Receptor protein-tyrosine kinase

Overview
NameReceptor protein-tyrosine kinase
Smed IDSMED30004568
Length (bp)4710
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Receptor protein-tyrosine kinase (SMED30004568) t-SNE clustered cells

Violin plots show distribution of expression levels for Receptor protein-tyrosine kinase (SMED30004568) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Receptor protein-tyrosine kinase (SMED30004568) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Receptor protein-tyrosine kinase (SMED30004568) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004568

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30004568h1SMcG0014301 Contig41432uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004568h1SMcG0014301 Contig41432newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30004568h1SMcG0014301 dd_Smed_v4_7012_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004568h1SMcG0014301 dd_Smed_v4_7012_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004568h1SMcG0014301 dd_Smed_v4_7012_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004568h1SMcG0014301 dd_Smed_v4_7012_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004568h1SMcG0014301 dd_Smed_v4_7012_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30004568h1SMcG0014301 dd_Smed_v4_7012_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004568h1SMcG0014301 dd_Smed_v4_7012_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004568h1SMcG0014301 dd_Smed_v4_7012_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004568h1SMcG0014301 dd_Smed_v4_9290_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Human
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:HGNC Symbol;Acc:HGNC:3432])

HSP 1 Score: 266.544 bits (680), Expect = 7.051e-72
Identity = 205/621 (33.01%), Postives = 299/621 (48.15%), Query Frame = 2
Query: 2012 PGIGGCNKCERILLSRKADIVSCVKTC--HEGTY-AFPNDRPDISRFYPVTGFTCLPCPELCSK-------CKGKSPKNDECEVCKGVWHKNTCRLRCPRD----ESYGTKIIDSISYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAER------IETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSPHSIEMTNFNNHYGEDQFNFPSMTAETML---------PLLNGRDSIDRDVKDFT 3778
            PG   C  C R    R      C+++C  ++G +  F N            G  C+ C   C K       C G  P  D C  C        C  +CP       S+  K  D    C  CH +C +GC G T  +C       IY                                 W   + L +  RT +    V+  L +++IV +T  VY++RK+I ++      +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ +  G +     M EA +MAS+ H H +R +GVCLS     L++  +  G L +++  +K+ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     V+ITDFGL+++LE   +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T +I D + KG RL QP IC++DVY++MV CW+   + RP F+ L   F+   ++P RYL IQGD   ++PSP+  +   F N   E+      M AE  L         P+   R  ID +   F 
Sbjct:  489 PGPDQCLSCRRFSRGR-----ICIESCNLYDGEFREFEN------------GSICVECDPQCEKMEDGLLTCHGPGP--DNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCNGPTSHDC-------IYYP-------------------------------WTGHSTLPQHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRALRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRVKVLGSGAFGTVYKGIW-VPEGETV---------KIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLS-PTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEG-DEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKF--FQNLLDEEDLE-DMMDAEEYLVPQAFNIPPPIYTSRARIDSNRNQFV 1023          

HSP 2 Score: 148.673 bits (374), Expect = 3.390e-35
Identity = 159/665 (23.91%), Postives = 259/665 (38.95%), Query Frame = 2
Query:  179 ICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGPYSGGIGGTITNKEFRYHA----GFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTN------DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIV--LTEDSFVKHNITVEMLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFA------------------ISETELEFLGLKSLKEIN-GPFRFFKNQKLCYMN-IPVNELFKNVKNFYYI-----PSNCTDK--ICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPEC------LNTCVGPNPNQCIKGCKNKRENGTCVASCSKNF-------YPPLNDSKACLPCHPNCSEYNSTICTGPSS 2008
            +C     ++ SL    ++ + L     +NC  + G++ I  I       R+L+F  S+ E+ G++++  N    +  +NLRIIRG    +         ++     GN  L +L  ++L  I    V  D N  + Y   +I W ++  +P    L         ++    S  C          CWGP+ N CQ   +T+C  +    C    Y++     CC+ +C GGC+G   + C AC N  +   CV  C  P +     T    E  ++A    G FC K+CP   + +++ CV  C     + + N    C    CT+      D +       A   D +N        + +  NC KI G ++  +T      +N    +  E LN  + +     +                      + S  PN+  +  F+                  + +  +  L  +SLKEI+ G      N  LCY + I    LF  +     I       NCT +  +C+  CS  GCWGPG   C  CR++     C+  C+   G +    +  +    C+ C P+C      L TC GP P+ C K C + ++   CV  C           +   +  + C PCHPNC++     C GP+S
Sbjct:    2 VCAGTENKLSSLSDLEQQYRALRKYY-ENCEVVMGNLEITSI----EHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYR--KDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYA-DTIHWQDIVRNPWPSNL--------TLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYG-PYVSD----CCHRECAGGCSGPKDTDCFACMNFNDSGACVTQC--PQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMC--KPCTDICPKACDGIGTGSLMSAQTVDSSN--------IDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLN--------------------IQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEFREFENGSI----CVECDPQCEKMEDGLLTCHGPGPDNCTK-CSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQG----CNGPTS 604          

HSP 3 Score: 63.929 bits (154), Expect = 3.025e-9
Identity = 82/294 (27.89%), Postives = 128/294 (43.54%), Query Frame = 2
Query:  167 PGTIICQN--DNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYIL--GI-----TKLESKERE-LN-FDSIEEIDGHLIIEG---NDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDK-----CSDQCKLWANF-TQVFCWGPSANQCQQQTLCGSKYSSE---CTTCRYINGE----EQGC----CNDQC------LGGCNGGGASKCTACKNMLNEKKCVELC 937
            P T IC    D +   SL S+ + +   +I +  NCT I G++  L  GI       +E+ + E LN F ++ EI G L I+    N  +   F NL  I G     R L    ++  SL++     +  L F+SL+ I+A N+    N  + Y  H+I W  LF+          T+ + +++RD      C+ +  +  +  +   CWGP  +QC    L   ++S       +C   +GE    E G     C+ QC      L  C+G G   CT C +  +   CVE C
Sbjct:  299 PCTDICPKACDGIGTGSLMSA-QTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGG-----RVL----YSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYY-HTINWTTLFS----------TINQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQC----LSCRRFSRGRICIESCNLYDGEFREFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKC 567          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Human
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:HGNC Symbol;Acc:HGNC:3432])

HSP 1 Score: 266.159 bits (679), Expect = 1.142e-71
Identity = 205/621 (33.01%), Postives = 299/621 (48.15%), Query Frame = 2
Query: 2012 PGIGGCNKCERILLSRKADIVSCVKTC--HEGTY-AFPNDRPDISRFYPVTGFTCLPCPELCSK-------CKGKSPKNDECEVCKGVWHKNTCRLRCPRD----ESYGTKIIDSISYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAER------IETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSPHSIEMTNFNNHYGEDQFNFPSMTAETML---------PLLNGRDSIDRDVKDFT 3778
            PG   C  C R    R      C+++C  ++G +  F N            G  C+ C   C K       C G  P  D C  C        C  +CP       S+  K  D    C  CH +C +GC G T  +C       IY                                 W   + L +  RT +    V+  L +++IV +T  VY++RK+I ++      +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ +  G +     M EA +MAS+ H H +R +GVCLS     L++  +  G L +++  +K+ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     V+ITDFGL+++LE   +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T +I D + KG RL QP IC++DVY++MV CW+   + RP F+ L   F+   ++P RYL IQGD   ++PSP+  +   F N   E+      M AE  L         P+   R  ID +   F 
Sbjct:  515 PGPDQCLSCRRFSRGR-----ICIESCNLYDGEFREFEN------------GSICVECDPQCEKMEDGLLTCHGPGP--DNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCNGPTSHDC-------IYYP-------------------------------WTGHSTLPQHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRALRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRVKVLGSGAFGTVYKGIW-VPEGETV---------KIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLS-PTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEG-DEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKF--FQNLLDEEDLE-DMMDAEEYLVPQAFNIPPPIYTSRARIDSNRNQFV 1049          

HSP 2 Score: 148.288 bits (373), Expect = 4.361e-35
Identity = 159/665 (23.91%), Postives = 259/665 (38.95%), Query Frame = 2
Query:  179 ICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGPYSGGIGGTITNKEFRYHA----GFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTN------DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIV--LTEDSFVKHNITVEMLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFA------------------ISETELEFLGLKSLKEIN-GPFRFFKNQKLCYMN-IPVNELFKNVKNFYYI-----PSNCTDK--ICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPEC------LNTCVGPNPNQCIKGCKNKRENGTCVASCSKNF-------YPPLNDSKACLPCHPNCSEYNSTICTGPSS 2008
            +C     ++ SL    ++ + L     +NC  + G++ I  I       R+L+F  S+ E+ G++++  N    +  +NLRIIRG    +         ++     GN  L +L  ++L  I    V  D N  + Y   +I W ++  +P    L         ++    S  C          CWGP+ N CQ   +T+C  +    C    Y++     CC+ +C GGC+G   + C AC N  +   CV  C  P +     T    E  ++A    G FC K+CP   + +++ CV  C     + + N    C    CT+      D +       A   D +N        + +  NC KI G ++  +T      +N    +  E LN  + +     +                      + S  PN+  +  F+                  + +  +  L  +SLKEI+ G      N  LCY + I    LF  +     I       NCT +  +C+  CS  GCWGPG   C  CR++     C+  C+   G +    +  +    C+ C P+C      L TC GP P+ C K C + ++   CV  C           +   +  + C PCHPNC++     C GP+S
Sbjct:   28 VCAGTENKLSSLSDLEQQYRALRKYY-ENCEVVMGNLEITSI----EHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYR--KDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYA-DTIHWQDIVRNPWPSNL--------TLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYG-PYVSD----CCHRECAGGCSGPKDTDCFACMNFNDSGACVTQC--PQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMC--KPCTDICPKACDGIGTGSLMSAQTVDSSN--------IDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLN--------------------IQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEFREFENGSI----CVECDPQCEKMEDGLLTCHGPGPDNCTK-CSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQG----CNGPTS 630          

HSP 3 Score: 63.5438 bits (153), Expect = 3.365e-9
Identity = 82/294 (27.89%), Postives = 128/294 (43.54%), Query Frame = 2
Query:  167 PGTIICQN--DNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYIL--GI-----TKLESKERE-LN-FDSIEEIDGHLIIEG---NDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDK-----CSDQCKLWANF-TQVFCWGPSANQCQQQTLCGSKYSSE---CTTCRYINGE----EQGC----CNDQC------LGGCNGGGASKCTACKNMLNEKKCVELC 937
            P T IC    D +   SL S+ + +   +I +  NCT I G++  L  GI       +E+ + E LN F ++ EI G L I+    N  +   F NL  I G     R L    ++  SL++     +  L F+SL+ I+A N+    N  + Y  H+I W  LF+          T+ + +++RD      C+ +  +  +  +   CWGP  +QC    L   ++S       +C   +GE    E G     C+ QC      L  C+G G   CT C +  +   CVE C
Sbjct:  325 PCTDICPKACDGIGTGSLMSA-QTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGG-----RVL----YSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYY-HTINWTTLFS----------TINQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQC----LSCRRFSRGRICIESCNLYDGEFREFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKC 593          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Human
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:HGNC Symbol;Acc:HGNC:3432])

HSP 1 Score: 264.233 bits (674), Expect = 4.369e-71
Identity = 204/616 (33.12%), Postives = 298/616 (48.38%), Query Frame = 2
Query: 2012 PGIGGCNKCERILLSRKADIVSCVKTC--HEGTY-AFPNDRPDISRFYPVTGFTCLPCPELCSK-------CKGKSPKNDECEVCKGVWHKNTCRLRCPRD----ESYGTKIIDSISYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAER------IETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSPHSIEMTNFNNHYGEDQFNFPSMTAETML---------PLLNGRDSIDRD 3763
            PG   C  C R    R      C+++C  ++G +  F N            G  C+ C   C K       C G  P  D C  C        C  +CP       S+  K  D    C  CH +C +GC G T  +C       IY                                 W   + L +  RT +    V+  L +++IV +T  VY++RK+I ++      +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ +  G +     M EA +MAS+ H H +R +GVCLS     L++  +  G L +++  +K+ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     V+ITDFGL+++LE   +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T +I D + KG RL QP IC++DVY++MV CW+   + RP F+ L   F+   ++P RYL IQGD   ++PSP+  +   F N   E+      M AE  L         P+   R  ID +
Sbjct:  515 PGPDQCLSCRRFSRGR-----ICIESCNLYDGEFREFEN------------GSICVECDPQCEKMEDGLLTCHGPGP--DNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCNGPTSHDC-------IYYP-------------------------------WTGHSTLPQHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRALRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRVKVLGSGAFGTVYKGIW-VPEGETV---------KIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLS-PTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEG-DEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKF--FQNLLDEEDLE-DMMDAEEYLVPQAFNIPPPIYTSRARIDSN 1044          

HSP 2 Score: 147.902 bits (372), Expect = 5.417e-35
Identity = 159/665 (23.91%), Postives = 259/665 (38.95%), Query Frame = 2
Query:  179 ICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGPYSGGIGGTITNKEFRYHA----GFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTN------DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIV--LTEDSFVKHNITVEMLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFA------------------ISETELEFLGLKSLKEIN-GPFRFFKNQKLCYMN-IPVNELFKNVKNFYYI-----PSNCTDK--ICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPEC------LNTCVGPNPNQCIKGCKNKRENGTCVASCSKNF-------YPPLNDSKACLPCHPNCSEYNSTICTGPSS 2008
            +C     ++ SL    ++ + L     +NC  + G++ I  I       R+L+F  S+ E+ G++++  N    +  +NLRIIRG    +         ++     GN  L +L  ++L  I    V  D N  + Y   +I W ++  +P    L         ++    S  C          CWGP+ N CQ   +T+C  +    C    Y++     CC+ +C GGC+G   + C AC N  +   CV  C  P +     T    E  ++A    G FC K+CP   + +++ CV  C     + + N    C    CT+      D +       A   D +N        + +  NC KI G ++  +T      +N    +  E LN  + +     +                      + S  PN+  +  F+                  + +  +  L  +SLKEI+ G      N  LCY + I    LF  +     I       NCT +  +C+  CS  GCWGPG   C  CR++     C+  C+   G +    +  +    C+ C P+C      L TC GP P+ C K C + ++   CV  C           +   +  + C PCHPNC++     C GP+S
Sbjct:   28 VCAGTENKLSSLSDLEQQYRALRKYY-ENCEVVMGNLEITSI----EHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYR--KDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYA-DTIHWQDIVRNPWPSNL--------TLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYG-PYVSD----CCHRECAGGCSGPKDTDCFACMNFNDSGACVTQC--PQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMC--KPCTDICPKACDGIGTGSLMSAQTVDSSN--------IDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLN--------------------IQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEFREFENGSI----CVECDPQCEKMEDGLLTCHGPGPDNCTK-CSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQG----CNGPTS 630          

HSP 3 Score: 63.929 bits (154), Expect = 3.181e-9
Identity = 82/294 (27.89%), Postives = 128/294 (43.54%), Query Frame = 2
Query:  167 PGTIICQN--DNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYIL--GI-----TKLESKERE-LN-FDSIEEIDGHLIIEG---NDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDK-----CSDQCKLWANF-TQVFCWGPSANQCQQQTLCGSKYSSE---CTTCRYINGE----EQGC----CNDQC------LGGCNGGGASKCTACKNMLNEKKCVELC 937
            P T IC    D +   SL S+ + +   +I +  NCT I G++  L  GI       +E+ + E LN F ++ EI G L I+    N  +   F NL  I G     R L    ++  SL++     +  L F+SL+ I+A N+    N  + Y  H+I W  LF+          T+ + +++RD      C+ +  +  +  +   CWGP  +QC    L   ++S       +C   +GE    E G     C+ QC      L  C+G G   CT C +  +   CVE C
Sbjct:  325 PCTDICPKACDGIGTGSLMSA-QTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGG-----RVL----YSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYY-HTINWTTLFS----------TINQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQC----LSCRRFSRGRICIESCNLYDGEFREFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKC 593          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Human
Match: EGFR (epidermal growth factor receptor [Source:HGNC Symbol;Acc:HGNC:3236])

HSP 1 Score: 246.514 bits (628), Expect = 5.448e-66
Identity = 136/345 (39.42%), Postives = 205/345 (59.42%), Query Frame = 2
Query: 2615 YLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEI-ESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSP 3643
            +++R+ I  +       +   L EP +       + PN   L I+ + +     + K LG GAFG VYKG W IP+ E+           +PVAIK ++   + +  + ++ EA +MASV + H  R +G+CL+     LI+  +  G L  ++  +K+ I S  +L+W  QIA GM YL  R ++HRDLAARNVLV   + V+ITDFGL+K+L   ++KE   + GKVPI+W+A+E++    Y+H++DVW+YGVT+WE+ TFG  PY+     +I   + KG RL QP IC++DVY+IMV CW+   + RP F+ L+  F+   ++P RYL IQGD    +PSP
Sbjct:  622 FMRRRHIVRKRTLRRLLQERELVEPLTPS----GEAPNQALLRILKETEF---KKIKVLGSGAFGTVYKGLW-IPEGEKV---------KIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQ-LITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLL-GAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSP 947          

HSP 2 Score: 137.502 bits (345), Expect = 6.864e-32
Identity = 165/656 (25.15%), Postives = 253/656 (38.57%), Query Frame = 2
Query:  179 ICQNDNVQIESLHSSVEKLKILSIIRS-KNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQT--LCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPA-MMLPENTGCVHKCSEGYFKNKSN---HCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILG-----YIVLTEDSFVKHNITVEMLYENLNKLQELEGGF--SYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEI-NGPFRFFKNQKLCYMN-IPVNELFKNVKNFYYIPSN-------CTDKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLN-----TCVGPNPNQCIKGCKNKRENGTCVASCSKN--------FYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGC 2029
            +CQ  + ++  L +  +    LS+ R   NC  + G++ I  +     +  +L+F  +I+E+ G+++I  N +E+I  +NL+IIRG N    N        ++L V  N                    +D+N                           T  K+L +R+    +C    +     CWG     CQ+ T  +C  + S  C            CC++QC  GC G   S C  C+   +E  C + C     Y+        N E +Y  G  C K+CP   ++ ++  CV  C    ++ + +    C KC G         CN   I    D      + A ++   KNC  I G      +    DSF           + L  ++E+ G      + +N      F    +       H            A+    +  LGL+SLKEI +G      N+ LCY N I   +LF        I SN        T ++CH  CS +GCWGP  + C  CR       CV  C+  +G   P     + N +C++CHPECL      TC G  P+ CI+ C +  +   CV +C            +   +    C  CHPNC+ Y    CTG    PG+ GC
Sbjct:   30 VCQGTSNKLTQLGTFEDHF--LSLQRMFNNCEVVLGNLEITYV----QRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRG-NMYYEN-------SYALAVLSN--------------------YDANK--------------------------TGLKELPMRNLQGQKCD--PSCPNGSCWGAGEENCQKLTKIICAQQCSGRCR-----GKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPC----RKVCNGIGIGEFKD---SLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQF-------SLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEG--EP--REFVENSECIQCHPECLPQAMNITCTGRGPDNCIQ-CAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCT-YG---CTG----PGLEGC 591          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Human
Match: EGFR (epidermal growth factor receptor [Source:HGNC Symbol;Acc:HGNC:3236])

HSP 1 Score: 247.284 bits (630), Expect = 5.656e-66
Identity = 136/345 (39.42%), Postives = 205/345 (59.42%), Query Frame = 2
Query: 2615 YLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEI-ESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSP 3643
            +++R+ I  +       +   L EP +       + PN   L I+ + +     + K LG GAFG VYKG W IP+ E+           +PVAIK ++   + +  + ++ EA +MASV + H  R +G+CL+     LI+  +  G L  ++  +K+ I S  +L+W  QIA GM YL  R ++HRDLAARNVLV   + V+ITDFGL+K+L   ++KE   + GKVPI+W+A+E++    Y+H++DVW+YGVT+WE+ TFG  PY+     +I   + KG RL QP IC++DVY+IMV CW+   + RP F+ L+  F+   ++P RYL IQGD    +PSP
Sbjct:  622 FMRRRHIVRKRTLRRLLQERELVEPLTPS----GEAPNQALLRILKETEF---KKIKVLGSGAFGTVYKGLW-IPEGEKV---------KIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQ-LITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLL-GAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSP 947          

HSP 2 Score: 137.887 bits (346), Expect = 7.057e-32
Identity = 167/660 (25.30%), Postives = 254/660 (38.48%), Query Frame = 2
Query:  179 ICQNDNVQIESLHSSVEKLKILSIIRS-KNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRD----KCSDQCKLWANFTQVFCWGPSANQCQQQT--LCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPA-MMLPENTGCVHKCSEGYFKNKSN---HCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILG-----YIVLTEDSFVKHNITVEMLYENLNKLQELEGGF--SYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEI-NGPFRFFKNQKLCYMN-IPVNELFKNVKNFYYIPSN-------CTDKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLN-----TCVGPNPNQCIKGCKNKRENGTCVASCSKN--------FYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGC 2029
            +CQ  + ++  L +  +    LS+ R   NC  + G++ I  +     +  +L+F  +I+E+ G+++I  N +E+I  +NL+IIRG N    N        ++L V  N                    +D+N                           T  K+L +R+    KC   C   +      CWG     CQ+ T  +C  + S  C            CC++QC  GC G   S C  C+   +E  C + C     Y+        N E +Y  G  C K+CP   ++ ++  CV  C    ++ + +    C KC G         CN   I    D      + A ++   KNC  I G      +    DSF           + L  ++E+ G      + +N      F    +       H            A+    +  LGL+SLKEI +G      N+ LCY N I   +LF        I SN        T ++CH  CS +GCWGP  + C  CR       CV  C+  +G   P     + N +C++CHPECL      TC G  P+ CI+ C +  +   CV +C            +   +    C  CHPNC+ Y    CTG    PG+ GC
Sbjct:   30 VCQGTSNKLTQLGTFEDHF--LSLQRMFNNCEVVLGNLEITYV----QRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRG-NMYYEN-------SYALAVLSN--------------------YDANK--------------------------TGLKELPMRNLQGQKCDPSCPNGS------CWGAGEENCQKLTKIICAQQCSGRCR-----GKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPC----RKVCNGIGIGEFKD---SLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQF-------SLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEG--EP--REFVENSECIQCHPECLPQAMNITCTGRGPDNCIQ-CAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCT-YG---CTG----PGLEGC 591          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Celegans
Match: let-23 (Receptor tyrosine-protein kinase let-23 [Source:UniProtKB/Swiss-Prot;Acc:P24348])

HSP 1 Score: 416.772 bits (1070), Expect = 9.598e-123
Identity = 339/1136 (29.84%), Postives = 526/1136 (46.30%), Query Frame = 2
Query:  338 FDSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQ-GCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELC--RGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKS---NHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNI----TVEMLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEI-NGPFRFFKNQKLCYM-----NIPVNELFKNVKNFYYIPSN-------CTDKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGT-------CVASCSKNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPD--ISRF--YPVTGFTCLPCPELCSKCK--GKSPKNDECEVCKGVWHK-----NTCRLRCPRDESYGTKIIDSISYCKTCHSSCKG---CYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYL 3607
            FD++EEI G LII   +++KI+F  LR+I G         D+   D +L +  N  + ++  R LR I   +V    NPKM Y+   I W EL  DP  Q + +    +      K   +C    N     CWG   N CQ+  +++C       C+ C Y N      CC+  CLGGC G G   C AC     +  C+E C  R  ++   G  + N + RY  G  C K+CP  +L EN  CV  CS+G+  + +     C KC  + C        +  + GH        L  + L  L+ C++I G++++ E +F    +    TV+++ E +  +Q+      + K+           L       LH+    L  Y        +LE L L SLK I  G     KN +LCY+     +  +    K+ K    I  N          ++C K+C+++GCWG   + C EC+ + + GTCV  C  K    N       ++ KC RC PEC  TC G     C+  C++K    +       CV  C  + +P       C  CHP C +     CTGP S  G GGC +C +  +  + D + C+++         ND P+  IS +    V    C  C   C  C   G++   ++C VCK V ++       C  +CP +        +++  CK CH  C     C       C +CKN  ++       C   CP  K++      +G+  CL        +   +R    V +   +    ++ +  ++VY + + I ++++         LT  ++      S  PNM R+ ++   +L  + + K LG GAFG V+ G +           K + +  +PVAIKV +     + + +++EA  M  + H + L+ IG C+  +   +++ Y   G+L  FL  +K  + +   + +  QIA GM YL K+ ++HRDLA RNVLV +   V+ITDFGLSK+L+   D  I IK+GKV I+WLAIE  +   Y+H +DVWA+GVT WEI TFG+ PY+  +T  I +F+  G RLSQP  CS D+Y  ++ CW+  P  RP F+ L + F ++CK P  +L
Sbjct:   48 FDNLEEIRGSLIIYRANIQKISFPRLRVIYG---------DEVFHDNALYIHKNDKVHEVVMRELRVIRNGSVTIQDNPKMCYIGDKIDWKELLYDPDVQKVETTNSHQHCYQNGKSMAKCHESCNDK---CWGSGDNDCQRVYRSVC----PKSCSQCFYSNSTSSYECCDSACLGGCTGHGPKNCIACSKYELDGICIETCPSRKIFNHKTGRLVFNPDGRYQNGNHCVKECPPELLIENDVCVRHCSDGHHYDATKDVRECEKCRSSSCP------KICTVDGH--------LTNETLKNLEGCEQIDGHLII-EHAFTYEQLKVLETVKIVSEYITIVQQNFYDLKFLKN-----------LQIIEGRKLHNVRWALAIYQC-----DDLEELSLNSLKLIKTGAVLIMKNHRLCYVSKIDWSSIITSKGKDNKPSLAIAENRDSKLCETEQRVCDKNCNKRGCWGKEPEDCLECKTWKSVGTCVEKCDTKGFLRNQ------TSMKCERCSPEC-ETCNGLGELDCLT-CRHKTLYNSDFGNRMECVHDCPVSHFP--TQKNVCEKCHPTCYDNG---CTGPDSNLGYGGCKQC-KYAVKYENDTIFCLQSSGMNNVCVENDLPNYYISTYDTEGVIETHCEKCSISCKTCSSAGRNVVQNKC-VCKHVEYQPNPSERICMDQCPVNSFMVPDTNNTV--CKKCHHECDQNYHCANGQSTGCQKCKNFTVF-KGDIAQCVSECP--KNLPFSNPANGE--CLDY-----DIASRQRKTRMVIIGSVLFGFAVMFLFILLVYWRCQRIGKKLKIAEMVDMPELTPIDA------SVRPNMSRICLIPSSELQTKLDKK-LGAGAFGTVFAGIY---------YPKRAKNVKIPVAIKVFQT-DQSQTDEMLEEATNMFRLRHDNLLKIIGFCMHDDGLKIVTIYRPLGNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVKKFNHVEITDFGLSKILKHDAD-SITIKSGKVAIKWLAIEIFSKHCYTHASDVWAFGVTCWEIITFGQSPYQGMSTDSIHNFLKDGNRLSQPPNCSQDLYQELLRCWMADPKSRPGFEILYERFKEFCKVPQLFL 1091          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Celegans
Match: let-23 (Receptor tyrosine-protein kinase let-23 [Source:UniProtKB/Swiss-Prot;Acc:P24348])

HSP 1 Score: 416.387 bits (1069), Expect = 4.456e-122
Identity = 339/1136 (29.84%), Postives = 526/1136 (46.30%), Query Frame = 2
Query:  338 FDSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQ-GCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELC--RGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKS---NHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNI----TVEMLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEI-NGPFRFFKNQKLCYM-----NIPVNELFKNVKNFYYIPSN-------CTDKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGT-------CVASCSKNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPD--ISRF--YPVTGFTCLPCPELCSKCK--GKSPKNDECEVCKGVWHK-----NTCRLRCPRDESYGTKIIDSISYCKTCHSSCKG---CYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYL 3607
            FD++EEI G LII   +++KI+F  LR+I G         D+   D +L +  N  + ++  R LR I   +V    NPKM Y+   I W EL  DP  Q + +    +      K   +C    N     CWG   N CQ+  +++C       C+ C Y N      CC+  CLGGC G G   C AC     +  C+E C  R  ++   G  + N + RY  G  C K+CP  +L EN  CV  CS+G+  + +     C KC  + C        +  + GH        L  + L  L+ C++I G++++ E +F    +    TV+++ E +  +Q+      + K+           L       LH+    L  Y        +LE L L SLK I  G     KN +LCY+     +  +    K+ K    I  N          ++C K+C+++GCWG   + C EC+ + + GTCV  C  K    N       ++ KC RC PEC  TC G     C+  C++K    +       CV  C  + +P       C  CHP C +     CTGP S  G GGC +C +  +  + D + C+++         ND P+  IS +    V    C  C   C  C   G++   ++C VCK V ++       C  +CP +        +++  CK CH  C     C       C +CKN  ++       C   CP  K++      +G+  CL        +   +R    V +   +    ++ +  ++VY + + I ++++         LT  ++      S  PNM R+ ++   +L  + + K LG GAFG V+ G +           K + +  +PVAIKV +     + + +++EA  M  + H + L+ IG C+  +   +++ Y   G+L  FL  +K  + +   + +  QIA GM YL K+ ++HRDLA RNVLV +   V+ITDFGLSK+L+   D  I IK+GKV I+WLAIE  +   Y+H +DVWA+GVT WEI TFG+ PY+  +T  I +F+  G RLSQP  CS D+Y  ++ CW+  P  RP F+ L + F ++CK P  +L
Sbjct:  114 FDNLEEIRGSLIIYRANIQKISFPRLRVIYG---------DEVFHDNALYIHKNDKVHEVVMRELRVIRNGSVTIQDNPKMCYIGDKIDWKELLYDPDVQKVETTNSHQHCYQNGKSMAKCHESCNDK---CWGSGDNDCQRVYRSVC----PKSCSQCFYSNSTSSYECCDSACLGGCTGHGPKNCIACSKYELDGICIETCPSRKIFNHKTGRLVFNPDGRYQNGNHCVKECPPELLIENDVCVRHCSDGHHYDATKDVRECEKCRSSSCP------KICTVDGH--------LTNETLKNLEGCEQIDGHLII-EHAFTYEQLKVLETVKIVSEYITIVQQNFYDLKFLKN-----------LQIIEGRKLHNVRWALAIYQC-----DDLEELSLNSLKLIKTGAVLIMKNHRLCYVSKIDWSSIITSKGKDNKPSLAIAENRDSKLCETEQRVCDKNCNKRGCWGKEPEDCLECKTWKSVGTCVEKCDTKGFLRNQ------TSMKCERCSPEC-ETCNGLGELDCLT-CRHKTLYNSDFGNRMECVHDCPVSHFP--TQKNVCEKCHPTCYDNG---CTGPDSNLGYGGCKQC-KYAVKYENDTIFCLQSSGMNNVCVENDLPNYYISTYDTEGVIETHCEKCSISCKTCSSAGRNVVQNKC-VCKHVEYQPNPSERICMDQCPVNSFMVPDTNNTV--CKKCHHECDQNYHCANGQSTGCQKCKNFTVF-KGDIAQCVSECP--KNLPFSNPANGE--CLDY-----DIASRQRKTRMVIIGSVLFGFAVMFLFILLVYWRCQRIGKKLKIAEMVDMPELTPIDA------SVRPNMSRICLIPSSELQTKLDKK-LGAGAFGTVFAGIY---------YPKRAKNVKIPVAIKVFQT-DQSQTDEMLEEATNMFRLRHDNLLKIIGFCMHDDGLKIVTIYRPLGNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVKKFNHVEITDFGLSKILKHDAD-SITIKSGKVAIKWLAIEIFSKHCYTHASDVWAFGVTCWEIITFGQSPYQGMSTDSIHNFLKDGNRLSQPPNCSQDLYQELLRCWMADPKSRPGFEILYERFKEFCKVPQLFL 1157          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Celegans
Match: let-23 (Receptor tyrosine-protein kinase let-23 [Source:UniProtKB/Swiss-Prot;Acc:P24348])

