033
            MSILGFTLIFSCIFFSSALKSPYLTTVDKDLIKSVFNQG SKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALMEIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFE+SVVYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQS +TIMTRKSLTHDSTTGLYELDLSSSQDLL KGFYSVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIREGQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASI+SPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFTTLQYLLPLGLLTAFFGNRVLRQIASKRKEL
Sbjct:    1 MSILGFTLIFSCIFFSSALKSPYLTTVDKDLIKSVFNQGFSKGFTDAQAVALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSEKCNLDVTKKKNALMEIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEKFLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYMYYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNLKAVVELAGALKSLSRNKIRVPLVISFESSVVYKSEPKVKVSLTNLWGDQIGDAKLVAETVKNIQSASTIMTRKSLTHDSTTGLYELDLSSSQDLLVKGFYSVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNYKLSMGSLLSEKLNMNWHHRLDMKFVIREGQQTFKPHQVFVKLTHYNTKQEIIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIDSPQNWLFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFHMFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPILFHVGVIAIFGLYYCYWSHLNMFTTLQYLLPLGLLTAFFGNRVLRQIASKRKEL 654          
The following BLAST results are available for this feature:
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPN22.692e-6428.73ribophorin II [Source:HGNC Symbol;Acc:HGNC:10382][more]
RPN21.048e-5629.12ribophorin II [Source:HGNC Symbol;Acc:HGNC:10382][more]
RPN21.637e-1823.24ribophorin II [Source:HGNC Symbol;Acc:HGNC:10382][more]
RPN21.010e-1632.97ribophorin II [Source:HGNC Symbol;Acc:HGNC:10382][more]
RPN24.857e-1226.62ribophorin II [Source:HGNC Symbol;Acc:HGNC:10382][more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ostd-16.204e-3833.45Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
ostd-16.204e-3833.45Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
OstDelta7.032e-6228.85gene:FBgn0034277 transcript:FBtr0089559[more]
OstDelta9.597e-6228.85gene:FBgn0034277 transcript:FBtr0340276[more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpn22.099e-6128.81ribophorin II [Source:ZFIN;Acc:ZDB-GENE-030131-792... [more]
rpn22.099e-6128.81ribophorin II [Source:ZFIN;Acc:ZDB-GENE-030131-792... [more]
rpn21.118e-6028.85ribophorin II [Source:ZFIN;Acc:ZDB-GENE-030131-792... [more]
rpn21.000e-4927.05ribophorin II [Source:ZFIN;Acc:ZDB-GENE-030131-792... [more]
rpn21.042e-623.64ribophorin II [Source:ZFIN;Acc:ZDB-GENE-030131-792... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gal3st4.15.090e-6527.74galactose-3-O-sulfotransferase 4, gene1 [Source:Xe... [more]
gal3st4.18.453e-6527.48galactose-3-O-sulfotransferase 4, gene1 [Source:Xe... [more]
gal3st4.11.025e-6427.74galactose-3-O-sulfotransferase 4, gene1 [Source:Xe... [more]
gal3st4.15.774e-6427.67galactose-3-O-sulfotransferase 4, gene1 [Source:Xe... [more]