HSP 1 Score: 416.001 bits (1068), Expect = 4.766e-122
Identity = 339/1136 (29.84%), Postives = 526/1136 (46.30%), Query Frame = 2
Query:  338 FDSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQ-GCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELC--RGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKS---NHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNI----TVEMLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEI-NGPFRFFKNQKLCYM-----NIPVNELFKNVKNFYYIPSN-------CTDKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGT-------CVASCSKNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPD--ISRF--YPVTGFTCLPCPELCSKCK--GKSPKNDECEVCKGVWHK-----NTCRLRCPRDESYGTKIIDSISYCKTCHSSCKG---CYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYL 3607
            FD++EEI G LII   +++KI+F  LR+I G         D+   D +L +  N  + ++  R LR I   +V    NPKM Y+   I W EL  DP  Q + +    +      K   +C    N     CWG   N CQ+  +++C       C+ C Y N      CC+  CLGGC G G   C AC     +  C+E C  R  ++   G  + N + RY  G  C K+CP  +L EN  CV  CS+G+  + +     C KC  + C        +  + GH        L  + L  L+ C++I G++++ E +F    +    TV+++ E +  +Q+      + K+           L       LH+    L  Y        +LE L L SLK I  G     KN +LCY+     +  +    K+ K    I  N          ++C K+C+++GCWG   + C EC+ + + GTCV  C  K    N       ++ KC RC PEC  TC G     C+  C++K    +       CV  C  + +P       C  CHP C +     CTGP S  G GGC +C +  +  + D + C+++         ND P+  IS +    V    C  C   C  C   G++   ++C VCK V ++       C  +CP +        +++  CK CH  C     C       C +CKN  ++       C   CP  K++      +G+  CL        +   +R    V +   +    ++ +  ++VY + + I ++++         LT  ++      S  PNM R+ ++   +L  + + K LG GAFG V+ G +           K + +  +PVAIKV +     + + +++EA  M  + H + L+ IG C+  +   +++ Y   G+L  FL  +K  + +   + +  QIA GM YL K+ ++HRDLA RNVLV +   V+ITDFGLSK+L+   D  I IK+GKV I+WLAIE  +   Y+H +DVWA+GVT WEI TFG+ PY+  +T  I +F+  G RLSQP  CS D+Y  ++ CW+  P  RP F+ L + F ++CK P  +L
Sbjct:  109 FDNLEEIRGSLIIYRANIQKISFPRLRVIYG---------DEVFHDNALYIHKNDKVHEVVMRELRVIRNGSVTIQDNPKMCYIGDKIDWKELLYDPDVQKVETTNSHQHCYQNGKSMAKCHESCNDK---CWGSGDNDCQRVYRSVC----PKSCSQCFYSNSTSSYECCDSACLGGCTGHGPKNCIACSKYELDGICIETCPSRKIFNHKTGRLVFNPDGRYQNGNHCVKECPPELLIENDVCVRHCSDGHHYDATKDVRECEKCRSSSCP------KICTVDGH--------LTNETLKNLEGCEQIDGHLII-EHAFTYEQLKVLETVKIVSEYITIVQQNFYDLKFLKN-----------LQIIEGRKLHNVRWALAIYQC-----DDLEELSLNSLKLIKTGAVLIMKNHRLCYVSKIDWSSIITSKGKDNKPSLAIAENRDSKLCETEQRVCDKNCNKRGCWGKEPEDCLECKTWKSVGTCVEKCDTKGFLRNQ------TSMKCERCSPEC-ETCNGLGELDCLT-CRHKTLYNSDFGNRMECVHDCPVSHFP--TQKNVCEKCHPTCYDNG---CTGPDSNLGYGGCKQC-KYAVKYENDTIFCLQSSGMNNVCVENDLPNYYISTYDTEGVIETHCEKCSISCKTCSSAGRNVVQNKC-VCKHVEYQPNPSERICMDQCPVNSFMVPDTNNTV--CKKCHHECDQNYHCANGQSTGCQKCKNFTVF-KGDIAQCVSECP--KNLPFSNPANGE--CLDY-----DIASRQRKTRMVIIGSVLFGFAVMFLFILLVYWRCQRIGKKLKIAEMVDMPELTPIDA------SVRPNMSRICLIPSSELQTKLDKK-LGAGAFGTVFAGIY---------YPKRAKNVKIPVAIKVFQT-DQSQTDEMLEEATNMFRLRHDNLLKIIGFCMHDDGLKIVTIYRPLGNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVKKFNHVEITDFGLSKILKHDAD-SITIKSGKVAIKWLAIEIFSKHCYTHASDVWAFGVTCWEIITFGQSPYQGMSTDSIHNFLKDGNRLSQPPNCSQDLYQELLRCWMADPKSRPGFEILYERFKEFCKVPQLFL 1152          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Celegans
Match: let-23 (Receptor tyrosine-protein kinase let-23 [Source:UniProtKB/Swiss-Prot;Acc:P24348])

HSP 1 Score: 416.387 bits (1069), Expect = 4.784e-122
Identity = 339/1136 (29.84%), Postives = 525/1136 (46.21%), Query Frame = 2
Query:  338 FDSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQ-GCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELC--RGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKS---NHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNI----TVEMLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEI-NGPFRFFKNQKLCYM-----NIPVNELFKNVKNFYYIPSN-------CTDKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKR-------ENGTCVASCSKNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPD--ISRF--YPVTGFTCLPCPELCSKCK--GKSPKNDECEVCKGVWHK-----NTCRLRCPRDESYGTKIIDSISYCKTCHSSCKG---CYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYL 3607
            FD++EEI G LII   +++KI+F  LR+I G         D+   D +L +  N  + ++  R LR I   +V    NPKM Y+   I W EL  DP  Q + +    +      K   +C    N     CWG   N CQ+  +++C       C+ C Y N      CC+  CLGGC G G   C AC     +  C+E C  R  ++   G  + N + RY  G  C K+CP  +L EN  CV  CS+G+  + +     C KC  + C        +  + GH        L  + L  L+ C++I G++++ E +F    +    TV+++ E +  +Q+      + K+           L       LH+    L  Y        +LE L L SLK I  G     KN +LCY+     +  +    K+ K    I  N          ++C K+C+++GCWG   + C EC+ + + GTCV  C  K    N       ++ KC RC PEC  TC G     C+  C++K            CV  C  + +P       C  CHP C +     CTGP S  G GGC +C +  +  + D + C+++         ND P+  IS +    V    C  C   C  C   G++   ++C VCK V ++       C  +CP +        +++  CK CH  C     C       C +CKN  ++       C   CP  K++      +G+  CL        +   +R    V +   +    ++ +  ++VY + + I ++++         LT  ++      S  PNM R+ ++   +L  + + K LG GAFG V+ G +           K + +  +PVAIKV +     + + +++EA  M  + H + L+ IG C+  +   +++ Y   G+L  FL  +K  + +   + +  QIA GM YL K+ ++HRDLA RNVLV +   V+ITDFGLSK+L+   D  I IK+GKV I+WLAIE  +   Y+H +DVWA+GVT WEI TFG+ PY+  +T  I +F+  G RLSQP  CS D+Y  ++ CW+  P  RP F+ L + F ++CK P  +L
Sbjct:  121 FDNLEEIRGSLIIYRANIQKISFPRLRVIYG---------DEVFHDNALYIHKNDKVHEVVMRELRVIRNGSVTIQDNPKMCYIGDKIDWKELLYDPDVQKVETTNSHQHCYQNGKSMAKCHESCNDK---CWGSGDNDCQRVYRSVC----PKSCSQCFYSNSTSSYECCDSACLGGCTGHGPKNCIACSKYELDGICIETCPSRKIFNHKTGRLVFNPDGRYQNGNHCVKECPPELLIENDVCVRHCSDGHHYDATKDVRECEKCRSSSCP------KICTVDGH--------LTNETLKNLEGCEQIDGHLII-EHAFTYEQLKVLETVKIVSEYITIVQQNFYDLKFLKN-----------LQIIEGRKLHNVRWALAIYQC-----DDLEELSLNSLKLIKTGAVLIMKNHRLCYVSKIDWSSIITSKGKDNKPSLAIAENRDSKLCETEQRVCDKNCNKRGCWGKEPEDCLECKTWKSVGTCVEKCDTKGFLRNQ------TSMKCERCSPEC-ETCNGLGELDCLT-CRHKTLYNSDFGNRMECVHDCPVSHFP--TQKNVCEKCHPTCYDNG---CTGPDSNLGYGGCKQC-KYAVKYENDTIFCLQSSGMNNVCVENDLPNYYISTYDTEGVIETHCEKCSISCKTCSSAGRNVVQNKC-VCKHVEYQPNPSERICMDQCPVNSFMVPDTNNTV--CKKCHHECDQNYHCANGQSTGCQKCKNFTVF-KGDIAQCVSECP--KNLPFSNPANGE--CLDY-----DIASRQRKTRMVIIGSVLFGFAVMFLFILLVYWRCQRIGKKLKIAEMVDMPELTPIDA------SVRPNMSRICLIPSSELQTKLDKK-LGAGAFGTVFAGIY---------YPKRAKNVKIPVAIKVFQT-DQSQTDEMLEEATNMFRLRHDNLLKIIGFCMHDDGLKIVTIYRPLGNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVKKFNHVEITDFGLSKILKHDADS-ITIKSGKVAIKWLAIEIFSKHCYTHASDVWAFGVTCWEIITFGQSPYQGMSTDSIHNFLKDGNRLSQPPNCSQDLYQELLRCWMADPKSRPGFEILYERFKEFCKVPQLFL 1164          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Celegans
Match: R151.1 (pep chromosome:WBcel235:III:7218813:7221186:1 gene:WBGene00020106.1 transcript:R151.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.1)

HSP 1 Score: 177.563 bits (449), Expect = 2.279e-47
Identity = 109/303 (35.97%), Postives = 166/303 (54.79%), Query Frame = 2
Query: 2699 DEDLLSKPPN------MGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIK-NMGNEEIESVMQEAKMMASVS-HMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFL--IRNKNKITSLI----MLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLM 3565
            + ++L +PPN       G  +I  ++ ++       +G GAFG V+KG  + P  +            +PVA+K +K N  +EE E  ++E +MM +V  H + +   G C+  +  C+I  YV  G L  +L  +R +    S I     LS++ QIA GM +L    IIHRDLAARN+LV   + ++I+DFG+S+         I +  G +P+RWL+ E + D  YS+++DVWA+GV LWEI T G  PY + A  DI + + +G RL QP  CS D+YI+M +CW      RP F  ++
Sbjct:  163 ETNILYRPPNEVNGGTTGEWLIRGQDIVV----GAVIGEGAFGQVFKGILRGPNGQ-----------VIPVAVKQLKANAIDEEREEFVREIQMMQTVGQHDNIVTMYGYCMDEQLQCMIMEYVPYGDLKHYLQNMRKEKDSDSAIDSKEFLSFTNQIACGMAHLESVGIIHRDLAARNILVGTGKVLKISDFGMSR-----PGVYIKMSKGVIPLRWLSPEAIKDNTYSNKSDVWAFGVLLWEIATLGGFPYNNVADKDILNQLTEGMRLEQPAKCSDDMYILMKSCWNLKAEDRPSFLAIL 445          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Fly
Match: Egfr (gene:FBgn0003731 transcript:FBtr0071653)

HSP 1 Score: 441.81 bits (1135), Expect = 1.121e-130
Identity = 347/1184 (29.31%), Postives = 554/1184 (46.79%), Query Frame = 2
Query:  254 RSKNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELC--RGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSF-----VKHNITVEMLY--------ENLNKLQELEG------------GFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLCYM-NIPVNELFKNVKNFYYIPSNCTDKICHKD-------CSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCV---KTCHEG---TYAFPNDRPDISRFYPVTG-FTCLPCPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRCPRDESYGTKIIDSISYCKTCHSSCKGCYGSTIFNCTRCKNKKI--------YLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMG----RLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIK-VIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDPY 3628
            R  NCT++ G+   L +T L ++  +L+F D+I E+ G+++I   D++K+ F  L+IIRG      ++ ++    ++L V+  + +  L+   LR +    V F +N  + ++  +I+W+E+ ++      ++   T       KC + C          CWG     CQ+  +  C    S +C   R    + + CC+  C GGC G     C ACKN  +E  C E C     Y+       TN E +Y  G  C K+CP  +L +N  CV  C +    +K   C+ C G        PC      G T       L A ++   +NC  I G I + + +F     V  N T+   Y        E  + ++E+ G              SYF++                   +H        +   AI ++ L  L +++LK+I+ G      N+ LCY+ NI    + K  +   ++  N    +C K+       C+E GCWG G   C  C+ ++  GTC++DC    G+ +  N+    N+ C  CHPEC  TC G   + C + C + R+   CV+ C KN Y   ND   C  CH  C       CTGP    GIG C  C   +++  A +  C+     C +G    Y  P ++  +    P+ G   C  C  LC  C         C  C     +  C   CP D     +  +    C  CH  C GC G    +C  C+N K+        Y++   F C   CP        +  +    C +     +K+      ++   +   +L+  I ++  +    ++K  A++   ++    S       +D + L +P N+G    +L IV   +L    +   LG GAFG VYKG W +P+ E         +  +PVAIK ++K+ G E  E  ++EA +MASV H++ L+ + VC+S +   LI+  +  G L  ++  N++KI S  +L+WS QIA GM YL ++ ++HRDLAARNVLV     V+ITDFGL+K+L S+   E     GK+PI+WLA+E + +  ++ ++DVWA+GVT+WE+ TFG+ P+E+    DI D +  G +L QP+ICSLD+Y  +++CW     +RP F+ L   F ++ ++PGRYL+I GD +
Sbjct:   76 RYTNCTYVDGN---LELTWLPNENLDLSFLDNIREVTGYILISHVDVKKVVFPKLQIIRGRTLFSLSVEEE---KYALFVT-YSKMYTLEIPDLRDVLNGQVGFHNNYNLCHM-RTIQWSEIVSN-GTDAYYNYDFTAPERECPKCHESCTHG-------CWGEGPKNCQKFSKLTC----SPQCAGGRCYGPKPRECCHLFCAGGCTGPTQKDCIACKNFFDEGVCKEECPPMRKYNPTTYVLETNPEGKYAYGATCVKECPGHLLRDNGACVRSCPQDKM-DKGGECVPCNG--------PCPK-TCPGVT------VLHAGNIDSFRNCTVIDGNIRILDQTFSGFQDVYANYTMGPRYIPLDPERLEVFSTVKEITGYLNIEGTHPQFRNLSYFRN----------------LETIHGRQLMESMFAALAIVKSSLYSLEMRNLKQISSGSVVIQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADLCEKNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC----GYIS--NAYKFDNRTCKICHPEC-RTCNGAGADHC-QECVHVRDGQHCVSECPKNKY---NDRGVCRECHATCDG-----CTGPKDTIGIGACTTCNLAIINNDATVKRCLLKDDKCPDGYFWEYVHPQEQGSLK---PLAGRAVCRKCHPLCELCTNYGYHEQVCSKCTHYKRREQCETECPADHYTDEEQRE----CFQCHPECNGCTGPGADDCKSCRNFKLFDANETGPYVNSTMFNCTSKCPLEMRHVNYQYTAIGPYCAASPPRSSKITANLDVNMIFIITGAVLVPTICILCVVTYICRQKQKAKKETVKMTMALSG-----CEDSEPL-RPSNIGANLCKLRIVKDAEL---RKGGVLGMGAFGRVYKGVW-VPEGE---------NVKIPVAIKELLKSTGAESSEEFLREAYIMASVEHVNLLKLLAVCMSSQM-MLITQLMPLGCLLDYVRNNRDKIGSKALLNWSTQIAKGMSYLEEKRLVHRDLAARNVLVQTPSLVKITDFGLAKLL-SSDSNEYKAAGGKMPIKWLALECIRNRVFTSKSDVWAFGVTIWELLTFGQRPHENIPAKDIPDLIEVGLKLEQPEICSLDIYCTLLSCWHLDAAMRPTFKQLTTVFAEFARDPGRYLAIPGDKF 1163          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Fly
Match: Egfr (gene:FBgn0003731 transcript:FBtr0071654)

HSP 1 Score: 442.58 bits (1137), Expect = 1.512e-130
Identity = 347/1184 (29.31%), Postives = 554/1184 (46.79%), Query Frame = 2
Query:  254 RSKNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELC--RGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSF-----VKHNITVEMLY--------ENLNKLQELEG------------GFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLCYM-NIPVNELFKNVKNFYYIPSNCTDKICHKD-------CSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCV---KTCHEG---TYAFPNDRPDISRFYPVTG-FTCLPCPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRCPRDESYGTKIIDSISYCKTCHSSCKGCYGSTIFNCTRCKNKKI--------YLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMG----RLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIK-VIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDPY 3628
            R  NCT++ G+   L +T L ++  +L+F D+I E+ G+++I   D++K+ F  L+IIRG      ++ ++    ++L V+  + +  L+   LR +    V F +N  + ++  +I+W+E+ ++      ++   T       KC + C          CWG     CQ+  +  C    S +C   R    + + CC+  C GGC G     C ACKN  +E  C E C     Y+       TN E +Y  G  C K+CP  +L +N  CV  C +    +K   C+ C G        PC      G T       L A ++   +NC  I G I + + +F     V  N T+   Y        E  + ++E+ G              SYF++                   +H        +   AI ++ L  L +++LK+I+ G      N+ LCY+ NI    + K  +   ++  N    +C K+       C+E GCWG G   C  C+ ++  GTC++DC    G+ +  N+    N+ C  CHPEC  TC G   + C + C + R+   CV+ C KN Y   ND   C  CH  C       CTGP    GIG C  C   +++  A +  C+     C +G    Y  P ++  +    P+ G   C  C  LC  C         C  C     +  C   CP D     +  +    C  CH  C GC G    +C  C+N K+        Y++   F C   CP        +  +    C +     +K+      ++   +   +L+  I ++  +    ++K  A++   ++    S       +D + L +P N+G    +L IV   +L    +   LG GAFG VYKG W +P+ E         +  +PVAIK ++K+ G E  E  ++EA +MASV H++ L+ + VC+S +   LI+  +  G L  ++  N++KI S  +L+WS QIA GM YL ++ ++HRDLAARNVLV     V+ITDFGL+K+L S+   E     GK+PI+WLA+E + +  ++ ++DVWA+GVT+WE+ TFG+ P+E+    DI D +  G +L QP+ICSLD+Y  +++CW     +RP F+ L   F ++ ++PGRYL+I GD +
Sbjct:  125 RYTNCTYVDGN---LELTWLPNENLDLSFLDNIREVTGYILISHVDVKKVVFPKLQIIRGRTLFSLSVEEE---KYALFVT-YSKMYTLEIPDLRDVLNGQVGFHNNYNLCHM-RTIQWSEIVSN-GTDAYYNYDFTAPERECPKCHESCTHG-------CWGEGPKNCQKFSKLTC----SPQCAGGRCYGPKPRECCHLFCAGGCTGPTQKDCIACKNFFDEGVCKEECPPMRKYNPTTYVLETNPEGKYAYGATCVKECPGHLLRDNGACVRSCPQDKM-DKGGECVPCNG--------PCPK-TCPGVT------VLHAGNIDSFRNCTVIDGNIRILDQTFSGFQDVYANYTMGPRYIPLDPERLEVFSTVKEITGYLNIEGTHPQFRNLSYFRN----------------LETIHGRQLMESMFAALAIVKSSLYSLEMRNLKQISSGSVVIQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADLCEKNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC----GYIS--NAYKFDNRTCKICHPEC-RTCNGAGADHC-QECVHVRDGQHCVSECPKNKY---NDRGVCRECHATCDG-----CTGPKDTIGIGACTTCNLAIINNDATVKRCLLKDDKCPDGYFWEYVHPQEQGSLK---PLAGRAVCRKCHPLCELCTNYGYHEQVCSKCTHYKRREQCETECPADHYTDEEQRE----CFQCHPECNGCTGPGADDCKSCRNFKLFDANETGPYVNSTMFNCTSKCPLEMRHVNYQYTAIGPYCAASPPRSSKITANLDVNMIFIITGAVLVPTICILCVVTYICRQKQKAKKETVKMTMALSG-----CEDSEPL-RPSNIGANLCKLRIVKDAEL---RKGGVLGMGAFGRVYKGVW-VPEGE---------NVKIPVAIKELLKSTGAESSEEFLREAYIMASVEHVNLLKLLAVCMSSQM-MLITQLMPLGCLLDYVRNNRDKIGSKALLNWSTQIAKGMSYLEEKRLVHRDLAARNVLVQTPSLVKITDFGLAKLL-SSDSNEYKAAGGKMPIKWLALECIRNRVFTSKSDVWAFGVTIWELLTFGQRPHENIPAKDIPDLIEVGLKLEQPEICSLDIYCTLLSCWHLDAAMRPTFKQLTTVFAEFARDPGRYLAIPGDKF 1212          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Fly
Match: Eph (gene:FBgn0025936 transcript:FBtr0301285)

HSP 1 Score: 179.104 bits (453), Expect = 4.396e-45
Identity = 102/303 (33.66%), Postives = 160/303 (52.81%), Query Frame = 2
Query: 2789 LGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIE-SVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDPYEIPSPHSIEMTNFNNHYGEDQF 3694
            +G G FG V +G+ KIP N    ++       + VAIK +K   +E+     + EA +M    H + +   GV        +I+ Y++ GSLD FL  N  K  +L ++     IA GM YL+  N +HRDLAARNVLV+     +I DFGLS+ +E+  D     + GK+P+RW A E +   K++  +DVW+YGV LWE+ ++G+ PY + +  D+   + KG RL  P  C   +Y +M++CW +    RP F +++ T  +  + P   L+ +      PSP S      +   G++ F
Sbjct:  714 IGGGEFGDVCRGRLKIPPN---FVQD------IDVAIKTLKPGSSEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLRVNDGKFQTLQLIVMLRGIASGMSYLSDMNYVHRDLAARNVLVNAQLICKIADFGLSREIENASDA-YTTRGGKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPEALYQLMLDCWQKQRTHRPTFASIVSTLDNLARQPQSLLTTR------PSPESDGNHILDGQRGQNIF 1000          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Fly
Match: Eph (gene:FBgn0025936 transcript:FBtr0089083)

HSP 1 Score: 178.333 bits (451), Expect = 7.207e-45
Identity = 102/303 (33.66%), Postives = 160/303 (52.81%), Query Frame = 2
Query: 2789 LGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIE-SVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDPYEIPSPHSIEMTNFNNHYGEDQF 3694
            +G G FG V +G+ KIP N    ++       + VAIK +K   +E+     + EA +M    H + +   GV        +I+ Y++ GSLD FL  N  K  +L ++     IA GM YL+  N +HRDLAARNVLV+     +I DFGLS+ +E+  D     + GK+P+RW A E +   K++  +DVW+YGV LWE+ ++G+ PY + +  D+   + KG RL  P  C   +Y +M++CW +    RP F +++ T  +  + P   L+ +      PSP S      +   G++ F
Sbjct:  698 IGGGEFGDVCRGRLKIPPN---FVQD------IDVAIKTLKPGSSEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLRVNDGKFQTLQLIVMLRGIASGMSYLSDMNYVHRDLAARNVLVNAQLICKIADFGLSREIENASDA-YTTRGGKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPEALYQLMLDCWQKQRTHRPTFASIVSTLDNLARQPQSLLTTR------PSPESDGNHILDGQRGQNIF 984          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Fly
Match: Eph (gene:FBgn0025936 transcript:FBtr0089082)

HSP 1 Score: 178.333 bits (451), Expect = 8.047e-45
Identity = 102/303 (33.66%), Postives = 160/303 (52.81%), Query Frame = 2
Query: 2789 LGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIE-SVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDPYEIPSPHSIEMTNFNNHYGEDQF 3694
            +G G FG V +G+ KIP N    ++       + VAIK +K   +E+     + EA +M    H + +   GV        +I+ Y++ GSLD FL  N  K  +L ++     IA GM YL+  N +HRDLAARNVLV+     +I DFGLS+ +E+  D     + GK+P+RW A E +   K++  +DVW+YGV LWE+ ++G+ PY + +  D+   + KG RL  P  C   +Y +M++CW +    RP F +++ T  +  + P   L+ +      PSP S      +   G++ F
Sbjct:  731 IGGGEFGDVCRGRLKIPPN---FVQD------IDVAIKTLKPGSSEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLRVNDGKFQTLQLIVMLRGIASGMSYLSDMNYVHRDLAARNVLVNAQLICKIADFGLSREIENASDA-YTTRGGKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPEALYQLMLDCWQKQRTHRPTFASIVSTLDNLARQPQSLLTTR------PSPESDGNHILDGQRGQNIF 1017          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Zebrafish
Match: erbb4a (erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Acc:ZDB-GENE-030918-4])

HSP 1 Score: 269.626 bits (688), Expect = 5.685e-73
Identity = 203/602 (33.72%), Postives = 317/602 (52.66%), Query Frame = 2
Query: 1910 KNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSKCKGKS-----PKNDECEVCKGVWHKNTCRLRCPRD----ESYGTKIIDSISYCKTCHSSCKGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVE-EIEKGSGDIVCLSL-WESKAKLEE----TKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAER------IETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSPH 3646
            KN   P   SK    C P CSE     C GP    G   C  C+    SR     +CVK+C+   Y       D+  F    G  C+ C   C K   K      P  D C  C  +     C  +CP       S+  K  ++ + C  CH +C    GS   N  RC+ + +Y    +  C++   P++S    +++   D + L++ + +  ++++      RT +    ++  L +++I+ + + VY++RK+I ++      +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ ++ G +     M EA +MAS+ H H +R +GVCLS     L++  +  G L  ++  +++ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     ++ITDFGL+++L+ T +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T DI D + KG RL QP IC++DVY++MV CW+   + RP F+ L   F+   ++P RYL IQGD   ++PSP+
Sbjct:  461 KNNREPRECSKEQKICDPLCSEAG---CWGP----GPDQCLSCK--YFSRGK---TCVKSCNL-YYG------DVREF--ANGSVCVECDSQCEKAGEKGLTCHGPGPDHCVKCLHLKDGPNCVEKCPDGLQGANSFIFKYAETNNECHPCHPNCT--QGSVACNRFRCRTRILY----RTSCDN---PMQSYNCSLDRNMFDAMFLNVTYCTGPRIQDCVGILDRTPLIAAGLIGGLFVIVIIALGVAVYIRRKSIKKKRALRRFLETEL-------VEPLTPS----GAAPNQAQLRILKETEL---KRVKILGAGAFGMVYKGIW-VPEGETV---------KIPVAIKILNESTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHQDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLD-TDEKEYNSDGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTRDIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPN 1006          

HSP 2 Score: 155.221 bits (391), Expect = 2.222e-37
Identity = 160/621 (25.76%), Postives = 260/621 (41.87%), Query Frame = 2
Query:  260 KNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVS----GNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHS--IKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYF---KNKSNHCIKCYGNMCTN--DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLY-------ENLNKLQELE--GGFSYFKD--NHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLC-YMNIPVNELFKNVKNFYYI-----PSNCT--DKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLN------TCVGPNPNQCIKGCKNKRENGTCVASCSKNF-------YPPLNDSKACLPCHPNCSE 1975
            +NC  + G++ I  I     + R L+F  SI E+ G++++  N  + +  +NLRIIRG        + +G    ++ ++    G   L  L  ++L  I    V  D N   K+L H+  I W+++  +P++++L  P+        +   + CK         CWG   +QCQ   +T+C  +    C      N     CC+ +C GGC G   + C AC N  +   CV  C  P  Y+        N   +Y  G FC K+CP   + +++ CV  C        +N++  CI C  ++C    D +     ++A   D +N        + +  NC KI G ++     F+   I  +M +       + LN  + +    GF   +    ++ +L    NL       L+S I  L    ++  S      L  +SL+EI+ G      N +LC Y  +    LF+       I     P  C+   KIC   CSE GCWGPG   C  C+ +    TCV  C+    +Y  +     +   C+ C  +C        TC GP P+ C+K C + ++   CV  C           +     +  C PCHPNC++
Sbjct:   27 ENCEVVMGNLEITSI----ERNRNLSFLKSIREVTGYVLVALNQFDYLPLENLRIIRGTK------LYEGRYSLAIFLNYRRDGYFGLRQLGLKNLTEILNGGVYVDQN---KFLCHADTIHWHDIIKNPRSELLVVPS--------NNSGNTCKRCHRSCNGRCWGHQEDQCQSLTKTVCAEQCDGRCFGPYVSN-----CCHRECAGGCFGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPNAKYTYGAFCVKKCPHNFVVDHSSCVRACPSNKMEVEENQTKMCIPCT-DICPKVCDGIGTGSLQMAQTVDSSN--------IEKFVNCTKINGNLI-----FLITGIKGDMFHGIRALDPDRLNVFRTVREITGFLNVQSWPENMTDLGVFSNLATIGGRSLYSGISLLILKQRWITS------LQFQSLREISAGNVYMTNNSQLCFYSTVNWTSLFRTSTQRALIKNNREPRECSKEQKICDPLCSEAGCWGPGPDQCLSCKYFSRGKTCVKSCNL---YYGDVR-EFANGSVCVECDSQCEKAGEKGLTCHGPGPDHCVK-CLHLKDGPNCVEKCPDGLQGANSFIFKYAETNNECHPCHPNCTQ 596          

HSP 3 Score: 60.8474 bits (146), Expect = 1.385e-8
Identity = 77/298 (25.84%), Postives = 120/298 (40.27%), Query Frame = 2
Query:  167 PGTIICQN--DNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYIL----------GITKLESKERELNFDSIEEIDGHLIIEG---NDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANF-TQVFCWGPSANQCQQQTLCGSKYSSECTTC------------RYINGEEQGCCNDQCLGG------CNGGGASKCTACKNMLNEKKCVELCRGPYSGG 958
            P T IC    D +   SL  + + +   +I +  NCT I G++  L          GI  L+  +R   F ++ EI G L ++    N  +   F NL  I G     R+L    ++  SL++     +  L F+SLR I+A NV   +N ++ +   ++ W  LF     + L      K+     +CS + K+     ++  CWGP  +QC        KY S   TC             + NG     C+ QC         C+G G   C  C ++ +   CVE C     G 
Sbjct:  298 PCTDICPKVCDGIGTGSLQMA-QTVDSSNIEKFVNCTKINGNLIFLITGIKGDMFHGIRALDP-DRLNVFRTVREITGFLNVQSWPENMTDLGVFSNLATIGG-----RSL----YSGISLLILKQRWITSLQFQSLREISAGNVYMTNNSQLCFY-STVNWTSLFRTSTQRALI-----KNNREPRECSKEQKICDPLCSEAGCWGPGPDQC-----LSCKYFSRGKTCVKSCNLYYGDVREFANGSVCVECDSQCEKAGEKGLTCHGPGPDHCVKCLHLKDGPNCVEKCPDGLQGA 573          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Zebrafish
Match: erbb4a (erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Acc:ZDB-GENE-030918-4])

HSP 1 Score: 264.618 bits (675), Expect = 1.234e-71
Identity = 202/596 (33.89%), Postives = 293/596 (49.16%), Query Frame = 2
Query: 1910 KNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSKCKGKS-----PKNDECEVCKGVWHKNTCRLRCPRD----ESYGTKIIDSISYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAER------IETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSP 3643
            KN   P   SK    C P CSE     C GP    G   C  C+    SR     +CVK+C+   Y       D+  F    G  C+ C   C K   K      P  D C  C  +     C  +CP       S+  K  ++ + C  CH +C +GC G  I +C         LD+          PL +   I  G   IV ++L                                 + VY++RK+I ++      +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ ++ G +     M EA +MAS+ H H +R +GVCLS     L++  +  G L  ++  +++ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     ++ITDFGL+++L+ T +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T DI D + KG RL QP IC++DVY++MV CW+   + RP F+ L   F+   ++P RYL IQGD   ++PSP
Sbjct:  283 KNNREPRECSKEQKICDPLCSEAG---CWGP----GPDQCLSCK--YFSRGK---TCVKSCNL-YYG------DVREF--ANGSVCVECDSQCEKAGEKGLTCHGPGPDHCVKCLHLKDGPNCVEKCPDGLQGANSFIFKYAETNNECHPCHPNCTQGCTGPRIQDCVG------ILDRT---------PLIAAGLI-GGLFVIVIIAL--------------------------------GVAVYIRRKSIKKKRALRRFLETEL-------VEPLTPS----GAAPNQAQLRILKETEL---KRVKILGAGAFGMVYKGIW-VPEGETV---------KIPVAIKILNESTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHQDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLD-TDEKEYNSDGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTRDIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFSRMARDPQRYLVIQGDDRMKLPSP 783          

HSP 2 Score: 110.923 bits (276), Expect = 8.715e-24
Identity = 117/431 (27.15%), Postives = 177/431 (41.07%), Query Frame = 2
Query:  836 CCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFK---NKSNHCIKCYGNMCTN--DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLY-------ENLNKLQELE--GGFSYFKD--NHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLC-YMNIPVNELFKNVKNFYYI-----PSNCT--DKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLN------TCVGPNPNQCIKGCKNKRENGTCVASCSKNF---------YPPLNDSKACLPCHPNCSEYNSTICTGP 2002
            CC+ +C GGC G   + C AC N  +   CV  C  P  Y+        N   +Y  G FC K+CP   + +++ CV  C     +   N++  CI C  ++C    D +     ++A   D +N        + +  NC KI G ++     F+   I  +M +       + LN  + +    GF   +    ++ +L    NL       L+S I  L    ++  S      L  +SL+EI+ G      N +LC Y  +    LF+       I     P  C+   KIC   CSE GCWGPG   C  C+ +    TCV  C+    +Y  +     +   C+ C  +C        TC GP P+ C+K C + ++   CV  C             Y   N+   C PCHPNC++     CTGP
Sbjct:   24 CCHRECAGGCFGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPNAKYTYGAFCVKKCPHNFVVDHSSCVRACPSNKMEVEENQTKMCIPCT-DICPKVCDGIGTGSLQMAQTVDSSN--------IEKFVNCTKINGNLI-----FLITGIKGDMFHGIRALDPDRLNVFRTVREITGFLNVQSWPENMTDLGVFSNLATIGGRSLYSGISLLILKQRWITS------LQFQSLREISAGNVYMTNNSQLCFYSTVNWTSLFRTSTQRALIKNNREPRECSKEQKICDPLCSEAGCWGPGPDQCLSCKYFSRGKTCVKSCNL---YYGDVR-EFANGSVCVECDSQCEKAGEKGLTCHGPGPDHCVK-CLHLKDGPNCVEKCPDGLQGANSFIFKYAETNNE--CHPCHPNCTQG----CTGP 423          

HSP 3 Score: 61.6178 bits (148), Expect = 9.876e-9
Identity = 68/257 (26.46%), Postives = 105/257 (40.86%), Query Frame = 2
Query:  263 NCTHIQGSIYIL----------GITKLESKERELNFDSIEEIDGHLIIEG---NDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANF-TQVFCWGPSANQCQQQTLCGSKYSSECTTC------------RYINGEEQGCCNDQCLGG------CNGGGASKCTACKNMLNEKKCVELC 937
            NCT I G++  L          GI  L+  +R   F ++ EI G L ++    N  +   F NL  I G     R+L    ++  SL++     +  L F+SLR I+A NV   +N ++ +   ++ W  LF     + L      K+     +CS + K+     ++  CWGP  +QC        KY S   TC             + NG     C+ QC         C+G G   C  C ++ +   CVE C
Sbjct:  153 NCTKINGNLIFLITGIKGDMFHGIRALDP-DRLNVFRTVREITGFLNVQSWPENMTDLGVFSNLATIGG-----RSL----YSGISLLILKQRWITSLQFQSLREISAGNVYMTNNSQLCFY-STVNWTSLFRTSTQRALI-----KNNREPRECSKEQKICDPLCSEAGCWGPGPDQC-----LSCKYFSRGKTCVKSCNLYYGDVREFANGSVCVECDSQCEKAGEKGLTCHGPGPDHCVKCLHLKDGPNCVEKC 388          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Zebrafish
Match: si:ch73-383l1.1 (si:ch73-383l1.1 [Source:ZFIN;Acc:ZDB-GENE-121214-64])

HSP 1 Score: 265.003 bits (676), Expect = 2.853e-71
Identity = 195/587 (33.22%), Postives = 288/587 (49.06%), Query Frame = 2
Query: 1925 PLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTC--HEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSKCKGKS-----PKNDECEVCKGVWHKNTCRLRCPRD----ESYGTKIIDSISYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSP 3643
            P   S+  + C P CS    + C GP    G   C  C+     R     +CV++C  + G         D+  F    G TC+ C   C K + KS     P  D C  C  +     C  +CP       S+  K  ++ + C  CH +C +GC G  I +C         LD+          PL +   I    G  V + +    A     K                           K++A+   +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ ++ G +     M EA +MAS+ H H +R +GVCLS     L++  +  G L  ++  +++ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     ++ITDFGL+++LE T +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T +I D + KG RL QP IC++DVY++MV CW+   + RP F+ L   F+   ++P RYL IQGD   ++PSP
Sbjct:  492 PRECSQQRMVCDPLCS---VSGCWGP----GPNQCLSCKYFSRGR-----TCVRSCNLYNG---------DVREF--ANGSTCVECDSQCEKAEDKSLTCHGPGPDHCVKCLHLKDGPNCVEKCPDGLQGANSFIFKYPETNNECHPCHPNCTQGCTGPRIQDCIG------ILDRT---------PLIAAGVI---GGMFVVVIVALGFAIFFRRKSIK------------------------KKRALRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRVKILGTGAFGTVYKGIW-VPEGETV---------KIPVAIKILNESTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHQDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLE-TNEKEYSADEGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFSRMARDPQRYLVIQGDDRMKLPSP 987          

HSP 2 Score: 163.31 bits (412), Expect = 8.361e-40
Identity = 174/663 (26.24%), Postives = 275/663 (41.48%), Query Frame = 2
Query:  170 GTIICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVS----GNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHS--IKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNH---CIKCY---GNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLY-------ENLNKLQELEGGFSYFK----DNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLC-YMNIPVNELFKNVKNFYYI-----PSNCTDK--ICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLN------TCVGPNPNQCIKGCKNKRENGTCVASCSKNF---------YPPLNDSKACLPCHPNCSEYNSTICTGP 2002
            G  +C   + ++ +L    ++ K L     +NC  + G++ I  I     + R L+F  SI E+ G++++  N  + +  +NLRIIRG        + +G    ++ ++    G   L  L  R+L  I    V  D N   K+L H+  I W ++  +P++++L  P+       R +C   C          CWGP  +QCQ   +T+C  +    C      N     CC+ +C GGC G   + C AC N  +   CV  C  P  Y+        N   +Y  G FC K+CP   + +++ CV  C     + + N+   CI+C      MC  D +     + A   D +N        + +  NC KI G ++     F+   I  +M +       E LN  + +     Y        ++ +L+   NL+      L+S I  L    ++  S      L  +SL+EI+ G      N +LC Y  +    LF+       I     P  C+ +  +C   CS  GCWGPG   C  C+ +    TCV  C+     YN       +   C+ C  +C        TC GP P+ C+K C + ++   CV  C             YP  N+   C PCHPNC++     CTGP
Sbjct:   24 GQSVCPGTDNKLSTLSDLDQQYKTLRKFY-ENCEVVMGNLEITSI----ERNRNLSFLKSIREVTGYVLVALNQFDYLPLENLRIIRGTK------LYEGRYSLAIFLNYRRDGYFGLRQLGLRNLTEILNGGVYVDQN---KFLCHADTIHWQDIIKNPRSELLVVPSNNSGNTCR-RCHRSCN-------GRCWGPQEDQCQSLTKTVCAEQCDGRCFGPYVSN-----CCHRECAGGCFGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPNAKYTYGAFCVKKCPHNFVVDHSSCVRACPSNKTEVEENNIKMCIQCTEICPKMC--DGIGTGSLQSAQTVDSSN--------IEKFVNCTKINGNLI-----FLITGIKGDMYHGIRALDPERLNVFRTVREITGYLNIQSWPENMTDLSVFSNLVTIGGRTLYSGISLLILKQRWITS------LQFQSLREISAGNVYMTNNSQLCFYSTVNWTSLFRTSTQKAKIKDNRDPRECSQQRMVCDPLCSVSGCWGPGPNQCLSCKYFSRGRTCVRSCN----LYNGDVREFANGSTCVECDSQCEKAEDKSLTCHGPGPDHCVK-CLHLKDGPNCVEKCPDGLQGANSFIFKYPETNNE--CHPCHPNCTQG----CTGP 627          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Zebrafish
Match: si:ch73-383l1.1 (si:ch73-383l1.1 [Source:ZFIN;Acc:ZDB-GENE-121214-64])

HSP 1 Score: 255.373 bits (651), Expect = 2.933e-71
Identity = 133/309 (43.04%), Postives = 197/309 (63.75%), Query Frame = 2
Query: 2723 PNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSP 3643
            PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ ++ G +     M EA +MAS+ H H +R +GVCLS     L++  +  G L  ++  +++ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     ++ITDFGL+++LE T +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T +I D + KG RL QP IC++DVY++MV CW+   + RP F+ L   F+   ++P RYL IQGD   ++PSP
Sbjct:   12 PNQAQLRILKETEL---KRVKILGTGAFGTVYKGIW-VPEGETV---------KIPVAIKILNESTGPKANVEFMDEALIMASMEHPHLVRLLGVCLS-PTIQLVTQLMPHGCLLDYVHEHQDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLE-TNEKEYSADEGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFSRMARDPQRYLVIQGDDRMKLPSP 305          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Zebrafish
Match: erbb4a (erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Acc:ZDB-GENE-030918-4])

HSP 1 Score: 264.618 bits (675), Expect = 3.437e-71
Identity = 202/597 (33.84%), Postives = 294/597 (49.25%), Query Frame = 2
Query: 1910 KNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSKCKGKS-----PKNDECEVCKGVWHKNTCRLRCPRD----ESYGTKIIDSISYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAER------IETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSPH 3646
            KN   P   SK    C P CSE     C GP    G   C  C+    SR     +CVK+C+   Y       D+  F    G  C+ C   C K   K      P  D C  C  +     C  +CP       S+  K  ++ + C  CH +C +GC G  I +C         LD+          PL +   I  G   IV ++L                                 + VY++RK+I ++      +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ ++ G +     M EA +MAS+ H H +R +GVCLS     L++  +  G L  ++  +++ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     ++ITDFGL+++L+ T +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T DI D + KG RL QP IC++DVY++MV CW+   + RP F+ L   F+   ++P RYL IQGD   ++PSP+
Sbjct:  461 KNNREPRECSKEQKICDPLCSEAG---CWGP----GPDQCLSCK--YFSRGK---TCVKSCNL-YYG------DVREF--ANGSVCVECDSQCEKAGEKGLTCHGPGPDHCVKCLHLKDGPNCVEKCPDGLQGANSFIFKYAETNNECHPCHPNCTQGCTGPRIQDCVG------ILDRT---------PLIAAGLI-GGLFVIVIIAL--------------------------------GVAVYIRRKSIKKKRALRRFLETEL-------VEPLTPS----GAAPNQAQLRILKETEL---KRVKILGAGAFGMVYKGIW-VPEGETV---------KIPVAIKILNESTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHQDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLD-TDEKEYNSDGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTRDIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPN 962          

HSP 2 Score: 157.532 bits (397), Expect = 4.605e-38
Identity = 165/630 (26.19%), Postives = 264/630 (41.90%), Query Frame = 2
Query:  260 KNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVS----GNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHS--IKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYF---KNKSNHCIKCYGNMCTN--DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLY-------ENLNKLQELE--GGFSYFKD--NHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLC-YMNIPVNELFKNVKNFYYI-----PSNCT--DKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLN------TCVGPNPNQCIKGCKNKRENGTCVASCSKNF-------YPPLNDSKACLPCHPNCSEYNSTICTGP 2002
            +NC  + G++ I  I     + R L+F  SI E+ G++++  N  + +  +NLRIIRG        + +G    ++ ++    G   L  L  ++L  I    V  D N   K+L H+  I W+++  +P++++L  P+       R +C   C          CWG   +QCQ   +T+C  +    C      N     CC+ +C GGC G   + C AC N  +   CV  C  P  Y+        N   +Y  G FC K+CP   + +++ CV  C        +N++  CI C  ++C    D +     ++A   D +N        + +  NC KI G ++     F+   I  +M +       + LN  + +    GF   +    ++ +L    NL       L+S I  L    ++  S      L  +SL+EI+ G      N +LC Y  +    LF+       I     P  C+   KIC   CSE GCWGPG   C  C+ +    TCV  C+    +Y  +     +   C+ C  +C        TC GP P+ C+K C + ++   CV  C           +     +  C PCHPNC++     CTGP
Sbjct:   27 ENCEVVMGNLEITSI----ERNRNLSFLKSIREVTGYVLVALNQFDYLPLENLRIIRGTK------LYEGRYSLAIFLNYRRDGYFGLRQLGLKNLTEILNGGVYVDQN---KFLCHADTIHWHDIIKNPRSELLVVPSNNSGNTCR-RCHRSCN-------GRCWGHQEDQCQSLTKTVCAEQCDGRCFGPYVSN-----CCHRECAGGCFGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPNAKYTYGAFCVKKCPHNFVVDHSSCVRACPSNKMEVEENQTKMCIPCT-DICPKVCDGIGTGSLQMAQTVDSSN--------IEKFVNCTKINGNLI-----FLITGIKGDMFHGIRALDPDRLNVFRTVREITGFLNVQSWPENMTDLGVFSNLATIGGRSLYSGISLLILKQRWITS------LQFQSLREISAGNVYMTNNSQLCFYSTVNWTSLFRTSTQRALIKNNREPRECSKEQKICDPLCSEAGCWGPGPDQCLSCKYFSRGKTCVKSCNL---YYGDVR-EFANGSVCVECDSQCEKAGEKGLTCHGPGPDHCVK-CLHLKDGPNCVEKCPDGLQGANSFIFKYAETNNECHPCHPNCTQG----CTGP 601          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Xenopus
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:100493234])

HSP 1 Score: 264.618 bits (675), Expect = 2.625e-71
Identity = 211/647 (32.61%), Postives = 303/647 (46.83%), Query Frame = 2
Query: 1925 PLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSK-------CKGKSPKNDECEVCKGVWHKNTCRLRCPRD----ESYGTKIIDSISYCKTCHSSCK-GCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAER------IETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSPHSIEMTNFNNHYGEDQFNFPSMTAETML---------PLLNGRDSIDRDVKDFT 3778
            P N +   + C P CS      C GP    G   C  C     SR     SCV++C        N     SR + V G  C+ C   C K       C G  P  D C  C        C  +CP       S+  K  D    C  CH +C  GC   T  +C                                         LW     L +  RT +    V+  L +++I+ +T  VY++RK+I ++      +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ +  G +     M EA +MAS+ H H +R +GV LS     L++  +  G L  ++  +K+ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     V+ITDFGL+++LE   +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T +I D + KG RL QP +C++DVY++MV CW+   + RP F+ L   F+   ++P RYL IQGD   ++PSP+  +   F N   E+      M AE  L         P+   R  ID +   F 
Sbjct:  468 PENCTAEGMVCDPLCSNAG---CWGP----GANQCLSCR--YFSRGK---SCVRSC--------NLYKGESREF-VNGSVCVMCDSQCEKMEDSIVTCYGPGP--DHCTKCSNFKDGPNCVEKCPEGLQGANSFIFKYADEDKECHPCHPNCTDGCNNPTSHDC-----------------------------------------LWNDPLTLPQHARTPLIAASVIGGLFIIVIMALTFAVYIRRKSIKKKRALRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRIKILGSGAFGTVYKGIW-VPEGETV---------KIPVAIKILNETTGPKANAEFMDEALIMASMDHPHLVRLLGVSLS-PTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEG-DEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTVWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPVCTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKF--FQNLLDEEDLG-DMMDAEEYLVPQAFNIPPPIYTSRTRIDSNRNQFV 1021          

HSP 2 Score: 156.762 bits (395), Expect = 9.746e-38
Identity = 172/656 (26.22%), Postives = 274/656 (41.77%), Query Frame = 2
Query:  176 IICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVV------SGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSN---HCIKCYGNMCTN--DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILG---YIVLTEDSFVKHNITVEMLYENLN---KLQELEGGFSYFK-DNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLCYMN-IPVNELFKNVKNFYYI-----PSNCTDK--ICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPEC------LNTCVGPNPNQCIKGCKNKRENGTCVASCSKNF-------YPPLNDSKACLPCHPNCSEYNSTICTGPSS 2008
            ++C     ++ SL    ++ K L     +NC  + G+   L IT +E   R L+F  SI E+ G++++  N  + +  +NLRIIRG        I      ++L +       GN  L +L  R+L  I    V    N  + Y   +I W ++   P A ++         +   +C   C          CWGPS   CQ+  +T+C  +    C    Y++     CC+ +C GGC G   + C +C    +   CV  C  P  Y+        N + +Y  G FC  +CP   + +++ CV  C     + + N    C  C G +C    D +     + A   D +N        + +  NC KI G   ++V   D    HNI   +  + LN    ++E+ G  +      ++ +L+   NL+      L+S I  L       + +  L  L  +SLKEI+ G      N+ LCY + +    LF+       I     P NCT +  +C   CS  GCWGPG   C  CR +    +CV  C+  KG     +   ++   C+ C  +C      + TC GP P+ C K C N ++   CV  C +         +   ++ K C PCHPNC++     C  P+S
Sbjct:    9 VMCAGTENKLSSLSDLEQQYKALRKYY-ENCEVVMGN---LEITSIEPG-RNLSFLRSIREVTGYVLVALNQFDYLPLENLRIIRG--------IKLYEDRYALAIFLNYRKDGNYGLRELGLRNLTEILNGGVYLGQNKFLCYA-DTIHWQDIVRTPNATLV--------PMSSGRCPKSC-------MGRCWGPSDQHCQRLTKTVCAEQCDGRCYG-SYVSD----CCHRECAGGCTGPKDTDCFSCMKFNDSGSCVTQCPQPNIYNPTAFQLEQNPKAKYTYGAFCVNKCPHNFVVDDSSCVRACPSNKMEVEENGIKMCKPCAG-ICPKVCDGIGTGSLQSAQTVDSSN--------IDKFINCTKINGNLHFLVTGIDGDPYHNIAA-LEPQKLNIFFTVREITGFLNIQSWPRNMTDLSVFSNLVNIGGRVLYSGISLL------ILKQQSLNSLQFQSLKEISAGNVYITDNRNLCYYHTVNWTSLFRTSNQRTTIRENKKPENCTAEGMVCDPLCSNAGCWGPGANQCLSCRYFSRGKSCVRSCNLYKGE----SREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCTK-CSNFKDGPNCVEKCPEGLQGANSFIFKYADEDKECHPCHPNCTDG----CNNPTS 605          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Xenopus
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:100493234])

HSP 1 Score: 264.233 bits (674), Expect = 3.386e-71
Identity = 211/647 (32.61%), Postives = 303/647 (46.83%), Query Frame = 2
Query: 1925 PLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSK-------CKGKSPKNDECEVCKGVWHKNTCRLRCPRD----ESYGTKIIDSISYCKTCHSSCK-GCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAER------IETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSPHSIEMTNFNNHYGEDQFNFPSMTAETML---------PLLNGRDSIDRDVKDFT 3778
            P N +   + C P CS      C GP    G   C  C     SR     SCV++C        N     SR + V G  C+ C   C K       C G  P  D C  C        C  +CP       S+  K  D    C  CH +C  GC   T  +C                                         LW     L +  RT +    V+  L +++I+ +T  VY++RK+I ++      +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ +  G +     M EA +MAS+ H H +R +GV LS     L++  +  G L  ++  +K+ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     V+ITDFGL+++LE   +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T +I D + KG RL QP +C++DVY++MV CW+   + RP F+ L   F+   ++P RYL IQGD   ++PSP+  +   F N   E+      M AE  L         P+   R  ID +   F 
Sbjct:  463 PENCTAEGMVCDPLCSNAG---CWGP----GANQCLSCR--YFSRGK---SCVRSC--------NLYKGESREF-VNGSVCVMCDSQCEKMEDSIVTCYGPGP--DHCTKCSNFKDGPNCVEKCPEGLQGANSFIFKYADEDKECHPCHPNCTDGCNNPTSHDC-----------------------------------------LWNDPLTLPQHARTPLIAASVIGGLFIIVIMALTFAVYIRRKSIKKKRALRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRIKILGSGAFGTVYKGIW-VPEGETV---------KIPVAIKILNETTGPKANAEFMDEALIMASMDHPHLVRLLGVSLS-PTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEG-DEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTVWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPVCTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKF--FQNLLDEEDLG-DMMDAEEYLVPQAFNIPPPIYTSRTRIDSNRNQFV 1016          

HSP 2 Score: 155.606 bits (392), Expect = 2.141e-37
Identity = 172/655 (26.26%), Postives = 273/655 (41.68%), Query Frame = 2
Query:  179 ICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVV------SGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSN---HCIKCYGNMCTN--DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILG---YIVLTEDSFVKHNITVEMLYENLN---KLQELEGGFSYFK-DNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLCYMN-IPVNELFKNVKNFYYI-----PSNCTDK--ICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPEC------LNTCVGPNPNQCIKGCKNKRENGTCVASCSKNF-------YPPLNDSKACLPCHPNCSEYNSTICTGPSS 2008
            +C     ++ SL    ++ K L     +NC  + G+   L IT +E   R L+F  SI E+ G++++  N  + +  +NLRIIRG        I      ++L +       GN  L +L  R+L  I    V    N  + Y   +I W ++   P A ++         +   +C   C          CWGPS   CQ+  +T+C  +    C    Y++     CC+ +C GGC G   + C +C    +   CV  C  P  Y+        N + +Y  G FC  +CP   + +++ CV  C     + + N    C  C G +C    D +     + A   D +N        + +  NC KI G   ++V   D    HNI   +  + LN    ++E+ G  +      ++ +L+   NL+      L+S I  L       + +  L  L  +SLKEI+ G      N+ LCY + +    LF+       I     P NCT +  +C   CS  GCWGPG   C  CR +    +CV  C+  KG     +   ++   C+ C  +C      + TC GP P+ C K C N ++   CV  C +         +   ++ K C PCHPNC++     C  P+S
Sbjct:    5 LCAGTENKLSSLSDLEQQYKALRKYY-ENCEVVMGN---LEITSIEPG-RNLSFLRSIREVTGYVLVALNQFDYLPLENLRIIRG--------IKLYEDRYALAIFLNYRKDGNYGLRELGLRNLTEILNGGVYLGQNKFLCYA-DTIHWQDIVRTPNATLV--------PMSSGRCPKSC-------MGRCWGPSDQHCQRLTKTVCAEQCDGRCYG-SYVSD----CCHRECAGGCTGPKDTDCFSCMKFNDSGSCVTQCPQPNIYNPTAFQLEQNPKAKYTYGAFCVNKCPHNFVVDDSSCVRACPSNKMEVEENGIKMCKPCAG-ICPKVCDGIGTGSLQSAQTVDSSN--------IDKFINCTKINGNLHFLVTGIDGDPYHNIAA-LEPQKLNIFFTVREITGFLNIQSWPRNMTDLSVFSNLVNIGGRVLYSGISLL------ILKQQSLNSLQFQSLKEISAGNVYITDNRNLCYYHTVNWTSLFRTSNQRTTIRENKKPENCTAEGMVCDPLCSNAGCWGPGANQCLSCRYFSRGKSCVRSCNLYKGE----SREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCTK-CSNFKDGPNCVEKCPEGLQGANSFIFKYADEDKECHPCHPNCTDG----CNNPTS 600          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Xenopus
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:100493234])

HSP 1 Score: 264.233 bits (674), Expect = 3.879e-71
Identity = 211/647 (32.61%), Postives = 303/647 (46.83%), Query Frame = 2
Query: 1925 PLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSK-------CKGKSPKNDECEVCKGVWHKNTCRLRCPRD----ESYGTKIIDSISYCKTCHSSCK-GCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAER------IETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSPHSIEMTNFNNHYGEDQFNFPSMTAETML---------PLLNGRDSIDRDVKDFT 3778
            P N +   + C P CS      C GP    G   C  C     SR     SCV++C        N     SR + V G  C+ C   C K       C G  P  D C  C        C  +CP       S+  K  D    C  CH +C  GC   T  +C                                         LW     L +  RT +    V+  L +++I+ +T  VY++RK+I ++      +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ +  G +     M EA +MAS+ H H +R +GV LS     L++  +  G L  ++  +K+ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     V+ITDFGL+++LE   +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T +I D + KG RL QP +C++DVY++MV CW+   + RP F+ L   F+   ++P RYL IQGD   ++PSP+  +   F N   E+      M AE  L         P+   R  ID +   F 
Sbjct:  494 PENCTAEGMVCDPLCSNAG---CWGP----GANQCLSCR--YFSRGK---SCVRSC--------NLYKGESREF-VNGSVCVMCDSQCEKMEDSIVTCYGPGP--DHCTKCSNFKDGPNCVEKCPEGLQGANSFIFKYADEDKECHPCHPNCTDGCNNPTSHDC-----------------------------------------LWNDPLTLPQHARTPLIAASVIGGLFIIVIMALTFAVYIRRKSIKKKRALRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRIKILGSGAFGTVYKGIW-VPEGETV---------KIPVAIKILNETTGPKANAEFMDEALIMASMDHPHLVRLLGVSLS-PTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEG-DEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTVWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPVCTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKF--FQNLLDEEDLG-DMMDAEEYLVPQAFNIPPPIYTSRTRIDSNRNQFV 1047          

HSP 2 Score: 156.377 bits (394), Expect = 1.393e-37
Identity = 172/655 (26.26%), Postives = 273/655 (41.68%), Query Frame = 2
Query:  179 ICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVV------SGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSN---HCIKCYGNMCTN--DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILG---YIVLTEDSFVKHNITVEMLYENLN---KLQELEGGFSYFK-DNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLCYMN-IPVNELFKNVKNFYYI-----PSNCTDK--ICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPEC------LNTCVGPNPNQCIKGCKNKRENGTCVASCSKNF-------YPPLNDSKACLPCHPNCSEYNSTICTGPSS 2008
            +C     ++ SL    ++ K L     +NC  + G+   L IT +E   R L+F  SI E+ G++++  N  + +  +NLRIIRG        I      ++L +       GN  L +L  R+L  I    V    N  + Y   +I W ++   P A ++         +   +C   C          CWGPS   CQ+  +T+C  +    C    Y++     CC+ +C GGC G   + C +C    +   CV  C  P  Y+        N + +Y  G FC  +CP   + +++ CV  C     + + N    C  C G +C    D +     + A   D +N        + +  NC KI G   ++V   D    HNI   +  + LN    ++E+ G  +      ++ +L+   NL+      L+S I  L       + +  L  L  +SLKEI+ G      N+ LCY + +    LF+       I     P NCT +  +C   CS  GCWGPG   C  CR +    +CV  C+  KG     +   ++   C+ C  +C      + TC GP P+ C K C N ++   CV  C +         +   ++ K C PCHPNC++     C  P+S
Sbjct:   36 VCAGTENKLSSLSDLEQQYKALRKYY-ENCEVVMGN---LEITSIEPG-RNLSFLRSIREVTGYVLVALNQFDYLPLENLRIIRG--------IKLYEDRYALAIFLNYRKDGNYGLRELGLRNLTEILNGGVYLGQNKFLCYA-DTIHWQDIVRTPNATLV--------PMSSGRCPKSC-------MGRCWGPSDQHCQRLTKTVCAEQCDGRCYG-SYVSD----CCHRECAGGCTGPKDTDCFSCMKFNDSGSCVTQCPQPNIYNPTAFQLEQNPKAKYTYGAFCVNKCPHNFVVDDSSCVRACPSNKMEVEENGIKMCKPCAG-ICPKVCDGIGTGSLQSAQTVDSSN--------IDKFINCTKINGNLHFLVTGIDGDPYHNIAA-LEPQKLNIFFTVREITGFLNIQSWPRNMTDLSVFSNLVNIGGRVLYSGISLL------ILKQQSLNSLQFQSLKEISAGNVYITDNRNLCYYHTVNWTSLFRTSNQRTTIRENKKPENCTAEGMVCDPLCSNAGCWGPGANQCLSCRYFSRGKSCVRSCNLYKG----ESREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCTK-CSNFKDGPNCVEKCPEGLQGANSFIFKYADEDKECHPCHPNCTDG----CNNPTS 631          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Xenopus
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:100493234])