gal3st4.12.663e-6227.52galactose-3-O-sulfotransferase 4, gene1 [Source:Xe... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rpn22.140e-6128.73ribophorin II [Source:MGI Symbol;Acc:MGI:98085][more]
Rpn29.439e-5329.17ribophorin II [Source:MGI Symbol;Acc:MGI:98085][more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RBM1|RPN2_PONAB2.893e-6428.74Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|Q3SZI6|RPN2_BOVIN6.210e-6429.38Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|P04844|RPN2_HUMAN1.293e-6328.73Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|F1PCT7|RPN2_CANLF1.310e-6128.88Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|Q9DBG6|RPN2_MOUSE1.497e-6028.73Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3ZNV97.199e-11936.83Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
A0A0L8GP293.803e-11436.54Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
A0A210QMZ04.103e-10834.66Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
A0A2C9K0182.232e-10734.35Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
K1QHM27.947e-10433.66Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpn21.301e-6428.90ribophorin II [Source:NCBI gene;Acc:103034914][more]
rpn25.222e-6428.83ribophorin II [Source:NCBI gene;Acc:103034914][more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000082.11.892e-1424.90pep scaffold:Pmarinus_7.0:GL480542:1893:6981:-1 ge... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO366711.945e-8131.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpn22.834e-6328.00ribophorin II [Source:NCBI gene;Acc:101167531][more]
rpn21.000e-6227.93ribophorin II [Source:NCBI gene;Acc:101167531][more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000027526.10.000e+099.08SMESG000027526.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004576 ID=SMED30004576|Name=Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2321bp
GTTTGTTTAACTGAATTATTGTAATTGACGTAACCGAGATTTGTCCAATT
TGCATTGGTAGAAATTTTGTCATGTCTATCTTAGGTTTTACATTAATATT
TTCGTGTATTTTCTTCAGCAGTGCTCTTAAATCACCATATTTGACCACTG
TTGACAAAGATTTGATTAAATCGGTTTTCAATCAAGGATTGTCCAAAGGT
TTCACGGACGCACAAGCAGTTGCACTTTCAGTCAAAGGTTATTCATTGTT
AGAGCAGAAATTTGAGCATGAAAAATCTGCTTGTAATTTATTTAAAACAA
CGTACTTAAATTCCGAAAACATAAATGATTTATATGTATCAGCCTATGGT
GCTTCACTTTTACAATCTGAAAAATGTAATTTGGATGTGACAAAGAAGAA
GAATGCTCTAATGGAAATTGATAAGATCAGTAATATAGAAAATCTTTTTA
AAATTGTCAAAACAGTGAGCTTATTAAACTTGCAAATTGACATTGATGCT
GTTAAAGTGTCATTAGAAAAATTTCTCAAAAAAGATTCATCTGCTTTAAG
TCAAGCTTTTAGTTATCATATTGCTACGAGTATTTTTAAAAATAAATCGG
AATTGAAAAAGTATTTTGTGGAAATTGAAGATACAATTCAACAAGCTGAT
GAATTGGACAATCTTTATATGTATTATGAAGATGGTATTTATACAACTGC
TTTCATTGTAAACAGCATATTTGAACTATGCAATAAATACGAGGAAGCTC
CTCCTATTCCAATTGAAAAACTTTTTAAATTCGCGAATTTTTTAATATCC
CGTCGTCATTCTTATAATTTAAAAGCTGTAGTAGAATTGGCAGGAGCCCT
CAAATCATTGTCAAGGAACAAAATTAGAGTGCCTCTAGTTATATCGTTTG
AAACTTCGGTTGTTTATAAAAGTGAACCAAAAGTAAAAGTTAGTCTAACT
AATTTATGGGGTGATCAAATCGGTGATGCAAAACTGGTGGCAGAAACTGT
GAAAAATATCCAATCGACAGCAACAATTATGACGAGAAAATCACTTACTC
ATGATTCCACGACTGGACTCTACGAATTGGACCTGAGTTCAAGTCAAGAT
TTATTGGCCAAGGGATTTTATTCTGTAAAATTTGACGCAAAAATCAACGA