HSP 1 Score: 262.307 bits (669), Expect = 5.750e-71
Identity = 208/642 (32.40%), Postives = 301/642 (46.88%), Query Frame = 2
Query: 1925 PLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSK-------CKGKSPKNDECEVCKGVWHKNTCRLRCPRD----ESYGTKIIDSISYCKTCHSSCK-GCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAER------IETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSPHSIEMTNFNNHYGEDQFNFPSMTAETML---------PLLNGRDSIDRD 3763
            P N +   + C P CS      C GP    G   C  C      +     SCV++C        N     SR + V G  C+ C   C K       C G  P  D C  C        C  +CP       S+  K  D    C  CH +C  GC   T  +C                                         LW     L +  RT +    V+  L +++I+ +T  VY++RK+I ++      +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ +  G +     M EA +MAS+ H H +R +GV LS     L++  +  G L  ++  +K+ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     V+ITDFGL+++LE   +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T +I D + KG RL QP +C++DVY++MV CW+   + RP F+ L   F+   ++P RYL IQGD   ++PSP+  +   F N   E+      M AE  L         P+   R  ID +
Sbjct:  314 PENCTAEGMVCDPLCSNAG---CWGP----GANQCLSCRYFSRGK-----SCVRSC--------NLYKGESREF-VNGSVCVMCDSQCEKMEDSIVTCYGPGP--DHCTKCSNFKDGPNCVEKCPEGLQGANSFIFKYADEDKECHPCHPNCTDGCNNPTSHDC-----------------------------------------LWNDPLTLPQHARTPLIAASVIGGLFIIVIMALTFAVYIRRKSIKKKRALRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRIKILGSGAFGTVYKGIW-VPEGETV---------KIPVAIKILNETTGPKANAEFMDEALIMASMDHPHLVRLLGVSLSPTIQ-LVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEG-DEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTVWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPVCTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKF--FQNLLDEEDLG-DMMDAEEYLVPQAFNIPPPIYTSRTRIDSN 862          

HSP 2 Score: 126.331 bits (316), Expect = 2.140e-28
Identity = 127/464 (27.37%), Postives = 197/464 (42.46%), Query Frame = 2
Query:  731 CWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSN---HCIKCYGNMCTN--DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILG---YIVLTEDSFVKHNITVEMLYENLN---KLQELEGGFSYFK-DNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLCYMN-IPVNELFKNVKNFYYI-----PSNCTDK--ICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPEC------LNTCVGPNPNQCIKGCKNKRENGTCVASCSKNF-------YPPLNDSKACLPCHPNCSEYNSTICTGPSS 2008
            CWGPS   CQ+  +T+C  +    C    Y++     CC+ +C GGC G   + C +C    +   CV  C  P  Y+        N + +Y  G FC  +CP   + +++ CV  C     + + N    C  C G +C    D +     + A   D +N        + +  NC KI G   ++V   D    HNI   +  + LN    ++E+ G  +      ++ +L+   NL+      L+S I  L       + +  L  L  +SLKEI+ G      N+ LCY + +    LF+       I     P NCT +  +C   CS  GCWGPG   C  CR +    +CV  C+  KG     +   ++   C+ C  +C      + TC GP P+ C K C N ++   CV  C +         +   ++ K C PCHPNC++     C  P+S
Sbjct:   18 CWGPSDQHCQRLTKTVCAEQCDGRCYG-SYVSD----CCHRECAGGCTGPKDTDCFSCMKFNDSGSCVTQCPQPNIYNPTAFQLEQNPKAKYTYGAFCVNKCPHNFVVDDSSCVRACPSNKMEVEENGIKMCKPCAG-ICPKVCDGIGTGSLQSAQTVDSSN--------IDKFINCTKINGNLHFLVTGIDGDPYHNIAA-LEPQKLNIFFTVREITGFLNIQSWPRNMTDLSVFSNLVNIGGRVLYSGISLL------ILKQQSLNSLQFQSLKEISAGNVYITDNRNLCYYHTVNWTSLFRTSNQRTTIRENKKPENCTAEGMVCDPLCSNAGCWGPGANQCLSCRYFSRGKSCVRSCNLYKGE----SREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCTK-CSNFKDGPNCVEKCPEGLQGANSFIFKYADEDKECHPCHPNCTDG----CNNPTS 451          

HSP 3 Score: 67.781 bits (164), Expect = 1.670e-10
Identity = 74/281 (26.33%), Postives = 115/281 (40.93%), Query Frame = 2
Query:  191 DNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYIL----------GITKLESKERELNFDSIEEIDGHLIIEG---NDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANF-TQVFCWGPSANQCQQQTLCGSKYSSECTTC------------RYINGEEQGCCNDQC------LGGCNGGGASKCTACKNMLNEKKCVELC 937
            D +   SL S+ + +   +I +  NCT I G+++ L           I  LE ++  + F ++ EI G L I+    N  +   F NL  I G     R L    ++  SL++     L  L F+SL+ I+A NV    N  + Y  H++ W  LF     +     T  ++    + C+ +  +     +   CWGP ANQC        +Y S   +C             ++NG     C+ QC      +  C G G   CT C N  +   CVE C
Sbjct:  156 DGIGTGSLQSA-QTVDSSNIDKFINCTKINGNLHFLVTGIDGDPYHNIAALEPQKLNIFF-TVREITGFLNIQSWPRNMTDLSVFSNLVNIGG-----RVL----YSGISLLILKQQSLNSLQFQSLKEISAGNVYITDNRNLCYY-HTVNWTSLFRTSNQR-----TTIRENKKPENCTAEGMVCDPLCSNAGCWGPGANQC-----LSCRYFSRGKSCVRSCNLYKGESREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCTKCSNFKDGPNCVEKC 414          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Xenopus
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:100493234])

HSP 1 Score: 263.077 bits (671), Expect = 8.092e-71
Identity = 210/642 (32.71%), Postives = 302/642 (47.04%), Query Frame = 2
Query: 1925 PLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSK-------CKGKSPKNDECEVCKGVWHKNTCRLRCPRD----ESYGTKIIDSISYCKTCHSSCK-GCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAER------IETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSPHSIEMTNFNNHYGEDQFNFPSMTAETML---------PLLNGRDSIDRD 3763
            P N +   + C P CS      C GP    G   C  C     SR     SCV++C        N     SR + V G  C+ C   C K       C G  P  D C  C        C  +CP       S+  K  D    C  CH +C  GC   T  +C                                         LW     L +  RT +    V+  L +++I+ +T  VY++RK+I ++      +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ +  G +     M EA +MAS+ H H +R +GV LS     L++  +  G L  ++  +K+ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     V+ITDFGL+++LE   +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T +I D + KG RL QP +C++DVY++MV CW+   + RP F+ L   F+   ++P RYL IQGD   ++PSP+  +   F N   E+      M AE  L         P+   R  ID +
Sbjct:  467 PENCTAEGMVCDPLCSNAG---CWGP----GANQCLSCR--YFSRGK---SCVRSC--------NLYKGESREF-VNGSVCVMCDSQCEKMEDSIVTCYGPGP--DHCTKCSNFKDGPNCVEKCPEGLQGANSFIFKYADEDKECHPCHPNCTDGCNNPTSHDC-----------------------------------------LWNDPLTLPQHARTPLIAASVIGGLFIIVIMALTFAVYIRRKSIKKKRALRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRIKILGSGAFGTVYKGIW-VPEGETV---------KIPVAIKILNETTGPKANAEFMDEALIMASMDHPHLVRLLGVSLS-PTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEG-DEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTVWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPVCTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKF--FQNLLDEEDLG-DMMDAEEYLVPQAFNIPPPIYTSRTRIDSN 1015          

HSP 2 Score: 156.377 bits (394), Expect = 1.244e-37
Identity = 172/656 (26.22%), Postives = 273/656 (41.62%), Query Frame = 2
Query:  176 IICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVV------SGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSN---HCIKCYGNMCTN--DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILG---YIVLTEDSFVKHNITVEMLYENLN---KLQELEGGFSYFK-DNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLCYMN-IPVNELFKNVKNFYYI-----PSNCTDK--ICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPEC------LNTCVGPNPNQCIKGCKNKRENGTCVASCSKNF-------YPPLNDSKACLPCHPNCSEYNSTICTGPSS 2008
             +C     ++ SL    ++ K L     +NC  + G+   L IT +E   R L+F  SI E+ G++++  N  + +  +NLRIIRG        I      ++L +       GN  L +L  R+L  I    V    N  + Y   +I W ++   P A ++         +   +C   C          CWGPS   CQ+  +T+C  +    C    Y++     CC+ +C GGC G   + C +C    +   CV  C  P  Y+        N + +Y  G FC  +CP   + +++ CV  C     + + N    C  C G +C    D +     + A   D +N        + +  NC KI G   ++V   D    HNI   +  + LN    ++E+ G  +      ++ +L+   NL+      L+S I  L       + +  L  L  +SLKEI+ G      N+ LCY + +    LF+       I     P NCT +  +C   CS  GCWGPG   C  CR +    +CV  C+  KG     +   ++   C+ C  +C      + TC GP P+ C K C N ++   CV  C +         +   ++ K C PCHPNC++     C  P+S
Sbjct:    8 FVCAGTENKLSSLSDLEQQYKALRKYY-ENCEVVMGN---LEITSIEPG-RNLSFLRSIREVTGYVLVALNQFDYLPLENLRIIRG--------IKLYEDRYALAIFLNYRKDGNYGLRELGLRNLTEILNGGVYLGQNKFLCYA-DTIHWQDIVRTPNATLV--------PMSSGRCPKSC-------MGRCWGPSDQHCQRLTKTVCAEQCDGRCYG-SYVSD----CCHRECAGGCTGPKDTDCFSCMKFNDSGSCVTQCPQPNIYNPTAFQLEQNPKAKYTYGAFCVNKCPHNFVVDDSSCVRACPSNKMEVEENGIKMCKPCAG-ICPKVCDGIGTGSLQSAQTVDSSN--------IDKFINCTKINGNLHFLVTGIDGDPYHNIAA-LEPQKLNIFFTVREITGFLNIQSWPRNMTDLSVFSNLVNIGGRVLYSGISLL------ILKQQSLNSLQFQSLKEISAGNVYITDNRNLCYYHTVNWTSLFRTSNQRTTIRENKKPENCTAEGMVCDPLCSNAGCWGPGANQCLSCRYFSRGKSCVRSCNLYKGE----SREFVNGSVCVMCDSQCEKMEDSIVTCYGPGPDHCTK-CSNFKDGPNCVEKCPEGLQGANSFIFKYADEDKECHPCHPNCTDG----CNNPTS 604          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Mouse
Match: Erbb4 (erb-b2 receptor tyrosine kinase 4 [Source:MGI Symbol;Acc:MGI:104771])

HSP 1 Score: 269.24 bits (687), Expect = 8.618e-73
Identity = 197/596 (33.05%), Postives = 290/596 (48.66%), Query Frame = 2
Query: 2156 GFTCLPCPELCSK-------CKGKSPKNDECEVCKGVWHKNTCRLRCPRD----ESYGTKIIDSISYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAER------IETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSPHSIEMTNFNNHYGEDQFNFPSMTAETML---------PLLNGRDSIDRDVKDFTDNNEIDESLLSSTDKEPLPTRSMNRT 3856
            G  C+ C   C K       C G  P  D C  C        C  +CP       S+  K  D    C  CH +C +GC G T  +C       IY                                 W   + L +  RT +    V+  L +++I+ +T  VY++RK+I ++      +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ +  G +     M EA +MAS+ H H +R +GVCLS     L++  +  G L  ++  +K+ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     V+ITDFGL+++LE   +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T +I D + KG RL QP IC++DVY++MV CW+   + RP F+ L   F+   ++P RYL IQGD   ++PSP+  +   F N   E+      M AE  L         P+   R  ID +   F       +   ++    P+P R+   T
Sbjct:  549 GSICVECDSQCEKMEDGLLTCHGPGP--DNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADQDRECHPCHPNCTQGCNGPTSHDC-------IYYP-------------------------------WTGHSTLPQHARTPLIAAGVIGGLFILVIMALTFAVYVRRKSIKKKRALRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRVKVLGSGAFGTVYKGIW-VPEGETV---------KIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLS-PTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEG-DEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKF--FQNLLDEEDLE-DMMDAEEYLVPQAFNIPPPIYTSRTRIDSNRNQFV----YQDGGFATQQGMPMPYRATTST 1071          

HSP 2 Score: 145.591 bits (366), Expect = 2.169e-34
Identity = 159/665 (23.91%), Postives = 259/665 (38.95%), Query Frame = 2
Query:  179 ICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGPYSGGIGGTITNKEFRYHA----GFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTN------DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIV--LTEDSFVKHNITVEMLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFA------------------ISETELEFLGLKSLKEIN-GPFRFFKNQKLCYMN-IPVNELFKNVKNFYYI-----PSNCTDK--ICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPEC------LNTCVGPNPNQCIKGCKNKRENGTCVASCSKNF-------YPPLNDSKACLPCHPNCSEYNSTICTGPSS 2008
            +C     ++ SL    ++ + L     +NC  + G++ I  I       R+L+F  SI E+ G++++  N    +  +NLRIIRG    +         ++     GN  L +L  ++L  I    V  D N  + Y   +I W +        I+ +P  +   ++    S  C          CWGP+ N CQ   +T+C  +    C    Y++     CC+ +C GGC+G   + C AC N  +   CV  C  P +     T    E  ++A    G FC K+CP   + +++ CV  C     + + N    C    CT+      D +       A   D +N        + +  NC KI G ++  +T      +N    +  E LN  + +     +                      + S  PN+  +  F+                  + +  +  L  +SLKEI+ G      N  LCY + I    LF  +     I       NCT +  +C+  CS  GCWGPG   C  CR++     C+  C+   G +    +  +    C+ C  +C      L TC GP P+ C K C + ++   CV  C           +   +  + C PCHPNC++     C GP+S
Sbjct:   28 VCAGTENKLSSLSDLEQQYRALRKYY-ENCEVVMGNLEITSI----EHNRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYR--KDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYA-DTIHWQD--------IVRNPWPSNMTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYG-PYVSD----CCHRECAGGCSGPKDTDCFACMNFNDSGACVTQC--PQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMC--KPCTDICPKACDGIGTGSLMSAQTVDSSN--------IDKFINCTKINGNLIFLVTGIHGDPYNAIDAIDPEKLNVFRTVREITGFLN--------------------IQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRRAENCTAEGMVCNHLCSNDGCWGPGPDQCLSCRRFSRGKICIESCNLYDGEFREFENGSI----CVECDSQCEKMEDGLLTCHGPGPDNCTK-CSHFKDGPNCVEKCPDGLQGANSFIFKYADQDRECHPCHPNCTQG----CNGPTS 630          

HSP 3 Score: 62.7734 bits (151), Expect = 3.867e-9
Identity = 81/294 (27.55%), Postives = 126/294 (42.86%), Query Frame = 2
Query:  167 PGTIICQN--DNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYIL--GI-----TKLESKERE-LN-FDSIEEIDGHLIIEG---NDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRD-KCSDQCKLWANFTQVFC-----WGPSANQCQQQTLCGSKYSSE---CTTCRYINGE----EQGC----CNDQC------LGGCNGGGASKCTACKNMLNEKKCVELC 937
            P T IC    D +   SL S+ + +   +I +  NCT I G++  L  GI       +++ + E LN F ++ EI G L I+    N  +   F NL  I G     R L    ++  SL++     +  L F+SL+ I+A N+    N  + Y  H+I W  LF+          T+ + +++RD + ++ C          C     WGP  +QC    L   ++S       +C   +GE    E G     C+ QC      L  C+G G   CT C +  +   CVE C
Sbjct:  325 PCTDICPKACDGIGTGSLMSA-QTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAIDAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGG-----RVL----YSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYY-HTINWTTLFS----------TINQRIVIRDNRRAENCTAEGMVCNHLCSNDGCWGPGPDQC----LSCRRFSRGKICIESCNLYDGEFREFENGSICVECDSQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKC 593          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Mouse
Match: Erbb4 (erb-b2 receptor tyrosine kinase 4 [Source:MGI Symbol;Acc:MGI:104771])

HSP 1 Score: 264.233 bits (674), Expect = 3.637e-71
Identity = 192/565 (33.98%), Postives = 280/565 (49.56%), Query Frame = 2
Query: 2156 GFTCLPCPELCSK-------CKGKSPKNDECEVCKGVWHKNTCRLRCPRD----ESYGTKIIDSISYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAER------IETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSPHSIEMTNFNNHYGEDQFNFPSMTAETML---------PLLNGRDSIDRD 3763
            G  C+ C   C K       C G  P  D C  C        C  +CP       S+  K  D    C  CH +C +GC G T  +C       IY                                 W   + L +  RT +    V+  L +++I+ +T  VY++RK+I ++      +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ +  G +     M EA +MAS+ H H +R +GVCLS     L++  +  G L  ++  +K+ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     V+ITDFGL+++LE   +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T +I D + KG RL QP IC++DVY++MV CW+   + RP F+ L   F+   ++P RYL IQGD   ++PSP+  +   F N   E+      M AE  L         P+   R  ID +
Sbjct:  549 GSICVECDSQCEKMEDGLLTCHGPGP--DNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADQDRECHPCHPNCTQGCNGPTSHDC-------IYYP-------------------------------WTGHSTLPQHARTPLIAAGVIGGLFILVIMALTFAVYVRRKSIKKKRALRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRVKVLGSGAFGTVYKGIW-VPEGETV---------KIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLS-PTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEG-DEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKF--FQNLLDEEDLE-DMMDAEEYLVPQAFNIPPPIYTSRTRIDSN 1044          

HSP 2 Score: 144.821 bits (364), Expect = 3.981e-34
Identity = 159/665 (23.91%), Postives = 259/665 (38.95%), Query Frame = 2
Query:  179 ICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGPYSGGIGGTITNKEFRYHA----GFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTN------DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIV--LTEDSFVKHNITVEMLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFA------------------ISETELEFLGLKSLKEIN-GPFRFFKNQKLCYMN-IPVNELFKNVKNFYYI-----PSNCTDK--ICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPEC------LNTCVGPNPNQCIKGCKNKRENGTCVASCSKNF-------YPPLNDSKACLPCHPNCSEYNSTICTGPSS 2008
            +C     ++ SL    ++ + L     +NC  + G++ I  I       R+L+F  SI E+ G++++  N    +  +NLRIIRG    +         ++     GN  L +L  ++L  I    V  D N  + Y   +I W +        I+ +P  +   ++    S  C          CWGP+ N CQ   +T+C  +    C    Y++     CC+ +C GGC+G   + C AC N  +   CV  C  P +     T    E  ++A    G FC K+CP   + +++ CV  C     + + N    C    CT+      D +       A   D +N        + +  NC KI G ++  +T      +N    +  E LN  + +     +                      + S  PN+  +  F+                  + +  +  L  +SLKEI+ G      N  LCY + I    LF  +     I       NCT +  +C+  CS  GCWGPG   C  CR++     C+  C+   G +    +  +    C+ C  +C      L TC GP P+ C K C + ++   CV  C           +   +  + C PCHPNC++     C GP+S
Sbjct:   28 VCAGTENKLSSLSDLEQQYRALRKYY-ENCEVVMGNLEITSI----EHNRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYR--KDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYA-DTIHWQD--------IVRNPWPSNMTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYG-PYVSD----CCHRECAGGCSGPKDTDCFACMNFNDSGACVTQC--PQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMC--KPCTDICPKACDGIGTGSLMSAQTVDSSN--------IDKFINCTKINGNLIFLVTGIHGDPYNAIDAIDPEKLNVFRTVREITGFLN--------------------IQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRRAENCTAEGMVCNHLCSNDGCWGPGPDQCLSCRRFSRGKICIESCNLYDGEFREFENGSI----CVECDSQCEKMEDGLLTCHGPGPDNCTK-CSHFKDGPNCVEKCPDGLQGANSFIFKYADQDRECHPCHPNCTQG----CNGPTS 630          

HSP 3 Score: 62.7734 bits (151), Expect = 4.328e-9
Identity = 81/294 (27.55%), Postives = 126/294 (42.86%), Query Frame = 2
Query:  167 PGTIICQN--DNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYIL--GI-----TKLESKERE-LN-FDSIEEIDGHLIIEG---NDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRD-KCSDQCKLWANFTQVFC-----WGPSANQCQQQTLCGSKYSSE---CTTCRYINGE----EQGC----CNDQC------LGGCNGGGASKCTACKNMLNEKKCVELC 937
            P T IC    D +   SL S+ + +   +I +  NCT I G++  L  GI       +++ + E LN F ++ EI G L I+    N  +   F NL  I G     R L    ++  SL++     +  L F+SL+ I+A N+    N  + Y  H+I W  LF+          T+ + +++RD + ++ C          C     WGP  +QC    L   ++S       +C   +GE    E G     C+ QC      L  C+G G   CT C +  +   CVE C
Sbjct:  325 PCTDICPKACDGIGTGSLMSA-QTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAIDAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGG-----RVL----YSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYY-HTINWTTLFS----------TINQRIVIRDNRRAENCTAEGMVCNHLCSNDGCWGPGPDQC----LSCRRFSRGKICIESCNLYDGEFREFENGSICVECDSQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKC 593          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Mouse
Match: Egfr (epidermal growth factor receptor [Source:MGI Symbol;Acc:MGI:95294])

HSP 1 Score: 249.21 bits (635), Expect = 1.085e-66
Identity = 174/520 (33.46%), Postives = 265/520 (50.96%), Query Frame = 2
Query: 2174 CPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRCPRDESYGTKIIDSISYCKTCHSSCK------GCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEE----IEKGSGDIVC------------------LSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEI-ESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSP 3643
            C  LCS      P+  +C  C+ V     C  +C   E    + +++ S C  CH  C        C G    NC +C +   Y+D    +C  TCP     E      +    + VC                    +W S  K+            +V  L+ +++V + I ++++R+ I  +       +   L EP +       + PN   L I+ + +     + K LG GAFG VYKG W IP+ E+           +PVAIK ++   + +  + ++ EA +MASV + H  R +G+CL+     LI+  +  G L  ++  +K+ I S  +L+W  QIA GM YL  R ++HRDLAARNVLV   + V+ITDFGL+K+L   ++KE   + GKVPI+W+A+E++    Y+H++DVW+YGVT+WE+ TFG  PY+     DI   + KG RL QP IC++DVY+IMV CW+   + RP F+ L+  F+   ++P RYL IQGD    +PSP
Sbjct:  506 CNPLCSSEGCWGPEPRDCVSCQNVSRGRECVEKCNILEGEPREFVEN-SECIQCHPECLPQAMNITCTGRGPDNCIQCAH---YIDGP--HCVKTCPAGIMGENNTLVWKYADANNVCHLCHANCTYGCAGPGLQGCEVWPSGPKIPSIA------TGIVGGLLFIVVVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPS----GEAPNQAHLRILKETEF---KKIKVLGSGAFGTVYKGLW-IPEGEKV---------KIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQ-LITQLMPYGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLL-GAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASDISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELILEFSKMARDPQRYLVIQGDERMHLPSP 994          

HSP 2 Score: 150.214 bits (378), Expect = 7.812e-36
Identity = 170/661 (25.72%), Postives = 272/661 (41.15%), Query Frame = 2
Query:  179 ICQNDNVQIESLHSSVEKLKILSIIRS-KNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGN-----AHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQT--LCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPA-MMLPENTGCVHKCSEGYFKNKSN---HCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILG-----YIVLTEDSFVKHNITVEMLYENLNKLQELEGGF--SYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEI-NGPFRFFKNQKLCYMN-IPVNELFKNVKNFYYIPSNCTDK-------ICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLN-----TCVGPNPNQCIKGCKNKRENGTCVASCSKNF--------YPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGC 2029
            +CQ  + ++  L +  +    LS+ R   NC  + G++ I  +     +  +L+F  +I+E+ G+++I  N +E+I  +NL+IIRG N++  N        ++L +  N       L +L  R+L+ I    V F +NP +  +  +I+W ++      Q +F   ++ DL        +C    +     CWG     CQ+ T  +C  + S  C            CC++QC  GC G   S C  C+   +E  C + C     Y+        N E +Y  G  C K+CP   ++ ++  CV  C   Y++ + +    C KC G         CN   I    D      + A ++   K C  I G      +    DSF +         E L  ++E+ G      + DN      F    +       H            A+    +  LGL+SLKEI +G      N+ LCY N I   +LF        I +N  +K       +C+  CS +GCWGP  + C  C+       CV  C+  +G   P     + N +C++CHPECL      TC G  P+ CI+ C +  +   CV +C            +   + +  C  CH NC+ Y    C G    PG+ GC
Sbjct:   30 VCQGTSNRLTQLGTFEDHF--LSLQRMYNNCEVVLGNLEITYV----QRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRG-NALYEN-------TYALAILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNPILCNM-DTIQWRDI-----VQNVFMSNMSMDLQSHPSSCPKCD--PSCPNGSCWGGGEENCQKLTKIICAQQCSHRCR-----GRSPSDCCHNQCAAGCTGPRESDCLVCQKFQDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACGPDYYEVEEDGIRKCKKCDGPC----RKVCNGIGIGEFKD---TLSINATNIKHFKYCTAISGDLHILPVAFKGDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPDNWTDLHAFENLEIIRGRTKQHGQF-------SLAVVGLNITSLGLRSLKEISDGDVIISGNRNLCYANTINWKKLFGTPNQKTKIMNNRAEKDCKAVNHVCNPLCSSEGCWGPEPRDCVSCQNVSRGRECVEKCNILEG--EP--REFVENSECIQCHPECLPQAMNITCTGRGPDNCIQ-CAHYIDGPHCVKTCPAGIMGENNTLVWKYADANNVCHLCHANCT-YG---CAG----PGLQGC 636          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Mouse
Match: Erbb2 (erb-b2 receptor tyrosine kinase 2 [Source:MGI Symbol;Acc:MGI:95410])

HSP 1 Score: 227.254 bits (578), Expect = 1.110e-59
Identity = 120/308 (38.96%), Postives = 186/308 (60.39%), Query Frame = 2
Query: 2723 PNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIK-NMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDPYEIPSP 3643
            PN  ++ I+ + +L    + K LG GAFG VYKG W IP  E         +  +PVAIKV++ N   +  + ++ EA +MA V   +  R +G+CL+     L++  +  G L   +  ++ ++ S  +L+W  QIA GM YL +  ++HRDLAARNVLV     V+ITDFGL+++L+   + E     GKVPI+W+A+E++   +++H++DVW+YGVT+WE+ TFG  PY+     +I D + KG RL QP IC++DVY+IMV CW+     RP F+ L+  F+   ++P R++ IQ +     SP
Sbjct:  708 PNQAQMRILKETEL---RKLKVLGSGAFGTVYKGIW-IPDGE---------NVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYVSRLLGICLTSTVQ-LVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEEVRLVHRDLAARNVLVKSPNHVKITDFGLARLLD-IDETEYHADGGKVPIKWMALESILRRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPSSP 1000          

HSP 2 Score: 142.51 bits (358), Expect = 1.954e-33
Identity = 155/651 (23.81%), Postives = 257/651 (39.48%), Query Frame = 2
Query:  170 GTIICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNFDSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIK----------RNLIDKGHTDFSLVVSGNA--HLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRG--PYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTG-CVHKC----SEGYFKNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLR------AQDLVQLKNCKKILGYIVLTEDSFVKH--NITVEMLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEI-NGPFRFFKNQKLCYMN-IPVNELFKNVKNFYYIPSNCTDK-------ICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECL-----NTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPL---------NDSKACLPCHPNCS 1972
            GT +C   ++++    S    L +L  +  + C  +QG+   L +T L +         I+E+ G+++I  N ++ +  + LRI+RG    +          R+ +D    + +    G     L +L  RSL  I    V+   NP++ Y    + W ++      Q+      T        C+  CK         CWG S   CQ   L G+  +S C  C+        CC++QC  GC G   S C AC +  +   C   C     Y+     ++ N E RY  G  C   CP   L    G C   C     E   ++ +  C KC          PC     AG   G    +LR      + ++ +   CKKI G +    +SF  +  +    +  E+L   + LE    Y   +         ++ +         + +    +   +    +  LGL+SL+E+ +G     +N  LC++N +P ++LF+N         N  ++       +C+  C+   CWGPG   C  C ++     CV +C   KG    +    +  + CL CHPEC       TC G   +QC + C + +++ +CVA C     P L         ++   C PC  NC+
Sbjct:   22 GTQVCTGTDMKLRLPASPETHLDMLRHLY-QGCQVVQGN---LELTYLPANASLSFLQDIQEVQGYMLIAHNRVKHVPLQRLRIVRGTQLFEDKYALAVLDNRDPLD----NVTTAAPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQ-DMVLWKDVLRK-NNQLAPVDMDTNRSRACPPCAPTCK------DNHCWGESPEDCQ--ILTGTICTSGCARCK--GRLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALITYNTDTFESMLNPEGRYTFGASCVTTCPYNYLSTEVGSCTLVCPPNNQEVTAEDGTQRCEKCSK--------PC-----AGVCYGLGMEHLRGARAITSDNIQEFAGCKKIFGSLAFLPESFDGNPSSGVAPLKPEHLQVFETLEEITGYLYISAWPESFQDLSVFQNLRVIRGRILHD--GAYSLTLQGLGIHSLGLRSLRELGSGLALIHRNTHLCFVNTVPWDQLFRNPHQALLHSGNRPEEACGLEGLVCNSLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVWKG----LPREYVRGKHCLPCHPECQPQNSSETCYGSEADQC-EACAHYKDSSSCVARCPSGVKPDLSYMPIWKYPDEEGICQPCPINCT 632          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Mouse
Match: Erbb3 (erb-b2 receptor tyrosine kinase 3 [Source:MGI Symbol;Acc:MGI:95411])

HSP 1 Score: 227.254 bits (578), Expect = 1.576e-59
Identity = 110/279 (39.43%), Postives = 171/279 (61.29%), Query Frame = 2
Query: 2783 KPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKN-MGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQ 3616
            K LG G FG V+KG W IP+ E            +PV IKVI++  G +  ++V      + S+ H H +R +G+C       L++ Y+  GSL   + +++  +   ++L+W  QIA GM YL + +++HRDLA RNV++     VQ+ DFG++ +L    DK+++    K PI+W+A+E++  GKY+H++DVW+YGVT+WE+ TFG  PY      +I D + KG RL+QP IC++DVY++MV CW+   N+RP F+ L   FT   ++P RYL I+
Sbjct:  711 KVLGSGVFGTVHKGIW-IPEGE---------SIKIPVCIKVIEDKSGRQSFQAVTDHMLAVGSLDHAHIVRLLGLCPGSSLQ-LVTQYLPLGSLLDHVRQHRETLGPQLLLNWGVQIAKGMYYLEEHSMVHRDLALRNVMLKSPSQVQVADFGVADLL-PPDDKQLLHSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAEPYAGLRLAEIPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIK 977          

HSP 2 Score: 146.747 bits (369), Expect = 9.448e-35
Identity = 153/619 (24.72%), Postives = 236/619 (38.13%), Query Frame = 2
Query:  260 KNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLV---VSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQ--QQTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYF---KNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILG---YIVLTEDSFVKHNITVEMLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLCY---------MNIPVNELFKNVKNFYYIPSNCTDKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPEC-----LNTCVGPNPNQCIKGCKNKRENGTCVASCSKNF---------YPPLNDSKACLPCHPNCSEYNSTICTGP 2002
            + C  + G++ I+    L     +L+F   I E+ G++++  N+   +   NLR++RG       + D     F ++    + +  L  L F  L  I    V  + N K+ ++  +I W ++   P A+I+    V  +      C + CK         CWGP    CQ   +T+C  + +  C            CC+D+C GGC+G   + C AC++  +   CV  C  P  Y+        N   +Y  G  C   CP   + + T CV  C        KN    C  C G +C             G   G+    + + ++    NC KILG   +++   +    H I   +  E LN  + +     Y             ++           + N   +    +    +  LG +SLKEI+ G      NQ+LCY         +  P  E      N          K+C   CS  GCWGPG   C  CR Y   G CV+ C+  +G   P     +    C  CHPEC      +TC G   + C + C + R+   CV SC             YP  +    C PCH NC++     C GP
Sbjct:   54 EKCEVVMGNLEIV----LTGHNADLSFLQWIREVTGYVLVAMNEFSVLPLPNLRVVRGTQ-----VYDGKFAIFVMLNYNTNSSHALRQLRFTQLTEILLGGVYIEKNDKLCHM-DTIDWRDIVRVPDAEIV----VKNNGGNCPPCHEVCK-------GRCWGPGPEDCQILTKTICAPQCNGRC-----FGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPAPLVYNKLTFQLEPNPHIKYQYGGVCVASCPHNFVVDQTFCVRACPADKMEVDKNGLKMCEPCRG-LCPK--------ACEGTGSGSRYQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPA-LDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNR-GFSLLIMKNLNVTSLGFRSLKEISAGRVYISANQQLCYHHSLNWTRLLRGPAEERLDIKYNRPLGECVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSREGVCVTHCNVLQG--EP--REFVHEAHCFSCHPECQPMEGTSTCNGSGSDACAR-CAHFRDGPHCVNSCPHGILGAKGPIYKYP--DAQNECRPCHENCTQG----CKGP 624          
BLAST of Receptor protein-tyrosine kinase vs. UniProt/SwissProt
Match: sp|P04412|EGFR_DROME (Epidermal growth factor receptor OS=Drosophila melanogaster OX=7227 GN=Egfr PE=1 SV=3)

HSP 1 Score: 432.18 bits (1110), Expect = 5.887e-126
Identity = 344/1184 (29.05%), Postives = 551/1184 (46.54%), Query Frame = 2
Query:  254 RSKNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELC--RGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSF-----VKHNITVEMLY--------ENLNKLQELEG------------GFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLCYM-NIPVNELFKNVKNFYYIPSNCTDKICHKD-------CSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCV---KTCHEG---TYAFPNDRPDISRFYPVTG-FTCLPCPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRCPRDESYGTKIIDSISYCKTCHSSCKGCYGSTIFNCTRCKNKKI--------YLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMG----RLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIK-VIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDPY 3628
            R  NCT++ G+   L +T L ++  +L+F D+I E+ G+++I   D++K+ F  L+IIRG      ++ ++    ++L V+  + +  L+   LR +    V F +N  + ++  +I+W+E+ ++      ++   T       KC + C          CWG     CQ+  +  C    S +C   R    + + CC+  C GGC G     C ACKN  +E    E C     Y+       TN E +Y  G  C K+CP  +L +N  CV  C +    +K   C+ C G        PC      G T       L A ++   +NC  I G I + + +F     V  N T+   Y        E  + ++E+ G              SYF++                   +H        +   AI ++ L  L +++LK+I+ G      N+ LCY+ NI    + K  +   ++  N    +C K+       C+E GCWG G   C  C+ ++  GTC++DC    G+ +  N+    N+ C  CHPEC  TC G   + C + C + R+   CV+ C KN Y   ND   C  CH  C       CTGP    GIG C  C   +++  A +  C+     C +G    Y  P ++  +    P+ G   C  C  LC  C         C  C     +  C   CP D     +  +    C   H  C GC G    +C  C+N K+        Y++   F C   CP        +  +    C +     +K+      ++   +   +L+  I ++  +    ++K  A++   ++    S       +D + L +P N+G    +L IV   +L    +   LG GAFG VYKG W +P+ E         +  +PVAIK ++K+ G E  E  ++EA +MAS  H++ L+ + VC+S +   LI+  +  G L  ++  N++KI S  +L+WS QIA GM YL ++ ++HRDLAARNVLV     V+ITDFGL+K+L S+   E     GK+PI+WLA+E + +  ++ ++DVWA+GVT+WE+ TFG+ P+E+    DI D +  G +L QP+ICSLD+Y  +++CW     +RP F+ L   F ++ ++PGRYL+I GD +
Sbjct:  125 RYTNCTYVDGN---LKLTWLPNENLDLSFLDNIREVTGYILISHVDVKKVVFPKLQIIRGRTLFSLSVEEE---KYALFVT-YSKMYTLEIPDLRDVLNGQVGFHNNYNLCHM-RTIQWSEIVSN-GTDAYYNYDFTAPERECPKCHESCTHG-------CWGEGPKNCQKFSKLTC----SPQCAGGRCYGPKPRECCHLFCAGGCTGPTQKDCIACKNFFDEAVSKEECPPMRKYNPTTYVLETNPEGKYAYGATCVKECPGHLLRDNGACVRSCPQDKM-DKGGECVPCNG--------PCPK-TCPGVT------VLHAGNIDSFRNCTVIDGNIRILDQTFSGFQDVYANYTMGPRYIPLDPERREVFSTVKEITGYLNIEGTHPQFRNLSYFRN----------------LETIHGRQLMESMFAALAIVKSSLYSLEMRNLKQISSGSVVIQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADLCEKNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC----GYIS--NAYKFDNRTCKICHPEC-RTCNGAGADHC-QECVHVRDGQHCVSECPKNKY---NDRGVCRECHATCDG-----CTGPKDTIGIGACTTCNLAIINNDATVKRCLLKDDKCPDGYFWEYVHPQEQGSLK---PLAGRAVCRKCHPLCELCTNYGYHEQVCSKCTHYKRREQCETECPADHYTDEEQRE----CFQRHPECNGCTGPGADDCKSCRNFKLFDANETGPYVNSTMFNCTSKCPLEMRHVNYQYTAIGPYCAASPPRSSKITANLDVNMIFIITGAVLVPTICILCVVTYICRQKQKAKKETVKMTMALSG-----CEDSEPL-RPSNIGANLCKLRIVKDAEL---RKGGVLGMGAFGRVYKGVW-VPEGE---------NVKIPVAIKELLKSTGAESSEEFLREAYIMASEEHVNLLKLLAVCMSSQM-MLITQLMPLGCLLDYVRNNRDKIGSKALLNWSTQIAKGMSYLEEKRLVHRDLAARNVLVQTPSLVKITDFGLAKLL-SSDSNEYKAAGGKMPIKWLALECIRNRVFTSKSDVWAFGVTIWELLTFGQRPHENIPAKDIPDLIEVGLKLEQPEICSLDIYCTLLSCWHLDAAMRPTFKQLTTVFAEFARDPGRYLAIPGDKF 1212          
BLAST of Receptor protein-tyrosine kinase vs. UniProt/SwissProt
Match: sp|P0CY46|EGFR_APIME (Epidermal growth factor receptor OS=Apis mellifera OX=7460 GN=Egfr PE=2 SV=1)

HSP 1 Score: 417.542 bits (1072), Expect = 9.912e-122
Identity = 313/1056 (29.64%), Postives = 487/1056 (46.12%), Query Frame = 2
Query:  593 HSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELC--RGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSF-----VKHNITVEMLYENLN--------KLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEI-NGPFRFFKNQKLCY-MNIPVNELFKNVKNFYYIPSNCTDKICHKD-------CSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVK---TCHEGTYAFPNDRPDISRFYPVTG-FTCLPCPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRCPRDESYGTKIIDSISYCKTCHSSCKGCYGSTIFNCTRCKNKKIYLDKK------KFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKP----PNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKN-MGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDPY-EIPS 3640
             +I W E+ T P A   +    T        C   C       +  CWG     CQ+ +   +  S +C   R      + CC+  C GGC G   S C ACKN  ++  C + C     Y+        N + +Y  G  C ++CP  +L +N  CV  C     K  +  C+ C G        PC          G    +  + ++   K+C  I G I + + SF     V  N +    YE ++         L+E+ G  +   D+           L        ++      +    + +T L   GL SLK+I +G     +N+ LCY  +I    + K+ ++   + +N  +  C KD       CS++GCWGPG   C  C+ +     C+ DC+   G Y          + C  CH EC  +C+GPN + C K CK+ R+   CV  C  + Y   ND+  C  CH NC       C GP +  G  GC+ C++ +L+       C++   +C +G Y       +     P+     C  C   C KC G       C+ C        C   CP D        D+   C  C S C+GC+G     C +C+N KIY+D+        F C +TC P    +     S     L      A L E +     +  V    +  ++V   I+ + + +A A+    ++    + L      D++   +P    PN+ +L I+ +E++    +   LG+GAFG VYKG W +P+ E         +  +PVAIKV+ +  G    +  + EA +MASV H + L+ + VC++ +   L++  +  G L  F+ R K+KI S  +L+W  QIA GM YL +R ++HRDLAARNVLV    CV+ITDFGL+K+L+   +++     GK+PI+WLA+E +    ++H++DVWA+GVT+WE+ T+G  PYE+    ++ + + KG RL QP IC++DVY+IM+ CW+     RP F+ L + F    ++PGRYL+I+GD Y  +PS
Sbjct:   11 RTINWEEIITGPSAMYSYVYNFTSPERACTPCDKSC-------EQGCWGEGPENCQKYS--KTNCSPQCWQGRCFGPNPRECCHLFCAGGCTGPKQSDCIACKNFFDDGVCTQECPPMQKYNPTTYSWEPNPDGKYAYGATCVRRCPEHLLKDNGACVRSCPPKK-KALNGECVPCDG--------PC-----PKTCKGVEKVH--SGNIDSFKDCTIIEGSITILDQSFQGFQHVYRNFSFGKRYEKMHPDKLEVFSTLKEITGFLNIQGDHKDFKNLSYFRNLEVIGGRTLTEY-----FASLYVVKTSLVSFGLSSLKKIYSGSIAILENKNLCYAQSINWTRIKKSSEHESLLSNNRNESECIKDGLVCDEQCSDEGCWGPGPAQCLSCKNFILGNDCLQDCT-APGIYQ------ADEKTCKVCHEECDGSCIGPNTDHC-KKCKHARDGPFCVPECPASKY---NDNGVCKSCHGNCV----GGCEGPENNIGPNGCHSCDKAILNDHVP-EGCLQKKESCPDGYYYEWVSPLEQGPLKPLASKAVCRKCHSRCKKCTGYGFHEHVCQECTKYKRGEQCEDECPAD-----YFADANKLCIPCFSECRGCFGPGPNQCYKCRNYKIYIDEDTDGNTTSFNCTETCTPEYPHKIFNPDSEPYCSLE----TAGLIENELQPAILAGVAVFALAFLVVAAIIMYFWRVRAKAKENTVKMTMALTGL------DDNEPLRPTGVKPNLAKLRIIKEEEM---RKGGILGYGAFGNVYKGVW-VPEGE---------NVKIPVAIKVLHDGTGANTSKEFLDEAYIMASVEHPNLLQLLAVCMTSQM-MLVTQLMPLGCLLDFVRRFKDKIGSKALLNWCTQIARGMAYLEERRLVHRDLAARNVLVQTPNCVKITDFGLAKLLD-INEEQYKAAGGKMPIKWLALECIQHRVFTHKSDVWAFGVTIWEVLTYGGRPYENVPARNVPELLEKGERLPQPAICTIDVYMIMIKCWMLDAESRPSFKELAEDFAKMSRDPGRYLAIKGDKYMRLPS 990          

HSP 2 Score: 67.781 bits (164), Expect = 9.222e-10
Identity = 69/266 (25.94%), Postives = 114/266 (42.86%), Query Frame = 2
Query:  221 SVEKLKILSIIRSKNCTHIQGSIYILGIT------------------KLESKERELNFDSIEEIDGHLIIEGN--DLEKIT-FKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDK--CSDQCKLWANFTQVFCWGPSANQCQ--QQTLCGSKYSSECTTCRYINGEEQGC--CNDQCLGGCNGGGASKCTACKNMLNEKKCVELC 937
             VEK+   +I   K+CT I+GSI IL  +                  K+   + E+ F +++EI G L I+G+  D + ++ F+NL +I G     R L +     F+ +      LV     SL+ I + ++    N  + Y   SI W  +    + + L S    +   ++D   C +QC      +   CWGP   QC   +  + G+    +CT       +E+ C  C+++C G C G     C  CK+  +   CV  C
Sbjct:  186 GVEKVHSGNIDSFKDCTIIEGSITILDQSFQGFQHVYRNFSFGKRYEKMHPDKLEV-FSTLKEITGFLNIQGDHKDFKNLSYFRNLEVIGG-----RTLTEY----FASLYVVKTSLVSFGLSSLKKIYSGSIAILENKNLCYA-QSINWTRIKKSSEHESLLSNNRNESECIKDGLVCDEQC------SDEGCWGPGPAQCLSCKNFILGNDCLQDCTAPGIYQADEKTCKVCHEECDGSCIGPNTDHCKKCKHARDGPFCVPEC 434          
BLAST of Receptor protein-tyrosine kinase vs. UniProt/SwissProt
Match: sp|P24348|LET23_CAEEL (Receptor tyrosine-protein kinase let-23 OS=Caenorhabditis elegans OX=6239 GN=let-23 PE=1 SV=3)

HSP 1 Score: 416.001 bits (1068), Expect = 6.062e-121
Identity = 339/1136 (29.84%), Postives = 526/1136 (46.30%), Query Frame = 2
Query:  338 FDSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQ-GCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELC--RGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKS---NHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNI----TVEMLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEI-NGPFRFFKNQKLCYM-----NIPVNELFKNVKNFYYIPSN-------CTDKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGT-------CVASCSKNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPD--ISRF--YPVTGFTCLPCPELCSKCK--GKSPKNDECEVCKGVWHK-----NTCRLRCPRDESYGTKIIDSISYCKTCHSSCKG---CYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYL 3607
            FD++EEI G LII   +++KI+F  LR+I G         D+   D +L +  N  + ++  R LR I   +V    NPKM Y+   I W EL  DP  Q + +    +      K   +C    N     CWG   N CQ+  +++C       C+ C Y N      CC+  CLGGC G G   C AC     +  C+E C  R  ++   G  + N + RY  G  C K+CP  +L EN  CV  CS+G+  + +     C KC  + C        +  + GH        L  + L  L+ C++I G++++ E +F    +    TV+++ E +  +Q+      + K+           L       LH+    L  Y        +LE L L SLK I  G     KN +LCY+     +  +    K+ K    I  N          ++C K+C+++GCWG   + C EC+ + + GTCV  C  K    N       ++ KC RC PEC  TC G     C+  C++K    +       CV  C  + +P       C  CHP C +     CTGP S  G GGC +C +  +  + D + C+++         ND P+  IS +    V    C  C   C  C   G++   ++C VCK V ++       C  +CP +        +++  CK CH  C     C       C +CKN  ++       C   CP  K++      +G+  CL        +   +R    V +   +    ++ +  ++VY + + I ++++         LT  ++      S  PNM R+ ++   +L  + + K LG GAFG V+ G +           K + +  +PVAIKV +     + + +++EA  M  + H + L+ IG C+  +   +++ Y   G+L  FL  +K  + +   + +  QIA GM YL K+ ++HRDLA RNVLV +   V+ITDFGLSK+L+   D  I IK+GKV I+WLAIE  +   Y+H +DVWA+GVT WEI TFG+ PY+  +T  I +F+  G RLSQP  CS D+Y  ++ CW+  P  RP F+ L + F ++CK P  +L
Sbjct:  109 FDNLEEIRGSLIIYRANIQKISFPRLRVIYG---------DEVFHDNALYIHKNDKVHEVVMRELRVIRNGSVTIQDNPKMCYIGDKIDWKELLYDPDVQKVETTNSHQHCYQNGKSMAKCHESCNDK---CWGSGDNDCQRVYRSVC----PKSCSQCFYSNSTSSYECCDSACLGGCTGHGPKNCIACSKYELDGICIETCPSRKIFNHKTGRLVFNPDGRYQNGNHCVKECPPELLIENDVCVRHCSDGHHYDATKDVRECEKCRSSSCP------KICTVDGH--------LTNETLKNLEGCEQIDGHLII-EHAFTYEQLKVLETVKIVSEYITIVQQNFYDLKFLKN-----------LQIIEGRKLHNVRWALAIYQC-----DDLEELSLNSLKLIKTGAVLIMKNHRLCYVSKIDWSSIITSKGKDNKPSLAIAENRDSKLCETEQRVCDKNCNKRGCWGKEPEDCLECKTWKSVGTCVEKCDTKGFLRNQ------TSMKCERCSPEC-ETCNGLGELDCLT-CRHKTLYNSDFGNRMECVHDCPVSHFP--TQKNVCEKCHPTCYDNG---CTGPDSNLGYGGCKQC-KYAVKYENDTIFCLQSSGMNNVCVENDLPNYYISTYDTEGVIETHCEKCSISCKTCSSAGRNVVQNKC-VCKHVEYQPNPSERICMDQCPVNSFMVPDTNNTV--CKKCHHECDQNYHCANGQSTGCQKCKNFTVF-KGDIAQCVSECP--KNLPFSNPANGE--CLDY-----DIASRQRKTRMVIIGSVLFGFAVMFLFILLVYWRCQRIGKKLKIAEMVDMPELTPIDA------SVRPNMSRICLIPSSELQTKLDKK-LGAGAFGTVFAGIY---------YPKRAKNVKIPVAIKVFQT-DQSQTDEMLEEATNMFRLRHDNLLKIIGFCMHDDGLKIVTIYRPLGNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVKKFNHVEITDFGLSKILKHDAD-SITIKSGKVAIKWLAIEIFSKHCYTHASDVWAFGVTCWEIITFGQSPYQGMSTDSIHNFLKDGNRLSQPPNCSQDLYQELLRCWMADPKSRPGFEILYERFKEFCKVPQLFL 1152          
BLAST of Receptor protein-tyrosine kinase vs. UniProt/SwissProt
Match: sp|Q62956|ERBB4_RAT (Receptor tyrosine-protein kinase erbB-4 OS=Rattus norvegicus OX=10116 GN=Erbb4 PE=1 SV=3)

HSP 1 Score: 267.314 bits (682), Expect = 2.669e-71
Identity = 194/565 (34.34%), Postives = 281/565 (49.73%), Query Frame = 2
Query: 2156 GFTCLPCPELCSK-------CKGKSPKNDECEVCKGVWHKNTCRLRCPR----DESYGTKIIDSISYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAER------IETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSPHSIEMTNFNNHYGEDQFNFPSMTAETML---------PLLNGRDSIDRD 3763
            G  C+ C   C K       C G  P  D C  C        C  +CP       S+  K  D    C  CH +C +GC G T  +C       IY                                 W   + L +  RT +    V+  L +++I+ +T  VY++RK+I ++      +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ +  G +     M EA +MASV H H +R +GVCLS     L++  +  G L +++  +K+ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     V+ITDFGL+++LE   +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T +I D + KG RL QP IC++DVYI+MV CW+   + RP F+ L   F+   ++P RYL IQGD   ++PSP+  +   F N   E+      M AE  L         P+   R  ID +
Sbjct:  549 GSICVECDSQCEKMEDGLLTCHGPGP--DNCTKCSHFKDGPNCVEKCPDVLQGANSFIFKYADQDRECHPCHPNCTQGCNGPTSHDC-------IYYP-------------------------------WTGHSTLPQHARTPLIAAGVIGGLFILVIMALTFAVYVRRKSIKKKRALRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRVKVLGSGAFGTVYKGIW-VPEGETV---------KIPVAIKILNETTGPKANVEFMDEALIMASVDHPHLVRLLGVCLS-PTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEG-DEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYIVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKF--FQNLLDEEDLE-DMMDAEEYLVPQAFNIPPPIYTSRTRIDSN 1044          

HSP 2 Score: 143.665 bits (361), Expect = 5.448e-33
Identity = 160/666 (24.02%), Postives = 261/666 (39.19%), Query Frame = 2
Query:  179 ICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDP-KAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGPYSGGIGGTITNKEFRYHA----GFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTN------DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIV--LTEDSFVKHNITVEMLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFA------------------ISETELEFLGLKSLKEIN-GPFRFFKNQKLCYMN-IPVNELFKNVKNFYYI-----PSNCTDK--ICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPEC------LNTCVGPNPNQCIKGCKNKRENGTCVASC-------SKNFYPPLNDSKACLPCHPNCSEYNSTICTGPSS 2008
            +C     ++ SL    ++ + L     +NC  + G++ I  I       R+L+F  SI E+ G++++  N    +  +NLRIIRG    +         ++     GN  L +L  ++L  I    V  D N  + Y   +I W ++  +P  + +    T+      R  C   C          CWGP+ N CQ   +T+C  +    C    Y++     CC+ +C GGC+G   + C AC N  +   CV  C  P +     T    E  ++A    G FC K+CP   + +++ CV  C     + + N    C    CT+      D +       A   D +N        + +  NC KI G ++  +T      +N    +  E LN  + +     +                      + +  PN+  +  F+                  + +  +  L  +SLKEI+ G      N  LCY + I    LF  V     I       NCT +  +C+  CS  GCWGPG   C  CR++     C+  C+   G +    +  +    C+ C  +C      L TC GP P+ C K C + ++   CV  C       +   +   +  + C PCHPNC++     C GP+S
Sbjct:   28 VCAGTENKLSSLSDLEQQYRALRKYY-ENCEVVMGNLEITSI----EHNRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYR--KDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYA-DTIHWQDIVRNPWPSNMTLVSTIGSSGCGR--CHKSCT-------GRCWGPTENHCQTLTRTVCAEQCDGRCYG-PYVSD----CCHRECAGGCSGPKDTDCFACMNFNDSGACVTQC--PQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMC--KPCTDICPKACDGIGTGSLMSAQTVDSSN--------IDKFINCTKINGNLIFLVTGIHGDPYNAIDAIDPEKLNVFRTVREITGFLN--------------------IQTWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTVNQRIVIRDNRRAENCTAEGMVCNHLCSNDGCWGPGPDQCLSCRRFSRGKICIESCNLYDGEFREFENGSI----CVECDSQCEKMEDGLLTCHGPGPDNCTK-CSHFKDGPNCVEKCPDVLQGANSFIFKYADQDRECHPCHPNCTQG----CNGPTS 630          