AACTCGGTTCAATGGCGGAGTGAGCTCAATATTGGTAGTGAAGGTCATAT
CACAGGTCTCGATTGGAAATGTCGAGCTGTCTGTCAAGGAAAGAGATCAA
ATCACAGGAACGCTGAATTACAAATTGAGTATGGGTTCACTGCTTAGTGA
AAAGCTGAACATGAATTGGCATCATCGGCTCGACATGAAATTTGTGATTC
GAGAGGGTCAACAAACTTTCAAGCCTCATCAAGTTTTCGTTAAGTTGACG
CATTACAATACGAAACAAGAGATAATTTTCGTAGCTGAAGTAGATCGCAA
TGATGTTTACAAATTTAATCTGGATTTGGACAAGTCGAATAAGGATTTTG
ATAATTTGTCTGGTGATTACAAGATGGAATTAATTATTGGAGATGCATCA
ATTGAGAGCCCACAAAATTGGTTATTTGCTAATGTGAAATTGGATATGCC
TAGCACCCCGACCACTGAAAATACAGGCGAGAGTCGGCGCAGCGTTGCTG
GATCAAAGCGATCTGTGGCGAATCCAAGAATCGGATTGGGCCCAACAACA
GTGAAACCGCAAATATTTCACATGTTTAAGCCAGCCGAGAAGCGTGGAGG
CCAATTGATATCGACAGTGTTCACGTTCCTTTGTATTGTGCCACCGTTCA
TTGTCATGATCGTCCTGTGGTCTTTGGTTGGAGTAAACGCGTCGAACTTT
CAACTTGCTATCAGTCCTATCCTTTTCCATGTCGGCGTCATCGCTATTTT
CGGGCTCTATTATTGCTATTGGAGCCACCTAAACATGTTCACAACTCTGC
AGTATTTGCTGCCTCTTGGCTTACTGACTGCTTTCTTTGGCAATCGCGTG
TTGCGTCAGATTGCATCCAAAAGGAAGGAGCTCTGAAGGGTCGGCTGTCA
TTTGCATCGAGGATTATTTGTAGTTTTTTAATTGATGTTGGAAATAAACT
AATTTTCTTGTACATTTGATTATTTGTAATGTGTATGTTAGTTACCATGG
TAATTTGTATGCTAGACATTATTAGGATGATCAACTAGTTATACCAACTG
TCTTTAATTATGTCCGACACGAACACATGAGCAGCTGGTTATTTAAAAAT
TAAATTCACATATTTTTCAAAAAAGTGAGATTATATCTTTAATTCTAAAG
TGCGTACAGTATTGATTTCAG
back to top

protein sequence of SMED30004576-orf-1

>SMED30004576-orf-1 ID=SMED30004576-orf-1|Name=SMED30004576-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=655bp
MSILGFTLIFSCIFFSSALKSPYLTTVDKDLIKSVFNQGLSKGFTDAQAV
ALSVKGYSLLEQKFEHEKSACNLFKTTYLNSENINDLYVSAYGASLLQSE
KCNLDVTKKKNALMEIDKISNIENLFKIVKTVSLLNLQIDIDAVKVSLEK
FLKKDSSALSQAFSYHIATSIFKNKSELKKYFVEIEDTIQQADELDNLYM
YYEDGIYTTAFIVNSIFELCNKYEEAPPIPIEKLFKFANFLISRRHSYNL
KAVVELAGALKSLSRNKIRVPLVISFETSVVYKSEPKVKVSLTNLWGDQI
GDAKLVAETVKNIQSTATIMTRKSLTHDSTTGLYELDLSSSQDLLAKGFY
SVKFDAKINETRFNGGVSSILVVKVISQVSIGNVELSVKERDQITGTLNY
KLSMGSLLSEKLNMNWHHRLDMKFVIREGQQTFKPHQVFVKLTHYNTKQE
IIFVAEVDRNDVYKFNLDLDKSNKDFDNLSGDYKMELIIGDASIESPQNW
LFANVKLDMPSTPTTENTGESRRSVAGSKRSVANPRIGLGPTTVKPQIFH
MFKPAEKRGGQLISTVFTFLCIVPPFIVMIVLWSLVGVNASNFQLAISPI
LFHVGVIAIFGLYYCYWSHLNMFTTLQYLLPLGLLTAFFGNRVLRQIASK
RKEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0008250oligosaccharyltransferase complex
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006486protein glycosylation
GO:0006487protein N-linked glycosylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR008814Swp1
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008814Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit Swp1PFAMPF05817Ribophorin_IIcoord: 7..650
e-value: 4.3E-158
score: 527.7
IPR008814Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit Swp1PANTHERPTHR12640RIBOPHORIN IIcoord: 5..653
NoneNo IPR availablePANTHERPTHR12640:SF0DOLICHYL-DIPHOSPHOOLIGOSACCHARIDE--PROTEIN GLYCOSYLTRANSFERASE SUBUNIT 2coord: 5..653
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.795
NoneNo IPR availableTMHMMTMhelixcoord: 622..644
NoneNo IPR availableTMHMMTMhelixcoord: 566..588
NoneNo IPR availableTMHMMTMhelixcoord: 595..617