HSP 3 Score: 62.7734 bits (151), Expect = 2.830e-8
Identity = 78/295 (26.44%), Postives = 123/295 (41.69%), Query Frame = 2
Query:  167 PGTIICQN--DNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYIL----------GITKLESKERELNFDSIEEIDGHLIIEG---NDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRD-KCSDQCKLWANFTQVFC-----WGPSANQCQQQTLCGSKYSSE---CTTCRYINGE----EQGC----CNDQC------LGGCNGGGASKCTACKNMLNEKKCVELC 937
            P T IC    D +   SL S+ + +   +I +  NCT I G++  L           I  ++ ++  + F ++ EI G L I+    N  +   F NL  I G     R L    ++  SL++     +  L F+SL+ I+A N+    N  + Y  H+I W  LF+          TV + +++RD + ++ C          C     WGP  +QC    L   ++S       +C   +GE    E G     C+ QC      L  C+G G   CT C +  +   CVE C
Sbjct:  325 PCTDICPKACDGIGTGSLMSA-QTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAIDAIDPEKLNV-FRTVREITGFLNIQTWPPNMTDFSVFSNLVTIGG-----RVL----YSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYY-HTINWTTLFS----------TVNQRIVIRDNRRAENCTAEGMVCNHLCSNDGCWGPGPDQC----LSCRRFSRGKICIESCNLYDGEFREFENGSICVECDSQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKC 593          
BLAST of Receptor protein-tyrosine kinase vs. UniProt/SwissProt
Match: sp|P11273|ERBB_AVIEU (Tyrosine-protein kinase transforming protein erbB OS=Avian erythroblastosis virus (strain ts167) OX=103898 GN=V-ERBB PE=3 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 1.796e-70
Identity = 139/345 (40.29%), Postives = 206/345 (59.71%), Query Frame = 2
Query: 2615 YLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEI-ESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSP 3643
            YL+R+ I  +       +   L EP +       + PN   L I+ + +     + K LGFGAFG VYKG W IP+ E+  +         PVAIK ++   + +  + ++ EA +MASV + H  R +G+CL+     LI+  +  G L  ++  +K+ I S  +L+W  QIA GM YL +R+++HRDLAARNVLV   + V+ITDFGL+K L    +KE   + GKVPI+W+A+E++    Y+H++DVW+YGVT+WE+ TFG  PY+     +I   + KG RL QP IC++DVY+IMV CW+   + RP F+ L+  F+   ++P RYL IQGD    +PSP
Sbjct:   87 YLRRRHIVRKRTLRRLLQERELVEPLTPS----GEAPNQAHLRILKETEF---KKVKVLGFGAFGTVYKGLW-IPEGEKVTI---------PVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLT-STVQLITQLMPYGCLLDYIREHKDNIGSQYLLNWCVQIAKGMNYLEERHMVHRDLAARNVLVKTPQHVKITDFGLAKQL-GADEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSVLEKGERLPQPPICTIDVYMIMVKCWMSDADSRPKFRELIAEFSKMARDPPRYLVIQGDERMHLPSP 412          
BLAST of Receptor protein-tyrosine kinase vs. TrEMBL
Match: A0A1B1ACY5 (Receptor protein-tyrosine kinase OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 2855.86 bits (7402), Expect = 0.000e+0
Identity = 1478/1479 (99.93%), Postives = 1478/1479 (99.93%), Query Frame = 2
Query:   86 MTHKTYXXXXXXXXXXXXNNATFEEEYPGTIICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNFDSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEINGPFRFFKNQKLCYMNIPVNELFKNVKNFYYIPSNCTDKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRCPRDESYGTKIIDSISYCKTCHSSCKGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDPYEIPSPHSIEMTNFNNHYGEDQFNFPSMTAETMLPLLNGRDSIDRDVKDFTDNNEIDESLLSSTDKEPLPTRSMNRTSNIFKLFQDNKQSXXXXXXXXXXXXXXXXXXXXXVSLASQEEPTFRNQPLITDDDPRYVADPTEKSIKMRQQLPLQSQFLQETPRFHSNISRENHTPFNNVXXXXXXXXXXXXDDYLEPNAPGPKNTSLVDTGDPEGYLEPINPSNKSSLLNQDDYVVPSLTNTPRESMLNSKPPRNSNAFKQSKQYISMDDGNPHFSNSIDDDDGYLEPEPKSRLLNSSNR 4522
            MTHKTYLILFLFLIQFQINNATFEEEYPGTIICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNFDSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLYENLNKLQELEGGFSYFKDNHLKNLTFLRNLLRFRAAYLHSDIPNLPSYHKFAISETELEFLGLKSLKEINGPFRFFKNQKLCYMNIPVNELFKNVKNFYYIPSNCTDKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRCPRDESYGTKIIDSISYCKTCHSSCKGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHITVGVVVTMLILVIIVIVTIVVYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDPYEIPSPHSIEMTNFNNHYGEDQFNFPSMTAETMLPLLNGRDSIDRDVKDFTDNNEIDESLLSSTDKEPLPTRSMNRTSNIFKLFQDNKQSQNPQNLNTRNNNTNNNNTPRLVSLASQEEPTFRNQPLITDDDPRYVADPTEKSIKMRQQLPLQSQFLQETPRFHSNISRENHTPFNNVSASQSPQISQISDDYLEPNAPG KNTSLVDTGDPEGYLEPINPSNKSSLLNQDDYVVPSLTNTPRESMLNSKPPRNSNAFKQSKQYISMDDGNPHFSNSIDDDDGYLEPEPKSRLLNSSNR
Sbjct:    1 MTHKTYLILFLFLIQFQINNATFEEEYPGTIICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNFDSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLYENLNKLQELEGGFSYFKDNHLKNLTFLRNLLRFRAAYLHSDIPNLPSYHKFAISETELEFLGLKSLKEINGPFRFFKNQKLCYMNIPVNELFKNVKNFYYIPSNCTDKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRCPRDESYGTKIIDSISYCKTCHSSCKGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHITVGVVVTMLILVIIVIVTIVVYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDPYEIPSPHSIEMTNFNNHYGEDQFNFPSMTAETMLPLLNGRDSIDRDVKDFTDNNEIDESLLSSTDKEPLPTRSMNRTSNIFKLFQDNKQSQNPQNLNTRNNNTNNNNTPRLVSLASQEEPTFRNQPLITDDDPRYVADPTEKSIKMRQQLPLQSQFLQETPRFHSNISRENHTPFNNVSASQSPQISQISDDYLEPNAPGSKNTSLVDTGDPEGYLEPINPSNKSSLLNQDDYVVPSLTNTPRESMLNSKPPRNSNAFKQSKQYISMDDGNPHFSNSIDDDDGYLEPEPKSRLLNSSNR 1479          
BLAST of Receptor protein-tyrosine kinase vs. TrEMBL
Match: A0A1B1ACX9 (Receptor protein-tyrosine kinase OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 707.983 bits (1826), Expect = 0.000e+0
Identity = 440/1192 (36.91%), Postives = 640/1192 (53.69%), Query Frame = 2
Query:  140 NNATFEEEYPGTIICQNDNVQIESLHSSVEKLKIL--SIIRSKNCTHIQGSIYILGITKLES-KERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQV---FCWGPSANQCQQQTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMC---TNDHLPCNLFKIAGHTDGANDFY-LRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLYENLNKLQELEGGFSY--FKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEINGPFRFFKNQKLCYMN-IPVNELFKNVKNFYYIPSNCTDKICHKDCS---EKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLNDSKA---CLPCHPNCSEYNSTI-----CTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYP--VTGFTCLPCPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRCPRDESYGTKIIDSISYCKTCHSSCK-GCY-GSTIFNCTRCKNKKIYLD--KKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEET---KRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKD--EDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYL 3607
            N + F  +YP   IC        S  +  E    L  ++   + CTHI G++ I  +++ ++  + +L+F +SI EI G L I  ND+++I   NL++IRG     RN  D  +   +   +G   L ++D R+LR+I + NVI   NP ++YL  ++ W+++  DP  Q L      +      KC  +C+ W     V   FC+GPS N+CQ+QT C    + +   C++    E  C + +C GGC+G  +  CT C  ++ +  CV  C  P    I G  +  + RY  G  C+ QCPA +L +N  CV++C     +   N CI+C    C   T  +  CN+  I       N  Y L  Q L+QL NC  ILG + + + SF K+ +TV MLY +L  ++E+ G FS   F+                 +   H+    +  + K+      +EFLGLK LK++ G          CY++ IP  E+          P N     C+K C       CWGPGN++CY C  Y A  +CV  CS   G++   + +     KC  CHP C   C GP P  C   C+   E  TCV +CS +F+P  N+  A   C  CH +C    + +     CTGPS++ G GGC+KCE+++ +     +    +C +G Y    ++ +IS  +   V   +C PC  +C  C G + +   C  CKG +  N C   C   ++   K+ +    C  CH  C+ GC   +    CTRC N K+++D  K KF C   CP  ++  E +   GD +CL       K EET   K+      ++      ++ +I   V+Y + +A   RI  E+KA YSN  EP+ K+  ED +++PPNM R+ ++   DL+F+  SKPLG GAFG VY+G WK+P+ +   +        L V IKVI N      +  ++EAK+MASVSH HCL  IGVCLS EKPCL+S Y + GSLDK+L +N  KI+S  ML W++QIADGM YL KR IIHRDLAARNVLV+  + +QITDFGL+++++ T D  I+IK+GKVPIRWLAIETL    YS  TDVWAYGVTLWEIFT+ K PYE+ AT +I  F+ +G RL QP+I +L+VY++M+ CWL+ P++RP F  L+ TF  + ++P R+L
Sbjct:   17 NGSNFNPDYPNFRICVVSEAH-GSFKTPAEAYTYLKYTLGLGQRCTHIYGNLPISDLSRFKNGSDPDLSFLESIIEISGSLSIINNDVKRIPLTNLKVIRGVT--LRNEPDALNIIHNHSENG-TFLEEIDLRNLRAIMSKNVIISQNPGLEYLEKNLDWSQILDDPTTQKLKVSEFVRPSNGTAKCHTECEYWTREDGVRSQFCFGPSKNECQKQTKCVK--NKDLKWCKFTKTGEIPC-SHECAGGCDGRTSKDCTVCNKLVKDSDCVSSC-APRPNHIFGMDSKDKLRYTVGGLCTSQCPASLLDQNKICVYECDFDAHQKIGNRCIECPNGNCNSSTAGYKLCNIATIDKFYPKNNRKYSLNKQTLMQLTNCTLILGDLDIDDISFNKNGVTVPMLYHHLKNVREIIGLFSLVTFQTKISNLTFLSNLEEIRLSVKSHTVASAMNIHGKY------IEFLGLKKLKKVYGKISIGGTNGTCYLDRIPWEEIS---------PDNRVKFSCNKTCDPLCTGQCWGPGNEMCYSCAYYKAGNSCVKQCSDSPGYF--ASQTEFKTIKCQTCHPLCRQNCTGPTPKNCGGQCRYAIEENTCVKNCSIDFFPVANNVNAPITCQLCHSSCFVDKTLVGTNHACTGPSNILGTGGCSKCEKLIKTNNNQYLCHKGSCPKGFYQSVINQ-NISHLHKNIVHQSSCEPCHSMCRTCSGSTNEKRMCHQCKGYFLDNKCVKECDNMKNVTIKL-EIGDECPQCHKECRNGCLLANDSTACTRCLNHKLFVDDDKNKFSCVTRCPHDRNFTEYQ--DGDFICL-------KFEETINSKQRKTIFIILSGCFGFLVFIIGFCVLYFRWRANQTRILAEIKALYSNFKEPDMKNMKEDYITRPPNMRRMQMIPISDLVFDTSSKPLGSGAFGKVYRGYWKVPRQDNKYIN-------LEVVIKVIHNSSKGSTDEFLEEAKIMASVSHRHCLPLIGVCLSLEKPCLVSTYAQHGSLDKYLQQNSKKISSHSMLKWAKQIADGMAYLNKRGIIHRDLAARNVLVNDDDNIQITDFGLARLVDET-DDSIVIKSGKVPIRWLAIETLLSATYSPATDVWAYGVTLWEIFTYAKRPYEELATGEIKSFLQQGNRLCQPEISTLEVYMVMIKCWLDDPHMRPSFMELVSTFEQFIQSPKRFL 1164          
BLAST of Receptor protein-tyrosine kinase vs. TrEMBL
Match: A0A1B1ACY2 (Receptor protein-tyrosine kinase OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 671.774 bits (1732), Expect = 0.000e+0
Identity = 433/1202 (36.02%), Postives = 635/1202 (52.83%), Query Frame = 2
Query:  152 FEEEYPGTIICQNDNVQIESLHSSVEKLKILSIIRSK-------NCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECTTCRY--INGE-EQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCY-GNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKH--NITVEMLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFA---ISETELEFLGLKSLKEINGPFRFFKNQKLCY---MNIPVNELFKNVKNFYYIPSNCTDKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQK-------CLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLNDSKACLPCHPNCSE--YNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYPVTGF-TCLPCPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRC-------PRDESYGTKIIDSISYCKTCHSSC-KGCYGS--TIFNCTRCKNKKIYLDK--KKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKP-PNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKD--KEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGD 3622
            F+EEYPG  IC++      S+ S  +     S++  K       NCTH++G++ I  +   + +  +L F  SI E+ G + ++ N ++ I   NL++IRG NS+    ++K      + +    +     F  LR I  ++V F +  K K+LP SIKW ELF +PK Q L    +T +  +  +C   C L  +F   +CW  SAN CQ+Q+ C  +       C +   NGE ++G C++QC GGCNG   S C  CK  +N   CVE C   +    G T  N  F+   G+ C+  CP  +L E   C++ C+  +F    N CI+C   ++C       N+ KI    +  + FY+ A  L    + + ++G    T  SF K    IT+ MLY++L  +Q + G       N          L          +I +L +    A   I  T+LEFLGL+ L+ I G F    +  LCY   +N   N L  N  +  Y P N   K C   C  +GCWGPG+ +CY CR + A   CV  C  + GFY   N+S +           C RCHP CL  C GP P  CI GC+  +EN  CV +CS+ ++   + +K C+ CH  C E   N  +CTG SS+ G+GGC+ C +++  R          C    Y    D  ++ +         C PC E C +C G       CE C G W  + C  +C       PR+ S           C  C+ +C + C  +    F C  C  K++YLD   K F C   CP     +  +    DI+C++  +  +  E  K       ++++++ + +I  V I      K   ++    LKA YSN+ EP+S+      K  PNM RL+++   DLIF   +KP+G GAFG VY+G WK P N++  L+K+  D  L VA+KVI+   N +I+ +M+EAK+MASV H HCLR IG+CL YE PCLI+ +V+ GSLDK+L ++K+ + S  +LSW EQIADGM YL  R IIHRDLA RNVL++ LE +QITDFGL+ +++ T+D   EI+I  G+VPIRWLA+ETL +G YSH+TDVW++G+TLWEIFT+G+ PY++    +I  ++++G RL+QP+ICS+D+Y +M  CW E+ N RP F+ LM T + + + P  YL+I  D
Sbjct:   23 FDEEYPGVTICES------SMTSGFQYFMPHSLMFLKGELGGNHNCTHVEGNLVIQNVWP-DQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLA---LEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKL----ITYNKYMEHQCHSDC-LRNDFP--YCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKLNPNFKLRVGYMCANSCPVNLLQEVDACIYSCNSLHFYRVDNKCIRCQNSSVCAKKEF--NINKIINE-ENEDVFYMTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSN--------IVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIFGKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCN---KPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYT--NTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYF---SFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNAS-----------CPYCNGNCVERCTVTPNDPFQCGSCNFKRLYLDNHNKSFQCVSECPQTHKYKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWK-PSNKD--LEKSDRD-SLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND 1173          
BLAST of Receptor protein-tyrosine kinase vs. TrEMBL
Match: A0A564YLA1 (Receptor protein-tyrosine kinase OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS6873 PE=4 SV=1)

HSP 1 Score: 631.713 bits (1628), Expect = 0.000e+0
Identity = 444/1252 (35.46%), Postives = 617/1252 (49.28%), Query Frame = 2
Query:  266 CTHIQGSIYILGITKLES-KERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVD-----LDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQ--ILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGPYSGGIGGTIT----NKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQ-LKNCKKILGYIVLTEDSF--VKHNITVEMLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISE-TELEFLGLKSLKEINGPFRFFKNQKLCYMN-----IPVNELFKNVKNFYYIPSNCTDK--ICHKDC-SEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQ------------------------------KCLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLNDSKACLPCHPNC-----SEY---NSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKT----CHEGTYAFPNDRP--------DISRFYPVTGFTCLPCPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRCPRDESY--GTKIIDSISY----------CKTCHSSCKGCYGSTIFN---CTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKL---EETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKN------------------------------------MGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDPYEI 3634
            CTHI G++ +  I +LE+  + +L+F  SI E+ G++ I  ND+++I   +LRIIRG          +G  D SL ++ NA  +D     LD R+L  I  HNVIF  NP + +   ++  N LF +P  Q  IL S   T      D     C      T   CWGP A+QCQ    CG   S     CR+   +E   C+D C+GGC    +S C AC+N LN   C+  C  P    +    +    N EF+Y     C K+CP  ML   T CV +C        +  C+ C  + C N  +  ++F         N F L      +  K C    G I +++DSF   +  + +E L+ NL  L+E+ G + Y   +           L             L       I + T LEFLG+KSL+ ++          LCY +     +P+    +NVK+    P+ C  +  +CH +C  E GCWGPG  +C  C  Y+A G CV+DC+   GF+ P N+S +                                 KC +CH EC  TC GP  NQCI  CKN R   TCV  CS++ Y    + K CLPC P C     SE      + C+G     G+GGC  C  +   +      C+ T     H G   +             D ++   +    C+PC   C  C G       C+ CK   +++ C   CP D++Y     IID +S           C  CH  C G  G T F    C  C+  KI +D  KF CN TCPP     E+ +     +CL+  + +  L       R    +   + +L L+I  ++ +V+    KA   RI+  LK+ Y+N+  P+ KD    S+ PNMGR  +++ +DL F++    +G GAFG VY+GKW++PK        A G   L VAIKVI++                                         ++ ++ EAK+MASV H +CL  IGVCL+ +  C++S +V+EGSLD++L  +K+ + S  +LSW+EQIADGM YL +R IIHRDLAARNVLV   E VQITDFGL+KMLE+  +  ++++TG+VPIRWLAIETL  G YSH+TDVW+YGVTLWEIFTFGK PYE+ AT DI D V+KG RLSQP+IC+LD Y++MV CW+E    RP F  LM+ F  YC+ PGRYL I+GD Y I
Sbjct:   62 CTHIIGNLVLCYIKRLENGSDPDLSFLSSIREVSGYVFISDNDVKRIPLTSLRIIRGRVPYHY----EGKGDISLYIARNAKSLDYGLEILDLRNLTVIQQHNVIFWDNPFLCHFQFTVDINSLFANPSKQRRILVSKNDTISSYGCDYEKTHCH--KECTSGHCWGPDADQCQMIAKCGQGSSK---YCRF--DKEDAFCDDACIGGCTNS-SSNCWACRNKLNGDTCISSC--PPKHQVNQVTSRQELNPEFKYDVHDICVKECPEPMLKMETVCVIECDFKTTMPVNGTCVPCTTSPCANHCVQKSIF--------GNGFPLMTSKTAKKFKECYYYSGAIYISKDSFNLKRDPLKLEDLW-NLYNLREIVG-YIYIDLSDKDIPLQNLTFLENLYKVTTEFSGGLSLQSSLTIHDATNLEFLGMKSLRYMDFSAILNGLPSLCYTSGLEKVLPIRR--QNVKD----PAQCEKEGHVCHSECLPEAGCWGPGPAMCARCCTYEADGVCVADCADAPGFFLPPNTSAIIRSGFRCPTLPLTPEQVDAMSSEEIMAAIKPALKCAKCHEECAETCTGPEANQCIGECKNFRSGDTCVRRCSQDHY---TEDKICLPCSPKCLPPLKSELIPEGVSACSGLGEFLGLGGCTFCHFVQKDKATSKYQCLNTRCPPQHFGNSTYLKHLSLEKEELSMDNTQVANIAFQECIPCHPECEICAGPGNHISVCQKCKNWMYRSECVSTCPPDDTYMPDPSIIDQLSEREKKMLEKRECLRCHEQCSG--GCTAFGPEFCNNCRYAKIMIDGNKFICNSTCPP-----ELYRMENTNLCLNSEQYEKMLGANATRARNQALIAAGIVLLFLLIFSLIFVVLCFNYKAKRSRIKEALKSTYTNVKAPDMKDAKS-SREPNMGRWEMINIDDLSFDENKTLIGKGAFGEVYRGKWRVPKRVLNQFNLARGT-SLDVAIKVIRSSASGPSQGGPATNPGVNASDSSSNASQVDANTIDRITARSNLQDMLAEAKVMASVQHKNCLPLIGVCLTRKMQCMVSMFVEEGSLDRYLRLHKDDLNSFTLLSWAEQIADGMAYLEERGIIHRDLAARNVLVQSREHVQITDFGLAKMLENGDEDSVVVRTGRVPIRWLAIETLQSGIYSHKTDVWSYGVTLWEIFTFGKQPYENIATADIKDHVMKGVRLSQPEICTLDTYMVMVRCWMEEQESRPTFLELMKCFHKYCQTPGRYLYIEGDEYAI 1271          
BLAST of Receptor protein-tyrosine kinase vs. TrEMBL
Match: A0A0X3PH98 (Receptor protein-tyrosine kinase OS=Schistocephalus solidus OX=70667 GN=TR102389 PE=4 SV=1)

HSP 1 Score: 613.609 bits (1581), Expect = 0.000e+0
Identity = 436/1303 (33.46%), Postives = 630/1303 (48.35%), Query Frame = 2
Query:  149 TFEEEYPGTIICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLES-KERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAH-----LVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKC-----SDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGPY--SGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLYE-----NLNKLQELEGGFSY--FKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAIS---ETELEFLGLKSLKEINGPFRFFKNQKLCYMNIPVNELFKNVKNFYYIPSNCTDK--ICHKDCSE-KGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPIN---------------------------------------------SSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLNDSKACLPCHPNCSE--------YNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCV-KTCHEGTYAFP-----------NDRPDISRFYPVTGFTCLPCPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRCPRDESYGTKIIDSIS----------YCKTCHSSCKG-CYGSTIFNCTRCKNKKIYLDKK--KFYCNDTCPPLKSVEEIEKGSGDIVCLSL--WESKAKLEETK-RTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKN--EETLLKKASGDFYLPVAIKVIKNMGN-------------------------------EEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDPYEI 3634
            +   EYP   IC++ NV  ++      +L+      S+ CTHI G++ +  + + ++  + +L+F  SI E+ G++ I  ND+ +I   +LRIIRG   +   +   G++  +LV+S NA      L  LD R L  I  HNV    NP++ Y+   + ++ LF +PK Q         DLI +  C     S         T  +CWGP  +QCQ ++ C    S  C    Y  G     C+D C+GGC G  +S C AC++ LN + C   C   Y  S        N EF+Y     C K CPA  L  +T CV +C        +  C  C  + C        +F       G N   + +    ++K C+   G I L   +F K       L       NL  L+E+ G + Y  F  +  +          ++     SD  +L      A+S    + LEFLG KSL+ ++          LCY++  + ++          P+ C ++  +CH +C    GCWGPG  +C  C  + A   CVS C  + GFY P                                               S ++ +  C RCH EC  TC   +   CI  CK+ +E   CV++CS+N+Y     +K CL CHP CS          +   C+GP S  G GGC  C  I  + +     C+ + C    Y  P           N  PD      +    C PC  LC  C+G S     C  C+G  +K  C   CP D++Y      +++           C  CH  C G CY +   +C  C+ +KI +D++  KF CN TCPP +            +CL    +E  +    T+ R  I +G  + +  + ++ ++ IV     KA   +I   LK+ Y+N   P+ K +   S+ PNMGRL I++ +DL F++ S PLG GAFG VY+GKW++PK    E    +++    L VA+KVI++                                    +  ++ EAK+MASVSH++CL  IGVCL+    C++SA+V+ GS+D++L  NK+ + S  +LSW+EQIADGM YL  R IIHRDLAARNVL+   E VQITDFGL+KML+S  +  +++++G+VPIRWLAIETL  G YSH+TDVW+YGVTLWEIFTFGK PYE+  T DI D V+KGGRL+QPDIC+LD Y++MV CW+E  + RP F  LM+ F D+C+ PGRYL IQGD + I
Sbjct:   24 SLTPEYPNIKICRSRNVDCKTSLDPNIQLRYYRRQYSE-CTHILGNLVLCNLRRYDNGSDPDLSFLTSIVEVSGYVYISNNDVRRIPLTSLRIIRGM--VPYYIPSLGNS--ALVISRNAFNKTVGLEVLDLRKLTVIQNHNVALWDNPQLCYIAFRVDFHALFPNPKQQEALR-VSNSDLISQSGCDFDNTSCHPSCVQTDTNAYCWGPEKDQCQLRSKCLHDTSRYCLMDGYNLGTT---CDDACIGGCTGH-SSNCWACRDKLNNRTCTGSCPPKYILSHVTSRQELNPEFKYDLHDICVKTCPAPFLKMDTVCVIECDFKTTIPINGSCEPCATSPCAEHCTKEQIF-------GTNFPLITSAAAEKMKTCEYYSGPIYLNRMAFEKRGSGPAPLARLDDLWNLRNLREIVG-YIYLDFTGSPPELTNLTFLQNLYKVTAEFSDGVSL----GIALSIYNASNLEFLGFKSLRYVDTDAYLEFLPSLCYLS-GLKQILPMRTKAVKSPTTCDNEGHVCHSECLPITGCWGPGPAMCAHCCGFQAGDVCVSSCLDEPGFYTPPGLETQLVSVGASGSPFSSLQNAANIQCPTLPLTAAQLATMTAEEAISRVIPSPACARCHVECAQTCFNASNIACIGPCKHYKEANACVSNCSRNYYAD-ETTKDCLLCHPTCSNALQSTPLPVSVAACSGPGSYLGNGGCTFCHFIRKNPETQRFECLDRGCPPSHYGRPTHLSELKIAHVNLSPDNLHAATLDIRECAPCHPLCEVCEGPSTHETVCLKCRGWIYKGECVETCPSDDTYMPNENATLNEQELAALKAKQCLLCHRQCAGGCYAAGPEDCVNCRFRKILIDEESNKFVCNSTCPPDQPFTMPNTN----LCLDKIKYELISGAAATRTRNRILLGCSLGLFGVFLLALLIIVPCFHYKAKRRKIREALKSVYTNKAAPDMKSQ-AASREPNMGRLEIINSDDLQFDESSTPLGTGAFGAVYRGKWRVPKRILAEYNWPRSTN---LDVAVKVIRSPAEPVRGTVSGKAATMEPSDTSPEAKVMERIAEKNNLNEMLSEAKVMASVSHLNCLPLIGVCLTKNMQCMVSAFVELGSIDRYLRENKDSLNSYTLLSWAEQIADGMAYLEARGIIHRDLAARNVLLQSPEHVQITDFGLAKMLDSLDENSVVVRSGRVPIRWLAIETLQFGIYSHKTDVWSYGVTLWEIFTFGKQPYENIETVDIKDHVMKGGRLTQPDICTLDAYMVMVKCWMEDYDSRPTFLELMRLFHDFCQTPGRYLYIQGDEFAI 1294          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Cavefish
Match: egfra (epidermal growth factor receptor-like [Source:NCBI gene;Acc:103031629])

HSP 1 Score: 266.544 bits (680), Expect = 1.503e-72
Identity = 175/508 (34.45%), Postives = 251/508 (49.41%), Query Frame = 2
Query: 2159 FTCLPCPELCSKCKGK----SPKNDECEVCKGVWHKNTCRLRCPRD-----ESYGTKIIDSISYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGS-GDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEI-ESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSP 3643
             TCL C   C    G      P  D C  C        C  RCP+      ++   K  DS+  C+ CH +C +GC G  + +C   K                  P   +  I  G  G I+   +      +   +R                        ++KRK    R+  E       L EP +       + PN   L I+ + +     + K LG GAFG VYKG W +P+ E         D  +PVAIKV++   + +  + ++ EA +MASV H H  R +G+CL+     L+S  +  G L  ++  NK+ I S  +L+W  QIA GM YL  R+++HRDLAARNVLV   + V+ITDFGL+K+L S  +KE     GKVPI+W+A+E++    Y+H++DVW+YGVT+WE+ TFG  PY+     +I   + KG RL QP IC++DVY+IMV CW+     RP F+ L+  F+   ++P RYL IQGD    +PSP
Sbjct:  495 MTCLECDPECRPLNGSLTCSKPGPDGCVECAHFRDGPHCVARCPQGIPGEKDTLVWKYPDSMRVCQLCHQNCTQGCTGPELKDCREYK------------------PFSGMSVIAAGVVGGILAFVILSLGVAVLVRRR------------------------HIKRKRTLRRLLQE-----RELVEPLTPS----GEAPNQSLLRILKETEF---KKIKVLGSGAFGTVYKGLW-VPEGE---------DVKIPVAIKVLREATSPKANKEILDEAYVMASVEHPHVCRLLGICLTSTVQ-LVSQLMPYGCLLDYVKENKDNIGSQHLLNWCVQIAKGMNYLEDRHLVHRDLAARNVLVKTPQHVKITDFGLAKLL-SADEKEYHADGGKVPIKWMALESILHRTYTHQSDVWSYGVTVWELMTFGTKPYDGIPASEIAGVLEKGERLPQPPICTIDVYMIMVKCWMIDAESRPRFRELIAEFSKMARDPTRYLVIQGDERMHLPSP 936          

HSP 2 Score: 124.79 bits (312), Expect = 3.591e-28
Identity = 164/651 (25.19%), Postives = 261/651 (40.09%), Query Frame = 2
Query:  182 CQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQT--LCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPA-MMLPENTGCVHKCSEGYFK---NKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIV-----LTEDSFVKHNITVEMLYENLN---KLQELEGGF--SYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEI-NGPFRFFKNQKLCYMNIPVN--ELFKNVKNFYYI-----PSNCT--DKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPEC--LN---TCVGPNPNQCIKGCKNKRENGTCVASCSKNF----------YPPLNDSKACLPCHPNCSEYNSTICTGP 2002
            CQ  N ++  L +  E  + +  + S NCT I  ++ I       S E +L+F  SIEE+ G+++I  N   +I   NLR            I +GHT +             D  +L  ++ +N    ++  ++ LP                L S T          C   C   +      CW P    CQ  T   C  + S  C        +   CCN  C  GC G   + C AC++  ++  C + C     Y+        N + +Y+ G  C K CP   ++ ++  CV  CS G ++   +    C KC G +C      C+   + G+  G     + + ++   +NC  I G ++     L  D+F K   T +M    LN    ++E+ G     Y+  N      F    +          +          I +  +  LGL++L+EI +G      N KLCY N P +   LF++            P+ C   ++ C + C+ +GCWGPG  +C+ C+ Y    +CV+ C+  +G +         N  CL C PEC  LN   TC  P P+ C++ C + R+   CVA C +            YP  +  + C  CH NC++     CTGP
Sbjct:   20 CQGGNNRMTLLSTVDEHYQNMVKMYS-NCTVILENLEI----TYTSHEHDLSFLKSIEEVGGYVLIGLNKAPRIPLDNLR------------IIRGHTLY-------------DGLALAVLSNYN----NSKGLRELP----------------LISLT-------GKMCHSDCYNGS------CWAPGRANCQTFTKLTCAEQCSGRCK-----GPKPSDCCNMHCASGCTGPRPTDCLACRDFQDDNTCKDACPPLMLYNPNTHQLAPNPDGKYNFGATCVKNCPHNYVVTDHGACVRSCSPGTYEVDEDGVRKCKKCEG-LCPKV---CSGLGV-GNLVGV--MSINSSNIDSFENCTTINGDVLILKTTLNGDTFTK---TPKMDPAKLNVFRTVKEITGSLLVQYWPKNMPSLSPFENLEVIRGRTKHQGTV-------SLGIGKLPITHLGLRALREISDGDVSISANAKLCY-NSPEHWKRLFRSEDQVARPMQNADPATCAALNQTCDEMCTPEGCWGPGPTMCFSCKHYSRKKSCVAFCNLLEGEHRECE----VNMTCLECDPECRPLNGSLTCSKPGPDGCVE-CAHFRDGPHCVARCPQGIPGEKDTLVWKYP--DSMRVCQLCHQNCTQG----CTGP 573          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Cavefish
Match: egfra (epidermal growth factor receptor-like [Source:NCBI gene;Acc:103031629])

HSP 1 Score: 266.544 bits (680), Expect = 2.620e-72
Identity = 175/508 (34.45%), Postives = 252/508 (49.61%), Query Frame = 2
Query: 2159 FTCLPCPELCSKCKGK----SPKNDECEVCKGVWHKNTCRLRCPRD-----ESYGTKIIDSISYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGS-GDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEI-ESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSP 3643
             TCL C   C    G      P  D C  C        C  RCP+      ++   K  DS+  C+ CH +C +GC G  + +C   K                  P   +  I  G  G I+   +      +   +R                        ++KRK    R+  E +     L EP +       + PN   L I+ + +     + K LG GAFG VYKG W +P+ E         D  +PVAIKV++   + +  + ++ EA +MASV H H  R +G+CL+     L+S  +  G L  ++  NK+ I S  +L+W  QIA GM YL  R+++HRDLAARNVLV   + V+ITDFGL+K+L S  +KE     GKVPI+W+A+E++    Y+H++DVW+YGVT+WE+ TFG  PY+     +I   + KG RL QP IC++DVY+IMV CW+     RP F+ L+  F+   ++P RYL IQGD    +PSP
Sbjct:  555 MTCLECDPECRPLNGSLTCSKPGPDGCVECAHFRDGPHCVARCPQGIPGEKDTLVWKYPDSMRVCQLCHQNCTQGCTGPELKDCREYK------------------PFSGMSVIAAGVVGGILAFVILSLGVAVLVRRR------------------------HIKRKRTLRRLLQERE-----LVEPLTPS----GEAPNQSLLRILKETEF---KKIKVLGSGAFGTVYKGLW-VPEGE---------DVKIPVAIKVLREATSPKANKEILDEAYVMASVEHPHVCRLLGICLTSTVQ-LVSQLMPYGCLLDYVKENKDNIGSQHLLNWCVQIAKGMNYLEDRHLVHRDLAARNVLVKTPQHVKITDFGLAKLL-SADEKEYHADGGKVPIKWMALESILHRTYTHQSDVWSYGVTVWELMTFGTKPYDGIPASEIAGVLEKGERLPQPPICTIDVYMIMVKCWMIDAESRPRFRELIAEFSKMARDPTRYLVIQGDERMHLPSP 996          

HSP 2 Score: 155.606 bits (392), Expect = 1.294e-37
Identity = 177/658 (26.90%), Postives = 278/658 (42.25%), Query Frame = 2
Query:  179 ICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAH----LVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFT--DPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQT--LCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRG--PYSGGIGGTITNKEFRYHAGFFCSKQCPA-MMLPENTGCVHKCSEGYF---KNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIV-----LTEDSFVKHNITVEMLYENLN---KLQELEGGF--SYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEI-NGPFRFFKNQKLCYMNIPVN--ELFKNVKNFYYI-----PSNCT--DKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPEC--LN---TCVGPNPNQCIKGCKNKRENGTCVASCSKNF----------YPPLNDSKACLPCHPNCSEYNSTICTGP 2002
            +CQ  N ++  L +  E  + +  + S NCT I  ++ I       S E +L+F  SIEE+ G+++I  N   +I   NLRIIRG       L D      +L V  N +    L +L   SL  I    V F  NP +  +  +I+W ++ +  D    + F  T +KD  +   C   C   +      CW P    CQ  T   C  + S  C        +   CCN  C  GC G   + C AC++  ++  C + C     Y+        N + +Y+ G  C K CP   ++ ++  CV  CS G +   ++    C KC G +C      C+   + G+  G     + + ++   +NC  I G ++     L  D+F K   T +M    LN    ++E+ G     Y+  N      F    +          +          I +  +  LGL++L+EI +G      N KLCY N P +   LF++            P+ C   ++ C + C+ +GCWGPG  +C+ C+ Y    +CV+ C+  +G +         N  CL C PEC  LN   TC  P P+ C++ C + R+   CVA C +            YP  +  + C  CH NC++     CTGP
Sbjct:   34 VCQGGNNRMTLLSTVDEHYQNMVKMYS-NCTVILENLEI----TYTSHEHDLSFLKSIEEVGGYVLIGLNKAPRIPLDNLRIIRG-----HTLYD----GLALAVLSNYNNSKGLRELPLISLTEILKGGVKFAHNPYLCNV-ETIQWADIMSSKDSSQFVKFESTTSKDCKM---CHSDCYNGS------CWAPGRANCQTFTKLTCAEQCSGRCK-----GPKPSDCCNMHCASGCTGPRPTDCLACRDFQDDNTCKDACPPLMLYNPNTHQLAPNPDGKYNFGATCVKNCPHNYVVTDHGACVRSCSPGTYEVDEDGVRKCKKCEG-LCPKV---CSGLGV-GNLVGV--MSINSSNIDSFENCTTINGDVLILKTTLNGDTFTK---TPKMDPAKLNVFRTVKEITGSLLVQYWPKNMPSLSPFENLEVIRGRTKHQGTV-------SLGIGKLPITHLGLRALREISDGDVSISANAKLCY-NSPEHWKRLFRSEDQVARPMQNADPATCAALNQTCDEMCTPEGCWGPGPTMCFSCKHYSRKKSCVAFCNLLEGEHRECE----VNMTCLECDPECRPLNGSLTCSKPGPDGCVE-CAHFRDGPHCVARCPQGIPGEKDTLVWKYP--DSMRVCQLCHQNCTQG----CTGP 633          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Cavefish
Match: ENSAMXT00000002946.2 (pep primary_assembly:Astyanax_mexicanus-2.0:12:28119056:28308465:-1 gene:ENSAMXG00000002862.2 transcript:ENSAMXT00000002946.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 262.692 bits (670), Expect = 5.540e-71
Identity = 187/557 (33.57%), Postives = 274/557 (49.19%), Query Frame = 2
Query: 2012 PGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSKCKGKS-----PKNDECEVCKGVWHKNTCRLRCPRDESYGTKII----DSISYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSPH 3646
            PG   C  C      R     +CV++C+   Y     R DI  F    G  C+ C   C K   K+     P  D+C  C  +     C  +CP      T  I    +S + C  CH +C +GC G  I +C         LD+          PL +   I    G  V + +    A     K                           K++A+   +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ +  G +     M EA +MAS+ H H +R +GVCLS     L++  +  G L  ++  +K+ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     ++ITDFGL+++L++  +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T +I D + KG RL QP IC++DVY++MV CW+   + RP F+ L   F    ++P RYL IQGD   ++PSP+
Sbjct:  469 PGPDQCLSCRFYSRGR-----TCVRSCN--LY-----RGDIREF--ANGSVCMECDSQCEKAGDKTMTCHGPGPDQCTKCLHLKDGPNCVEKCPDGLQGATSFIFKYAESNNECHPCHPNCTQGCTGPRIQDCIG------MLDRT---------PLIAAGVI---GGMFVAVIVALGFAIYVRRKSIK------------------------KKRALRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRVKILGTGAFGTVYKGIW-VPEGESV---------KIPVAIKILNETTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVRSPNHIKITDFGLARLLDA-DEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFCRMARDPQRYLVIQGDDCMKLPSPN 943          

HSP 2 Score: 154.836 bits (390), Expect = 2.045e-37
Identity = 167/631 (26.47%), Postives = 254/631 (40.25%), Query Frame = 2
Query:  260 KNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHS--IKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLYENLNKLQ-ELEGGFSYFKD--NHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFA---ISETELEFLGLKSLKEIN-GPFRFFKNQKLCYMN-IPVNELFKNVKNFYYIPSN-----CTDK--ICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPEC------LNTCVGPNPNQCIKGCKNKRENGTCVASCSKNF-------YPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERI 2047
            +NC  + G++ I  I     + R LNF  SI E+ G++++  N  + +  +NLRIIRG                  +  G   L+ L  ++L  I    V  D N   K+L H+  I W ++  +P+A++L  P+       R +C   C          CWG   +QCQ   +T+C  +    C    Y++     CC+ +C GGC+G   + C AC N  +   CV  C  P  Y+        N + +Y  G FC K+CP   + +++ CV        +N+   CI C  ++C     P +      H       +L    L+  K          L+ D F         +Y  +  L  E    F   K+    L   ++  N+         + I     Y   +   + +  +  L  +SLKEI+ G      N +LCY N +    LF+       I SN     CT +  +C K CSE GCWGPG   C  CR Y    TCV  C+  +G          +   C+ C  +C        TC GP P+QC K C + ++   CV  C           +     +  C PCHPNC++     CTGP     IG  ++   I
Sbjct:   28 ENCEVVMGNLEITSI----ERNRNLNFLKSIREVTGYVLVALNQFDYLPLENLRIIRGTK----------------LYEGRYALLGL--KNLTEILNGGVYVDQN---KFLCHADTIHWQDILKNPRAELLVVPSNNSGSTCR-RCHRSC-------NGRCWGHQEDQCQTLTKTVCAEQCDGRCFG-PYVSD----CCHRECAGGCSGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPKAKYTYGAFCVKKCPHNFVVDHSSCVR-------ENRIKMCIPCT-DICPKGKDPSSF-----HCHTLLKPFLSPLSLISKKTLNSFF-LSFLSSDLFPAQFSPNRDMYHGIGALDPERLNVFRTVKEITGFLNIQSWPENMTDLGVFSNLATIGGRSLYSGISLLILKQRWITALQFQSLKEISAGNVYITNNSQLCYYNTVNWTGLFRTGGQRALIKSNKDPRECTQERMVCDKLCSEDGCWGPGPDQCLSCRFYSRGRTCVRSCNLYRGDIR----EFANGSVCMECDSQCEKAGDKTMTCHGPGPDQCTK-CLHLKDGPNCVEKCPDGLQGATSFIFKYAESNNECHPCHPNCTQG----CTGPRIQDCIGMLDRTPLI 597          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Cavefish
Match: erbb4b (erb-b2 receptor tyrosine kinase 4b [Source:ZFIN;Acc:ZDB-GENE-030918-5])

HSP 1 Score: 262.307 bits (669), Expect = 7.149e-71
Identity = 196/592 (33.11%), Postives = 284/592 (47.97%), Query Frame = 2
Query: 1934 DSKAC----LPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTC--HEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSK-------CKGKSPKNDECEVCKGVWHKNTCRLRCPRDESYGT-----KIIDSISYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSPH 3646
            D K C    + C P CS+     C GP    G   C  C      R     +CV++C  H+G         D+  F    G  CL C   C K       C G  P  D C  C        C  +CP D   GT     K  ++ + C  CH++C +GC G  + +C         +D+           L  V  I  G    V +S+     K                                K++A+   +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ +  G +     M EA +MAS+ H H +R +GVCLS     L++  +  G L  ++  +K+ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     ++ITDFGL+++L+   +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T +I D + KG RL QP IC++DVY++MV CW+   + RP F+ L   F    ++P RYL IQGD   ++PSP+
Sbjct:  441 DPKECIMEKMICDPLCSDGG---CWGP----GPDQCLSCRFFSRGR-----TCVESCNLHQG---------DVREF--ANGSVCLECDAQCQKADDDGLTCTGPGP--DHCVKCLHFKDGPNCVEKCP-DGLQGTNSFIFKYAEANNECHPCHANCTQGCTGPRLQDCIG------MIDRTPLIAAGVIGGLFVVVIIALG----VAVSVRRKSIK--------------------------------KKRALRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRVKILGAGAFGTVYKGIW-VPEGETV---------KIPVAIKILNEATGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLDG-DEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFCRMARDPQRYLVIQGDDRMKLPSPN 938          

HSP 2 Score: 159.458 bits (402), Expect = 9.161e-39
Identity = 165/632 (26.11%), Postives = 253/632 (40.03%), Query Frame = 2
Query:  260 KNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHS--IKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYF---KNKSNHCIKCYGNMCTN--DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLCYMN-IPVNELFKNVKNFYYIPSNCTDK-------ICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLN------TCVGPNPNQCIKGCKNKRENGTCVASCSKNF---------YPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERI 2047
            +NC  + G++ I  I     + R+L+F  SI E+ G++++  N  + +  +NLRIIRG    +         ++     GN  L  L  ++L  I    V  D N   K+L H+  I W ++  + ++  L  P+           S  C+         CWGP  NQCQ   +T+C  +    C    Y++     CC+ +C GGC+G   + C AC N  +   CV  C  P  Y+        N   +Y  G FC K+CP   + +++ CV  C        +NK   CI C  ++C    D +     + A   D +N        + +  NC KI G +V     F+   I  + +Y N+  L   +   + F+            L                      + +  +  L L+S++EI+ G      N +LCY N I    LF+       I +N   K       IC   CS+ GCWGPG   C  CR +    TCV  C+  +G          +   CL C  +C        TC GP P+ C+K C + ++   CV  C             Y   N+   C PCH NC++     CTGP     IG  ++   I
Sbjct:   23 ENCEVVMGNLEITSI----DRSRDLSFLRSIREVTGYVLVALNQFDYLPLENLRIIRGTRLYEDRYALAIFLNYRR--DGNFGLRQLGLKNLTEILHGGVYVDQN---KFLCHADTIHWQDIVKNARSDHLVVPS---------NSSSSCQRCHRACNGRCWGPKENQCQSLTKTVCAEQCDGRCFG-PYVSD----CCHRECAGGCSGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPRAKYTYGAFCVKKCPHNFVVDHSSCVRACPSNKMEVEENKIKMCIPC-TDICPKACDGIGTASLQTAQTVDSSN--------IDKFINCTKINGNLV-----FLITGIKGD-VYHNIEALDPEK--LNVFRTVREITGKTRSILTFSGR-----------GISLLVLKQQWITSLQLQSMREISAGNVYITNNSQLCYYNTINWTSLFRIPTQKALIRNNRDPKECIMEKMICDPLCSDGGCWGPGPDQCLSCRFFSRGRTCVESCNLHQGDVR----EFANGSVCLECDAQCQKADDDGLTCTGPGPDHCVK-CLHFKDGPNCVEKCPDGLQGTNSFIFKYAEANNE--CHPCHANCTQG----CTGPRLQDCIGMIDRTPLI 592          

HSP 3 Score: 59.3066 bits (142), Expect = 3.543e-8
Identity = 75/295 (25.42%), Postives = 115/295 (38.98%), Query Frame = 2
Query:  167 PGTIICQN--DNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNFDSIEEIDGHLIIEGNDLEKI-TFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPT------VTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECTTC------------RYINGEEQGCCNDQCLGG------CNGGGASKCTACKNMLNEKKCVELCRGPYSGGIGGT 970
            P T IC    D +   SL ++ + +   +I +  NCT I G++  L IT ++              D +  IE  D EK+  F+ +R I G     R+++       SL+V     +  L  +S+R I+A NV   +N ++ Y  ++I W  LF  P  + L          + + +I    CSD            CWGP  +QC        ++ S   TC             + NG     C+ QC         C G G   C  C +  +   CVE C      G+ GT
Sbjct:  293 PCTDICPKACDGIGTASLQTA-QTVDSSNIDKFINCTKINGNLVFL-ITGIKG-------------DVYHNIEALDPEKLNVFRTVREITGKT---RSILTFSGRGISLLVLKQQWITSLQLQSMREISAGNVYITNNSQLCYY-NTINWTSLFRIPTQKALIRNNRDPKECIMEKMICDPLCSDG----------GCWGPGPDQC-----LSCRFFSRGRTCVESCNLHQGDVREFANGSVCLECDAQCQKADDDGLTCTGPGPDHCVKCLHFKDGPNCVEKC----PDGLQGT 549          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Cavefish
Match: ENSAMXT00000030092.1 (receptor tyrosine-protein kinase erbB-4 [Source:NCBI gene;Acc:103038099])

HSP 1 Score: 254.603 bits (649), Expect = 4.922e-68
Identity = 176/537 (32.77%), Postives = 267/537 (49.72%), Query Frame = 2
Query: 2075 SCVKTCHEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSK-------CKGKSPKNDECEVCKGVWHKNTCRLRCPRDESYGTKII----DSISYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSP 3643
            +CVK+C+   Y+      D+  F    G  C+ C   C K       C G  P  D+C  C  +     C  +CP      T  I    +S + C  CH +C +GC G  I +C         LD+       T   L  V  I  G       +++  +  ++                              K++ +   +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVA+K++ +  G +     M EA +MAS+ H H +R +GVCLS     L++  +  G L  ++  +K+ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     ++ITDFGL+++L+ T +KE     GK+ I+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+     +I + + KG RL QP IC++DVY++MV CW+   + RP F+ L+  F    ++P RYL IQGD   ++PSP
Sbjct:  547 TCVKSCN--LYSG-----DVREF--ANGSVCVECDGQCEKTGDRTVTCHGPGP--DQCTKCLHLKDGPNCVEKCPDGLQGATSFIFKYAESNNECHPCHPNCTQGCTGPRIQDCIG------LLDRTPLIVAGTIGGLFVVVIIALG------FAIFARRKSIK------------------------------KKRCLRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRVKILGTGAFGTVYKGIW-VPEGESV---------KIPVAVKILSETTGPKASVEFMDEALIMASMEHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLD-TNEKEYNADGGKMAIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPPCEIPEILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELVAEFCRMARDPQRYLVIQGDDCMKLPSP 1004          

HSP 2 Score: 158.303 bits (399), Expect = 2.194e-38
Identity = 176/655 (26.87%), Postives = 273/655 (41.68%), Query Frame = 2
Query:  260 KNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVS----GNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHS--IKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQT--LCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNH---CIKCYGNMCTN--DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLY-------ENLNKLQELE--GGFSYFKD--NHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLCYMN-IPVNELFKNVKNFYYIPSN-----CT--DKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLN------TCVGPNPNQCIKGCKNKRENGTCVASCSKNF-------YPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVS 2077
            +NC  + G++ I  I     + R LNF  SI E+ G++++  N  + +  +NLRIIRG        + +G    ++ ++    G   L  L  ++L  I    V  D N   K+L H+  I W ++  +P+A++L  P+        +   + C+         CWG   +QCQ  T  +C  +    C    Y++     CC+ +C GGC+G   + C AC N  +   CV  C  P  Y+        N + +Y  G FC K+CP   + + + CV  C     + + N    CI C  ++C    D +     ++A   D +N        + +  NC KI G ++     F+   I  +M +       E LN  + +    GF   +    ++ N     NL       L+S I  L    ++ IS      L  +SL+EI+ G      N +LCY N +    LF+       I SN     C+    +C K CSE+GCWG G   C  C+ Y    TCV  C+     Y+       +   C+ C  +C        TC GP P+QC K C + ++   CV  C           +     +  C PCHPNC++     CTGP     IG        LL R   IV+
Sbjct:   70 ENCEVVMGNLEITSI----ERNRNLNFLKSIREVTGYVLVALNQFDYLPLENLRIIRGTK------LYEGRYALAIFLNYRRDGYFGLRQLGLKNLTEILNGGVYVDQN---KFLCHADTIHWQDIVYNPRAELLVVPS--------NNSGNSCRRCHRSCNGRCWGHQEDQCQSLTKMVCAEQCDGRCFG-PYVSD----CCHRECAGGCSGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTSFQLEHNPKAKYTYGAFCVKKCPHNFVVDQSSCVRACPSNKMEVEENQVKMCIPCT-DICPKVCDGIGTGSLQMAQTVDSSN--------IHKFVNCTKINGNLI-----FLITGIKGDMYHGIAALDPERLNVFRTVREITGFLNIQSWPENMTNFGVFSNLATIGGRSLYSGISLLILKLRWIIS------LQFQSLQEISAGNVYITNNSQLCYYNTVNWTGLFRTRGQRAVIKSNKDLRECSQLQMVCDKLCSEEGCWGSGPDQCLSCKFYSRGKTCVKSCN----LYSGDVREFANGSVCVECDGQCEKTGDRTVTCHGPGPDQCTK-CLHLKDGPNCVEKCPDGLQGATSFIFKYAESNNECHPCHPNCTQG----CTGPRIQDCIG--------LLDRTPLIVA 661          

HSP 3 Score: 56.6102 bits (135), Expect = 2.612e-7
Identity = 78/294 (26.53%), Postives = 120/294 (40.82%), Query Frame = 2
Query:  167 PGTIICQN--DNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYIL----------GITKLESKERELNFDSIEEIDGHLIIEG---NDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDL----ILRDKCSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECTTC------------RYINGEEQGCCNDQC------LGGCNGGGASKCTACKNMLNEKKCVELC 937
            P T IC    D +   SL  + + +   +I +  NCT I G++  L          GI  L+  ER   F ++ EI G L I+    N      F NL  I G     R+L    ++  SL++     ++ L F+SL+ I+A NV   +N ++ Y  +++ W  LF     + +      KDL     L+  C   C      ++  CWG   +QC        K+ S   TC             + NG     C+ QC         C+G G  +CT C ++ +   CVE C
Sbjct:  341 PCTDICPKVCDGIGTGSLQMA-QTVDSSNIHKFVNCTKINGNLIFLITGIKGDMYHGIAALDP-ERLNVFRTVREITGFLNIQSWPENMTNFGVFSNLATIGG-----RSL----YSGISLLILKLRWIISLQFQSLQEISAGNVYITNNSQLCYY-NTVNWTGLFRTRGQRAVIKSN--KDLRECSQLQMVCDKLC------SEEGCWGSGPDQC-----LSCKFYSRGKTCVKSCNLYSGDVREFANGSVCVECDGQCEKTGDRTVTCHGPGPDQCTKCLHLKDGPNCVEKC 609          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003172.1 (pep scaffold:Pmarinus_7.0:GL476855:1052:76454:1 gene:ENSPMAG00000002842.1 transcript:ENSPMAT00000003172.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 250.751 bits (639), Expect = 3.019e-69
Identity = 138/343 (40.23%), Postives = 208/343 (60.64%), Query Frame = 2
Query: 2621 KRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEI-ESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSP 3643
            +++A+   IE EL        EP +         PN  +L I+ + +L    + K LG GAFG V+KG W  P+ E         D  +PVAIKV++   + +  + ++ EA +MASVSH H +R +G+CL+     L++  +  G L ++   +K  I S ++L+W+ QIA GM+YL ++ ++HRDLAARNVLV   + V+ITDFGL+++L+   + E     GK+PI+WLA+E++    ++H++DVW+YGVT+WE+ TFG  PYE     DI + + KG RL QP IC++DVY+IMV CW+     RP F+ L   F+   ++P RYL IQGD    +PSP
Sbjct:  538 RKRAMRRYIEKEL-------VEPLTPS----GAAPNQAQLRILKETEL---RKGKMLGSGAFGTVHKGIWT-PEGE---------DVKIPVAIKVLREATSPKANKEILDEAYIMASVSHPHLVRLLGICLTPSVQ-LVTQLMPLGCLLEYTREHKEHIGSQLLLNWAVQIAKGMMYLEEQRLVHRDLAARNVLVRTPQHVKITDFGLARLLD-INEIEYHADGGKMPIKWLALESIQYRTFTHQSDVWSYGVTIWELMTFGGKPYEGIPARDIPELLEKGERLPQPPICTIDVYMIMVKCWMIDAESRPRFKELAVEFSKMARDPQRYLVIQGDDRMTLPSP 854          

HSP 2 Score: 125.176 bits (313), Expect = 4.135e-29
Identity = 124/468 (26.50%), Postives = 184/468 (39.32%), Query Frame = 2
Query:  731 CWGPSANQCQQQTLCGSKYSSECTTCRYINGEEQG-----CCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEG------YFKNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIV-----LTEDSFVKHNITVEMLYENLNKLQELEG------------GFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEINGPFRFFKN-QKLCYMN-IPVNELFKNVKNFYYIPSNCTDKICHKD-------CSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLN-----TCVGPNPNQCIKGCKNKRENGTCVASCSKNF----------YPPLNDSKACLPCHPNCS 1972
            CWG     CQ+ T        + T  R  +G   G     CC+ QC  GC+G   + C ACKN  +   CV  C  P  Y+        N + +Y  G  C K+CP   + +   CV  C  G      + K K   C       C             G  + +    + A ++   +NC KI G I      +  D ++K              ++E+ G             F+ F +N       +   +    + L + IPN+ +             LGL SL+E++    + KN ++LCY N I    +F + +   Y+  N  +  C+ D       CSE GCWGPG   C  CR +  A +CV  C   +G Y       + +  C  C PECL      TC GP  N C++ C + ++   CV++C              YP  N++  C PCHPNCS
Sbjct:   56 CWGNGMKYCQKCT--------KLTCARQCDGRCHGPTPSECCHSQCAAGCDGPRDTHCFACKNFNDSGSCVSHCPPPTIYNPVTFAQGENPDVKYSYGAICVKECPHNFVVDYNSCVRACPAGKHEVEKFGKKKCETCTDVCPKACDG----------IGTGNLSRSQTVDATNIDTFENCTKINGNIAFLTTGIKGDDYMKIPPLDPDKLNVFRSIKEITGHLMIQAWPENMTDFAVF-ENLTTIRGRVLQSVGRTFSLLVARIPNITA-------------LGLASLQEVSAGNVYLKNNERLCYYNTIKWPAVFVSEQQTSYVHDNKPEADCNADGAVCDLLCSEHGCWGPGPDQCISCRFFRRARSCVESCYITEGPYR----EHMQDAVCAPCDPECLPVNDSVTCFGPGSNSCVR-CAHYKDGPHCVSACPVGAQGENDEIISKYPDKNNT--CQPCHPNCS 484          

HSP 3 Score: 63.5438 bits (153), Expect = 3.341e-10
Identity = 68/251 (27.09%), Postives = 110/251 (43.82%), Query Frame = 2
Query:  260 KNCTHIQGSIYILG----------ITKLESKERELNFDSIEEIDGHLIIEG---NDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQC-------QQQTLCGSKYSSECTTCRYINGEEQGCCNDQCLG-----GCNGGGASKCTACKNMLNEKKCVELC 937
            +NCT I G+I  L           I  L+  +  + F SI+EI GHL+I+    N  +   F+NL  IRG     R L   G T FSL+V+   ++  L   SL+ ++A NV   +N ++ Y  ++IKW  +F   +     +  V  +    D  +D        ++  CWGP  +QC       + ++   S Y +E     ++       C+ +CL       C G G++ C  C +  +   CV  C
Sbjct:  216 ENCTKINGNIAFLTTGIKGDDYMKIPPLDPDKLNV-FRSIKEITGHLMIQAWPENMTDFAVFENLTTIRG-----RVLQSVGRT-FSLLVARIPNITALGLASLQEVSAGNVYLKNNERLCYY-NTIKWPAVFVSEQQ----TSYVHDNKPEADCNADGAVCDLLCSEHGCWGPGPDQCISCRFFRRARSCVESCYITEGPYREHMQDAVCAPCDPECLPVNDSVTCFGPGSNSCVRCAHYKDGPHCVSAC 454          

HSP 4 Score: 50.8322 bits (120), Expect = 2.783e-6
Identity = 42/137 (30.66%), Postives = 57/137 (41.61%), Query Frame = 2
Query: 1514 INGPFRFFKNQKLCYMNIPVNELFKNVKNFYYI------PSNCTDKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASC 1906
            ++G     +N+ LCY N    + +  VK    +       + CT   CHK C  K CWG G K C +C K   A  C   C      + P  S          CH +C   C GP    C   CKN  ++G+CV+ C
Sbjct:    5 LHGGVYIKENKHLCYHN--TVDWWDIVKEGSIVNIDMDNSTTCTS--CHKGC-HKHCWGNGMKYCQKCTKLTCARQCDGRC------HGPTPSEC--------CHSQCAAGCDGPRDTHCF-ACKNFNDSGSCVSHC 121          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Sea Lamprey
Match: EGFR (epidermal growth factor receptor [Source:HGNC Symbol;Acc:HGNC:3236])

HSP 1 Score: 203.756 bits (517), Expect = 1.406e-53
Identity = 151/520 (29.04%), Postives = 246/520 (47.31%), Query Frame = 2
Query: 2174 CPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRCPRDESYGTKIIDSISYCKTCHSSCK------GCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCP---PLKSVEEIEK-GSGDIVC------------------LSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEI-ESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGD-PYEIPSP 3643
            C  LCS      P   +C  CK      TC   C   +    + + S + C  CH+ C        C+G    NCTRC+N +     +  +C   CP   P +S E I K    D VC                     W +  K+       ++    V +L+L + +       L+++ + + +E E       LT   ++        PN  +L I+ + +L    + K LG GAFG VYKG W +P+ E            + VA+KV+++  + +  + ++ EA +MASV H H +R +G+C+S     L++  +  G L +++  ++ ++ S ++L+W  QIA     +    ++  DL     LV  L          + + +S  D +       +PI+W+A+E++   K++H++DVW+YGVT+WE+ TFG  PY+  +  DI   + KG RL QP +C++DVY+IMV CW+     RP F  L   F+   ++P RYL IQGD P  +PSP
Sbjct:  476 CDALCSAEGCWGPGPMQCLSCKFHKRGKTCVESCSVLDGDEREFV-SGALCIACHAECMLINGSLTCHGPGPDNCTRCRNYR-----EGPHCVGFCPEGVPGESGELIYKYPDEDGVCHPCHYNCTQGEIGERHKGAPYWANVNKVPVIAAGVVSGLFAVFLLLLALFIYKRHQNALRKRTLRKYVENERPQLVQPLTPSGAQ--------PNQAQLRILKETEL---KKGKVLGSGAFGTVYKGIW-VPEGESV---------KIAVAVKVLRDSASSKANKDILDEAYLMASVDHPHLVRLLGICMSSTTQ-LVTQLMPHGCLLEYVREHRGRVGSQLILNWCVQIAKNASEIQALQMVCDDLVR---LVMSLRTPPRITLASANLFQSIDDAKHW-HDRDMPIKWMALESIQYRKFTHQSDVWSYGVTVWELMTFGGKPYDGISARDIPGLLEKGERLPQPPVCTIDVYMIMVKCWMIDAESRPRFSELATDFSKMARDPSRYLVIQGDEPMALPSP 963          

HSP 2 Score: 75.485 bits (184), Expect = 8.581e-14
Identity = 43/127 (33.86%), Postives = 58/127 (45.67%), Query Frame = 2
Query: 1634 ICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECL-----NTCVGPNPNQCIKGCKNKRENGTCVASCSKN--------FYPPLNDSKACLPCHPNCSE 1975
            +C   CS +GCWGPG   C  C+ +    TCV  CS   G         +S   C+ CH EC+      TC GP P+ C + C+N RE   CV  C +          Y   ++   C PCH NC++
Sbjct:  475 VCDALCSAEGCWGPGPMQCLSCKFHKRGKTCVESCSVLDG----DEREFVSGALCIACHAECMLINGSLTCHGPGPDNCTR-CRNYREGPHCVGFCPEGVPGESGELIYKYPDEDGVCHPCHYNCTQ 596          

HSP 3 Score: 51.2174 bits (121), Expect = 2.255e-6
Identity = 48/217 (22.12%), Postives = 87/217 (40.09%), Query Frame = 2
Query:  263 NCTHIQGSIYILGITKLESKERELNFDSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVD--LDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDL----ILRDKCSDQCKLWANFTQVFCWGPSANQCQ--QQTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKC 889
            NC  + G+   L IT + +        +I E+ G+++I  N+++ +  +NLR++RG       L D+ +   +++++ N  + +  L  + LR +     I      ++  P    W+++      +  F P V  D     +    C   CK        FCWG     CQ    T+C  +    C        +   CC+  C  GC G   + C
Sbjct:   27 NCEVVMGN---LEITYIRNGSDLSFLRTIREVSGYVLIALNEVDHVPLENLRVVRGT-----RLYDQRYA-LTVLLNYNDSVPEERLGLKELR-LTRLTEILRGGVYVRKEPGLPSWDDIRNRNSKENFFLPVVACDFSSVSLSGQPCHPSCK-------NFCWGSGPQYCQTFTSTICAKQCDGRC-----YGLDPNQCCHKHCASGCTGPRETDC 221          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005822.1 (pep scaffold:Pmarinus_7.0:GL476959:64997:68848:-1 gene:ENSPMAG00000005273.1 transcript:ENSPMAT00000005822.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 178.333 bits (451), Expect = 3.431e-51
Identity = 84/170 (49.41%), Postives = 117/170 (68.82%), Query Frame = 2
Query: 3137 GMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSP 3643
            GM YL  R ++HRDLAARNVLV     V+ITDFGL+K+L+   + E   + GK+PI+WLA+E++    ++H++DVW+YGVTLWE+ TFG  PY+     DI + + KG RL+QP IC++DVY+IMV CW+     RP F+ L   F+   ++P RYL IQGD   ++PSP
Sbjct:    1 GMNYLEDRRLVHRDLAARNVLVKAPNHVKITDFGLAKLLD-LNETEYHSEGGKLPIKWLALESIQQRIFTHQSDVWSYGVTLWELMTFGGKPYDGVPARDIPELLEKGERLTQPPICTIDVYMIMVKCWMIDAESRPKFRELAAEFSKMARDPTRYLVIQGDERMKLPSP 169          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Sea Lamprey
Match: EPHB2 (EPH receptor B2 [Source:HGNC Symbol;Acc:HGNC:3393])

HSP 1 Score: 174.866 bits (442), Expect = 1.522e-44
Identity = 104/342 (30.41%), Postives = 167/342 (48.83%), Query Frame = 2
Query: 2789 LGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNE-EIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLES--TKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDPYEIPSPHSIEMTNFNNHYGEDQFNFPSMTAETMLPLLNGRDSIDRDVKDFTDNNEIDESL 3805
            +G G FG V +G+ ++P   E           + VAIK +K+   E +    + EA +M    H + +R  GV        +++ +++ GSLD FL +N  + T + ++     IA GM YL+  N +HRDLAARN+LV+     +++DFGLS+ LE+  T         GK+PIRW A E +   K++  +DVW+YG+ +WE+ ++G+ PY D    D+ + V +  RL  P  C   ++ +M++CW +S N RP F  ++ T     +NP    ++                               +T+   LPLL      DR + DFT    +DE L
Sbjct:  586 IGSGEFGEVCRGRLRMPGKRE-----------MYVAIKTLKSAYTEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIVTEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSDMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLENDPTDPTYTSGMGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNEDVINAVEQDYRLPAPMDCPAALHQLMLDCWQKSRNDRPKFGQIVSTLDKMIRNPASLKAMS-----------------------------CVTSAPSLPLL------DRTMPDFTSFASVDEWL 881          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Sea Lamprey
Match: NTRK2 (neurotrophic receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:8032])

HSP 1 Score: 164.466 bits (415), Expect = 1.964e-44
Identity = 96/292 (32.88%), Postives = 155/292 (53.08%), Query Frame = 2
Query: 2789 LGFGAFGYVYKGKWK-IPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFL-IRNKNKI-------------TSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQG 3619
            LG GAFG VY  +   +   +E +L          VA K +K++ +   +   +EA+++ ++ H H +RF GVC+  E   ++  Y+K G L+KFL +R  + +             +   ML+   QIA GM YL  ++ +HRDLA RN LV     V+I DFG+S+ + ST    +   T  +PIRW+  E++   K++ ++DVW+ GV LWEIFT+GK P+   +  ++ D + +G  L +P  C ++VY +M+ CW   P  R   ++++       K    YL I G
Sbjct:   82 LGEGAFGKVYLAECSSLDVGQEPML----------VAAKTLKDLSDGARKDFYREAELLTNLQHEHIVRFYGVCVEGEPLIMVFEYMKNGDLNKFLRLRGPDAVFMGDAPQAEPRLLSQAQMLNMGSQIAAGMAYLASQHFVHRDLATRNCLVGAGLVVKIGDFGMSRDVYSTDYYRVGGHT-MLPIRWMPPESIMYRKFTADSDVWSLGVVLWEIFTYGKQPWYQLSNTEVIDCICQGRVLERPRSCPMEVYELMLGCWHREPQHRLGIKDILARLESLAKMSPVYLDILG 362          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Yeast
Match: KIN1 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN1 has a paralog, KIN2, that arose from the whole genome duplication [Source:SGD;Acc:S000002529])

HSP 1 Score: 88.5817 bits (218), Expect = 5.489e-18
Identity = 71/282 (25.18%), Postives = 131/282 (46.45%), Query Frame = 2
Query: 2837 PKNEETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSH-ETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQ---TFTDYCKNPGRYLSIQGDPYEIPSPHSIEMTNFN 3670
            PKNE+ +L++           K+ K +  ++    ++EA +   + H H  R   +C       ++  YV  G L  ++I++   I       ++  IA  ++YL   NI+HRDL   N+++S    ++I DFGLS + +S K       +    + + A E L    Y+  E DVW++GV L+ +   GKVP++D+ +  +    +K G++  P   S++V  ++    +  P  R   + +++       +   P  YL     P  +P   +IEM + N
Sbjct:  168 PKNEQDVLERQK---------KLEKEISRDK--RTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYIIQH-GSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNIYDSRKQLHTFCGS----LYFAAPELLKANPYTGPEVDVWSFGVVLF-VLVCGKVPFDDENS-SVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVDPKRRATLKQVVEHHWMVRGFNGPPPSYL-----PKRVPL--TIEMLDIN 424          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 86.2705 bits (212), Expect = 2.205e-17
Identity = 53/197 (26.90%), Postives = 98/197 (49.75%), Query Frame = 2
Query: 2900 KVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICS 3490
            K  +N+  + ++++  E  ++  + H + + + G         +   YV  GS+   L  N       ++ +++ QI  G+ YL K+NIIHRD+   N+L+    CV+ITDFG+SK L     K+    + +  + W++ E +     + + D+W+ G  + E+FT GK P+ D +       + K G  + P+I S
Sbjct:  488 KTNQNIHRKMVDALQHEMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSML-NNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFT-GKHPFPDFSQ---MQAIFKIGTNTTPEIPS 679          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 83.5741 bits (205), Expect = 1.540e-16
Identity = 66/261 (25.29%), Postives = 127/261 (48.66%), Query Frame = 2
Query: 2789 LGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIG-VCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQ 3568
            +G G++G VYK    I K+ + +           VAIK +    +EE+  +M E  ++ +++H + +++ G +  SYE   L+  Y   GSL + + R+   ++     ++  Q   G+ YL    +IHRD+ A N+L+S    V++ DFG+S ++ S+        T    + W+A E L +   S  +D+W+ G T+ E+ T    PY +    +I+ + ++      P   S  +   +  C++++   RP    L++
Sbjct:   31 IGRGSYGVVYKA---INKHTDQV-----------VAIKEVVYENDEELNDIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLE-YCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSA------LTLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLT-KNPPYHNLTDANIY-YAVENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLK 268          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Yeast
Match: KIN2 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN2 has a paralog, KIN1, that arose from the whole genome duplication [Source:SGD;Acc:S000004086])

HSP 1 Score: 83.1889 bits (204), Expect = 2.196e-16
Identity = 53/211 (25.12%), Postives = 102/211 (48.34%), Query Frame = 2
Query: 2939 VMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSH-ETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQ 3568
             ++EA +   + H H  R   +C       ++  YV  G L  ++I++   +       ++  IA  + YL   NI+HRDL   N+++S    ++I DFGLS + +  K       +    + + A E L    Y+  E D+W++G+ L+ +   GKVP++D+ +  I    +K G++  P   S++V  ++    +  P  R   +N+++
Sbjct:  170 TVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYIIQH-GSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDYRKQLHTFCGS----LYFAAPELLKAQPYTGPEVDIWSFGIVLY-VLVCGKVPFDDENS-SILHEKIKKGKVDYPSHLSIEVISLLTRMIVVDPLRRATLKNVVE 373          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 80.8777 bits (198), Expect = 1.143e-15
Identity = 65/228 (28.51%), Postives = 107/228 (46.93%), Query Frame = 2
Query: 2789 LGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIK-NMGNEEIESVMQEAKMMASVSHM-HCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNK--NKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGK-YSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLK 3457
            +G G FG VYKG               +G  Y   AIKV+  +  ++E+E V +E + +AS+  + +  R+ G  L      +I  +   GSL   L   K   K   +IM     ++   +  + K N+IHRD+ A NVL++    V++ DFG++  +  T  +    +T      W+A E + +G  Y  + D+W+ G+T +EI T G  PY D         ++K
Sbjct:   29 IGRGKFGVVYKG-----------YNVKTGRVY---AIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRPGKIDEKYIGVIM----RELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRR---QTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIAT-GNPPYCDVEALRAMQLIIK 234          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Nematostella
Match: EDO47094 (Predicted protein; Vascular endothelial growth factor receptor-like protein [Source:UniProtKB/TrEMBL;Acc:A7RN88])

HSP 1 Score: 166.392 bits (420), Expect = 1.607e-45
Identity = 102/284 (35.92%), Postives = 159/284 (55.99%), Query Frame = 2
Query: 2789 LGFGAFGYVYKGKWK--IPKNEETLLKKASGDFYLPVAIKVIKNMGNE-EIESVMQEAKMMASV-SHMHCLRFIGVCLSYEKPCL--ISAYVKEGSLDKFLIRNKN---------------KITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKT-GKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTF 3574
            LG GAFG VY G+ +  I     + +        + VAIK +K    E E + ++ E K++  V SH + +  +G C    +  L  I  +   G L  +L + ++               + T + ++S + Q+A GM +L  R  IHRDLAARNVL++    +++ DFGL++  +  K++E +  T G VPI+W+AIE+LTD  YS ++DVW+YGV LWEIFT G  PY D    D+F+++L G R+ +P  C+ ++Y IM +CW+ SP  RP F  L++  
Sbjct:   22 LGSGAFGQVYLGETEGGIDYRRPSAISMRGN---IKVAIKTLKGGATESEQKDLLSELKILIHVGSHKNIVNLLGACTKGPQRDLWIILEFCANGDLLSYLKKKRDIYDPAWCAPSEDHDVQFTQMELVSAAYQVARGMEFLASRRCIHRDLAARNVLIADDYVLKVADFGLAR--DVYKNEEYVKHTPGLVPIKWIAIESLTDKIYSQKSDVWSYGVLLWEIFTLGGNPYPDLHPSDVFEYLLDGKRMEKPVDCAQEIYNIMTDCWVLSPEDRPTFTELVKKL 300          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Nematostella
Match: EDO33736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD7])

HSP 1 Score: 169.088 bits (427), Expect = 1.867e-45
Identity = 101/296 (34.12%), Postives = 162/296 (54.73%), Query Frame = 2
Query: 2729 MGRLMIVSKEDLIFEDESK---PLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIK-NMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLEST---KDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNP 3595
            M  LM V+KE  I +D+ K    +G G F  VY+G   +  NE+   +K        VA+K++K    ++  E    EA +M    H + +   GV        +I+ +++ GSLD FL  N  ++T+L ++     +A GM YL++ N IHRDLAARN+LVS     +++DFGLS+ L+ +   +  E   + GK+P+RW A E +   K+S  +DVW+YG+ LWEI +FG+ PY       + D V  G RL  P  C   ++ +M++CW +    RP F ++++ F +  ++P
Sbjct:   12 MEALMSVAKE--INKDDLKLEIIIGGGEFADVYRG---VLTNEDKTQEK--------VAVKILKPGSSHKNREDFCVEASIMGQFDHPNVIALKGVITRTRPMMIITEFLENGSLDNFLKSNDGRLTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAPMKCPKVIHNLMLDCWDKEKTSRPKFADIVRRFDEVIRSP 294          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Nematostella
Match: EDO40994 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5K8])

HSP 1 Score: 169.474 bits (428), Expect = 2.021e-45
Identity = 106/333 (31.83%), Postives = 165/333 (49.55%), Query Frame = 2
Query: 2783 KPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIES-VMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLS----IQGDP----YEIPSPH----SIEMTNFNNHYGEDQFNFPSMTAETMLPLLNG 3742
            K +G G FG VYKG  K P           G+  +PVAIK +K     +     + EA +M      + +   GV        +++ ++  GSLD FL +  +K++ + ++  +  IA GM YL++ N +HRDLAARN+LV+     ++ DFGLS+ LE   D       GK+P+RW A E +   K+S  +DVW+YG+ LWE F+F + PY D +  ++ D V  G RL  P  C   ++ IM+ CW      RP F  +++      ++P +       IQ  P     EI +      SI+M  +  H+ +  +      AE+  P L+G
Sbjct:   62 KVIGGGEFGDVYKGTLKRP-----------GENTIPVAIKTLKQGSTSKNRGDFLSEASVMGQFCDPNVIFLEGVVSKTHPLMIVTEFMSNGSLDNFLKKMDSKLSLIQLMGMARGIASGMKYLSEMNFVHRDLAARNILVTETLVCKVADFGLSRELE---DSAYETSGGKIPVRWTAPEAIKYRKFSTSSDVWSYGILLWETFSFAERPYWDWSNFEVMDRVETGYRLPPPMSCPKVIHQIMLECWDADRTKRPSFALIVKQLDSLIRSPEKLKDNQSVIQSKPNIDYSEITTVEEWLGSIKMGQYTEHFKQAGYRDLQTIAESEEPDLDG 380          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Nematostella
Match: EDO35594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL46])

HSP 1 Score: 164.081 bits (414), Expect = 2.285e-45
Identity = 93/252 (36.90%), Postives = 141/252 (55.95%), Query Frame = 2
Query: 2903 VIKNMGNEEIESVMQEAKMMASV-SHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNK------------ITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKML--ESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSI 3613
            ++   G E+ E  ++E  +M  + SH + + F+      E   L+  ++ +G L  +L RN++K            IT   +LS+S QIA GM YL+K+  +HRDLAARNVLV+  + V++ DFGL++ L  ES           K+PI+W++ E + D  ++ E+DVW+YGV LWEI T G  PY   +T D+F  +  G R+ +PDICS +VY IM +CW + P  RP F +L   F    +    YL +
Sbjct:    2 LVDTAGPEQGEEFLKEISLMKKLGSHKNIVNFLCCSTVKEPFMLVVEFLPKGDLLDYLRRNRSKQNDETGEQEDEMITPQDLLSFSYQIAAGMEYLSKKGFVHRDLAARNVLVADNKQVKVADFGLTRDLYEESAYQGH---SNRKLPIKWMSPEAIYDQIFTTESDVWSYGVVLWEIATLGGAPYPTISTRDVFVMLRSGYRMEKPDICSDEVYTIMKHCWEDQPKKRPTFSDLRMKFEYMLEADNPYLDL 250          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Nematostella
Match: EDO49126 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGW8])

HSP 1 Score: 163.31 bits (412), Expect = 4.513e-44
Identity = 95/279 (34.05%), Postives = 154/279 (55.20%), Query Frame = 2
Query: 2789 LGFGAFGYVYK----GKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGN-EEIESVMQEAKMMASVS-HMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFL--IRNK-------------NKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNL 3562
            +G GAFG V K    G    P+N+ET+           VA+K +  M   E+  + + E +MM  +  H++ +  +G      + CLI+ Y   G L  +L  IR+K              ++T   +LS++ QIA GM YL+++  +HRDLAARN+L+     V+I+DFGL++ +  + +   +  TGK+P++W+A E +    ++ ++DVWA+GV LWEI T G  PY  Q+  + +  +  G R+ +PD+CS ++Y +M +CW  SP  RP F  L
Sbjct:   24 VGSGAFGKVTKATIVGLPGGPENKETV-----------VAVKKLNAMATMEDRRNFLSEIEMMKQLGKHLNIVSILGCVTHAGQLCLITEYCPYGDLRNYLRAIRDKVSTRDSLAGRAPGRELTQNDLLSFARQIAVGMEYLSQKMFVHRDLAARNILICEDNLVKISDFGLTRDVYESSEYHKMHNTGKLPLKWMAPEAIFQNVHTTKSDVWAFGVVLWEIVTLGGSPYPGQSGKEFYKKLKNGYRMEKPDMCSPELYAMMRSCWASSPEDRPTFTKL 291          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Medaka
Match: erbb4b (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:101165111])

HSP 1 Score: 260.766 bits (665), Expect = 3.158e-70
Identity = 191/595 (32.10%), Postives = 294/595 (49.41%), Query Frame = 2
Query: 1910 KNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTC--HEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSK-------CKGKSPKNDECEVCKGVWHKNTCRLRCPRD----ESYGTKIIDSISYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSPH 3646
            +N   PL  ++  + C P CS+ +    +GP        C  C+     R     SC+K+C  ++G         +I  +    G  C+ C   C +       C G  P  + C  C        C  +CP       S+  K  ++ + C  CH +C +GC G  + +C        ++D+          PL +   I  G   +V ++L  + +   +  +                          K++A+   +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W IP+ E            +PVAIK++ +  G +     M EA +MAS+ H H +R +GVCLS     L++  +  G L  ++  +K+ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     V+ITDFGL+++L+   +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+  +T DI D + KG RL QP IC++DVY++MV CW+   + RP F+ L   FT   ++P RYL IQGD   ++PSP+
Sbjct:  445 RNNRNPLECARGHMVCDPLCSD-DGCWGSGPDQ------CLSCKFFSRGR-----SCIKSCNLYQG---------EIREY--ANGSVCVECDSQCEQGDDNTLTCHGSGP--EHCVKCLHFKDGPNCVEKCPDGLQGASSFIFKYAEANNECHPCHPNCTQGCIGPRLQDCIG------WMDRT---------PLIAAGVI-GGLFMVVIMALSVAVSVRRKNIK--------------------------KKRALRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRIKILGSGAFGTVYKGIW-IPEGETV---------KIPVAIKILNETTGPKANVEFMDEALIMASMEHPHLVRLLGVCLS-PTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLD-VNEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGISTRDIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFTRMARDPQRYLVIQGDDRMKLPSPN 946          

HSP 2 Score: 136.732 bits (343), Expect = 7.840e-32
Identity = 158/635 (24.88%), Postives = 249/635 (39.21%), Query Frame = 2
Query:  260 KNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVV------SGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHS--IKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPAM-MLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGA--NDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLCYMN-IPVNELFKNVKNFYYI-----PSNCT--DKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKG-FYNPINSSLLSNQKCLRCHPECLN------TCVGPNPNQCIKGCKNKRENGTCVASC-------SKNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERI 2047
            +NC  + G++ I  I     + R L F  SI E+ G++++  N  + +  +NLRIIRG    +          +SL +       GN  L  L   +L  I    V  D N   K+L H+  I W ++  +P    +  PT +   +   KC   C          CWGP  NQCQ   +T+C  +    C+   Y++     CC+ +C GGC G   + C AC N  +   CV  C  P  Y+        N   RY  G FC K+CP    +   T    +  +    +K  +C K  GN+         +F I G       N   L  + L   ++ ++I GY+ +        N+T  +++ NL  +    GG + +                                    + +  +    L+SLKEI+ G     +N++LCY N +    LF++      +     P  C     +C   CS+ GCWG G   C  C+ +    +C+  C+  +G      N S+     C+ C  +C        TC G  P  C+K C + ++   CV  C       S   +     +  C PCHPNC++     C GP     IG  ++   I
Sbjct:   50 ENCEVVMGNLEITSI----DRSRNLTFLRSIREVTGYVLVALNQFDHLPLENLRIIRGTKLYEDR--------YSLAIFLNYRRDGNFGLRHLGLINLAEILYGGVYVDQN---KFLCHADTIHWQDIVKNPGFHPVVVPTNSS--VTCPKCHRSC-------NGRCWGPKDNQCQSLTKTVCAEQCDGRCSG-PYVSD----CCHRECAGGCFGPKDTDCFACTNFNDSGACVTQCPQPFFYNPTTFQLEHNPSARYTYGAFCVKKCPPCDGIGTGTLQAAQTVDSSNIDKFVNCTKINGNL---------VFLITGIKGDVYHNIEALDPEKLNVFRSVREITGYLNIQS---WPDNMTDLIVFSNLATI----GGRALYS-----------------------------GISLLVLKQQGISSFLLQSLKEISAGNVHIAENKQLCYYNTVNWTRLFRSPNQKVLVRNNRNPLECARGHMVCDPLCSDDGCWGSGPDQCLSCKFFSRGRSCIKSCNLYQGEIREYANGSV-----CVECDSQCEQGDDNTLTCHGSGPEHCVK-CLHFKDGPNCVEKCPDGLQGASSFIFKYAEANNECHPCHPNCTQG----CIGPRLQDCIGWMDRTPLI 600          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Medaka
Match: erbb4b (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:101165111])

HSP 1 Score: 260.381 bits (664), Expect = 4.670e-70
Identity = 191/594 (32.15%), Postives = 293/594 (49.33%), Query Frame = 2
Query: 1910 KNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTC--HEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSK-------CKGKSPKNDECEVCKGVWHKNTCRLRCPRD----ESYGTKIIDSISYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSP 3643
            +N   PL  ++  + C P CS+ +    +GP        C  C+     R     SC+K+C  ++G         +I  +    G  C+ C   C +       C G  P  + C  C        C  +CP       S+  K  ++ + C  CH +C +GC G  + +C        ++D+          PL +   I  G   +V ++L  + +   +  +                          K++A+   +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W IP+ E            +PVAIK++ +  G +     M EA +MAS+ H H +R +GVCLS     L++  +  G L  ++  +K+ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     V+ITDFGL+++L+   +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+  +T DI D + KG RL QP IC++DVY++MV CW+   + RP F+ L   FT   ++P RYL IQGD   ++PSP
Sbjct:  483 RNNRNPLECARGHMVCDPLCSD-DGCWGSGPDQ------CLSCKFFSRGR-----SCIKSCNLYQG---------EIREY--ANGSVCVECDSQCEQGDDNTLTCHGSGP--EHCVKCLHFKDGPNCVEKCPDGLQGASSFIFKYAEANNECHPCHPNCTQGCIGPRLQDCIG------WMDRT---------PLIAAGVI-GGLFMVVIMALSVAVSVRRKNIK--------------------------KKRALRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRIKILGSGAFGTVYKGIW-IPEGETV---------KIPVAIKILNETTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLD-VNEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGISTRDIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFTRMARDPQRYLVIQGDDRMKLPSP 983          

HSP 2 Score: 152.91 bits (385), Expect = 1.054e-36
Identity = 171/644 (26.55%), Postives = 262/644 (40.68%), Query Frame = 2
Query:  260 KNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVV------SGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHS--IKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNH---CIKCYGNMCTN--DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSF---VKHNITVEMLYENLNKLQELEGGFSYFK----DNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLCYMN-IPVNELFKNVKNFYYI-----PSNCT--DKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKG-FYNPINSSLLSNQKCLRCHPECLN------TCVGPNPNQCIKGCKNKRENGTCVASC-------SKNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERI 2047
            +NC  + G++ I  I     + R L F  SI E+ G++++  N  + +  +NLRIIRG    +          +SL +       GN  L  L   +L  I    V  D N   K+L H+  I W ++  +P    +  PT +   +   KC   C          CWGP  NQCQ   +T+C  +    C+   Y++     CC+ +C GGC G   + C AC N  +   CV  C  P  Y+        N   RY  G FC K+CP   + ++  CV  C     + + NH   CI C  ++C    D +     + A   D +N        + +  NC KI G +V         V HNI   +  E LN  + +     Y       +++ +L    NL       L+S I  L       + +  +    L+SLKEI+ G     +N++LCY N +    LF++      +     P  C     +C   CS+ GCWG G   C  C+ +    +C+  C+  +G      N S+     C+ C  +C        TC G  P  C+K C + ++   CV  C       S   +     +  C PCHPNC++     C GP     IG  ++   I
Sbjct:   50 ENCEVVMGNLEITSI----DRSRNLTFLRSIREVTGYVLVALNQFDHLPLENLRIIRGTKLYEDR--------YSLAIFLNYRRDGNFGLRHLGLINLAEILYGGVYVDQN---KFLCHADTIHWQDIVKNPGFHPVVVPTNSS--VTCPKCHRSC-------NGRCWGPKDNQCQSLTKTVCAEQCDGRCSG-PYVSD----CCHRECAGGCFGPKDTDCFACTNFNDSGACVTQCPQPFFYNPTTFQLEHNPSARYTYGAFCVKKCPHNFVVDHNSCVRACPTNKMEVEDNHIKMCIPCT-DICPKACDGIGTGTLQAAQTVDSSN--------IDKFVNCTKINGNLVFLITGIKGDVYHNIEA-LDPEKLNVFRSVREITGYLNIQSWPDNMTDLIVFSNLATIGGRALYSGISLL------VLKQQGISSFLLQSLKEISAGNVHIAENKQLCYYNTVNWTRLFRSPNQKVLVRNNRNPLECARGHMVCDPLCSDDGCWGSGPDQCLSCKFFSRGRSCIKSCNLYQGEIREYANGSV-----CVECDSQCEQGDDNTLTCHGSGPEHCVK-CLHFKDGPNCVEKCPDGLQGASSFIFKYAEANNECHPCHPNCTQG----CIGPRLQDCIGWMDRTPLI 638          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Medaka
Match: erbb4b (erb-b2 receptor tyrosine kinase 4 [Source:NCBI gene;Acc:101165111])

HSP 1 Score: 260.381 bits (664), Expect = 5.930e-70
Identity = 191/595 (32.10%), Postives = 294/595 (49.41%), Query Frame = 2
Query: 1910 KNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTC--HEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSK-------CKGKSPKNDECEVCKGVWHKNTCRLRCPRD----ESYGTKIIDSISYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSPH 3646
            +N   PL  ++  + C P CS+ +    +GP        C  C+     R     SC+K+C  ++G         +I  +    G  C+ C   C +       C G  P  + C  C        C  +CP       S+  K  ++ + C  CH +C +GC G  + +C        ++D+          PL +   I  G   +V ++L  + +   +  +                          K++A+   +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W IP+ E            +PVAIK++ +  G +     M EA +MAS+ H H +R +GVCLS     L++  +  G L  ++  +K+ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     V+ITDFGL+++L+   +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+  +T DI D + KG RL QP IC++DVY++MV CW+   + RP F+ L   FT   ++P RYL IQGD   ++PSP+
Sbjct:  483 RNNRNPLECARGHMVCDPLCSD-DGCWGSGPDQ------CLSCKFFSRGR-----SCIKSCNLYQG---------EIREY--ANGSVCVECDSQCEQGDDNTLTCHGSGP--EHCVKCLHFKDGPNCVEKCPDGLQGASSFIFKYAEANNECHPCHPNCTQGCIGPRLQDCIG------WMDRT---------PLIAAGVI-GGLFMVVIMALSVAVSVRRKNIK--------------------------KKRALRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRIKILGSGAFGTVYKGIW-IPEGETV---------KIPVAIKILNETTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLD-VNEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGISTRDIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFTRMARDPQRYLVIQGDDRMKLPSPN 984          

HSP 2 Score: 152.91 bits (385), Expect = 1.092e-36
Identity = 168/629 (26.71%), Postives = 257/629 (40.86%), Query Frame = 2
Query:  260 KNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVV------SGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHS--IKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNH---CIKCYGNMCTN--DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSF---VKHNITVEMLYENLNKLQELEGGFSYFK----DNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLCYMN-IPVNELFKNVKNFYYI-----PSNCT--DKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKG-FYNPINSSLLSNQKCLRCHPECLN------TCVGPNPNQCIKGCKNKRENGTCVASC-------SKNFYPPLNDSKACLPCHPNCSEYNSTICTGP 2002
            +NC  + G++ I  I     + R L F  SI E+ G++++  N  + +  +NLRIIRG    +          +SL +       GN  L  L   +L  I    V  D N   K+L H+  I W ++  +P    +  PT +   +   KC   C          CWGP  NQCQ   +T+C  +    C+   Y++     CC+ +C GGC G   + C AC N  +   CV  C  P  Y+        N   RY  G FC K+CP   + ++  CV  C     + + NH   CI C  ++C    D +     + A   D +N        + +  NC KI G +V         V HNI   +  E LN  + +     Y       +++ +L    NL       L+S I  L       + +  +    L+SLKEI+ G     +N++LCY N +    LF++      +     P  C     +C   CS+ GCWG G   C  C+ +    +C+  C+  +G      N S+     C+ C  +C        TC G  P  C+K C + ++   CV  C       S   +     +  C PCHPNC++     C GP
Sbjct:   50 ENCEVVMGNLEITSI----DRSRNLTFLRSIREVTGYVLVALNQFDHLPLENLRIIRGTKLYEDR--------YSLAIFLNYRRDGNFGLRHLGLINLAEILYGGVYVDQN---KFLCHADTIHWQDIVKNPGFHPVVVPTNSS--VTCPKCHRSC-------NGRCWGPKDNQCQSLTKTVCAEQCDGRCSG-PYVSD----CCHRECAGGCFGPKDTDCFACTNFNDSGACVTQCPQPFFYNPTTFQLEHNPSARYTYGAFCVKKCPHNFVVDHNSCVRACPTNKMEVEDNHIKMCIPCT-DICPKACDGIGTGTLQAAQTVDSSN--------IDKFVNCTKINGNLVFLITGIKGDVYHNIEA-LDPEKLNVFRSVREITGYLNIQSWPDNMTDLIVFSNLATIGGRALYSGISLL------VLKQQGISSFLLQSLKEISAGNVHIAENKQLCYYNTVNWTRLFRSPNQKVLVRNNRNPLECARGHMVCDPLCSDDGCWGSGPDQCLSCKFFSRGRSCIKSCNLYQGEIREYANGSV-----CVECDSQCEQGDDNTLTCHGSGPEHCVK-CLHFKDGPNCVEKCPDGLQGASSFIFKYAEANNECHPCHPNCTQG----CIGP 623          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Medaka
Match: erbb4a (receptor tyrosine-protein kinase erbB-4 [Source:NCBI gene;Acc:101165379])

HSP 1 Score: 258.84 bits (660), Expect = 1.474e-69
Identity = 174/511 (34.05%), Postives = 260/511 (50.88%), Query Frame = 2
Query: 2156 GFTCLPCPELCSK-------CKGKSPKNDECEVCKGVWHKNTCRLRCPRD----ESYGTKIIDSISYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSPH 3646
            G  CL C   C K       C G+ P  D+C  C        C  +CP       S+  K   + + C  CH +C +GC G  I +C    ++                PL +   I  G   IV ++L  +     ++ +                          K++A+   +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ +  G +     M EA +MASV H H +R +GVCLS     L++  +  G L  ++  +K+ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     ++ITDFGL+++L++  +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T +I D + KG RL QP IC++DVY++MV CW+   + RP F+ L   F    ++P RYL IQGD   ++PSP+
Sbjct:  492 GSVCLECDSQCEKMDGNSLTCLGQGP--DQCVKCLNFKDGPNCVEKCPDGLQGANSFIFKYAKANNECHPCHVNCTQGCIGPRIQDCVGMMDRT---------------PLIAAGII-GGLFIIVIVALTVAIYARRKSIK--------------------------KKRALRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRVKILGSGAFGTVYKGIW-VPEGETV---------KIPVAIKILNEATGPKANVEFMDEALIMASVEHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLDA-DEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFCRMARDPQRYLVIQGDDRMKLPSPN 932          

HSP 2 Score: 161.77 bits (408), Expect = 1.910e-39
Identity = 159/616 (25.81%), Postives = 252/616 (40.91%), Query Frame = 2
Query:  296 LGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVS----GNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHS--IKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYF---KNKSNHCIKCYGNMCTN--DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLY-------ENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLCYMN-IPVNELFKNVKNFYYI-----PSNCTDK--ICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLN------TCVGPNPNQCIKGCKNKRENGTCVASCSKNF---------YPPLNDSKACLPCHPNCSEYNSTICTGP 2002
            L IT ++ + R L+F  SI E+ G++++  N  E +  +NLRIIRG        + +G    ++ ++    GN  L  L  RSL  I    V  D N   K+L H+  I W ++  +P+A++L  P+        +  ++ C+         CWG   +QCQ   +T+C  +    C    Y++     CC+ +C GGC G   + C AC N  +   CV  C  P  Y+        N   +Y  G FC ++CP   + +++ CV  C        +N+   CI C  ++C    D +     + A   D +N        + +  NC KI G ++     F+   I  +M +       E LN  + ++    +             ++           + +        + +  +     +SL EI+ G    F N +LC+ N I    LF+       I     P  C  +  IC + CSE GCWGPG   C  CR +    TCV  C+     +N       +   CL C  +C        TC+G  P+QC+K C N ++   CV  C             Y   N+   C PCH NC++     C GP
Sbjct:    4 LEITSID-RNRNLSFLKSIREVTGYVLVALNQFEYLPLENLRIIRGTT------LYEGRYALAIFLNYRRDGNYGLKQLGLRSLTEILNGGVYVDQN---KFLCHADTIHWQDVIKNPQAELLVVPS--------NNSNNGCRRCHRSCNGRCWGHQEDQCQTLTKTVCAEQCDGRCFG-PYVSD----CCHRECAGGCFGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTSFQLEHNPRAKYTYGAFCVRECPHNFVVDHSSCVRACPSNKMEVEENRIKMCIPCT-DICPKVCDGIGTGSLQTAQTVDASN--------IDKFVNCTKINGNLI-----FLITGIKGDMYHGIGPLDPERLNVFRTVKEITGFLNIQSWPENMTDLSVFSNLVTIGGRSLYSGSGISLLILKQRRISSFQFQSLNEISAGNVYIFNNSRLCFYNTINWTSLFRTPSQKVLIRNNREPMECLQQQMICDRMCSEDGCWGPGPDQCLSCRYFKRGRTCVESCN----LFNGEVREFANGSVCLECDSQCEKMDGNSLTCLGQGPDQCVK-CLNFKDGPNCVEKCPDGLQGANSFIFKYAKANNE--CHPCHVNCTQG----CIGP 571          

HSP 3 Score: 60.8474 bits (146), Expect = 1.206e-8
Identity = 78/289 (26.99%), Postives = 119/289 (41.18%), Query Frame = 2
Query:  167 PGTIICQN--DNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYIL----------GITKLESKERELNFDSIEEIDGHLIIEG---NDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDK--CSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECT-TCRYINGEEQGC--------CNDQC--LGG----CNGGGASKCTACKNMLNEKKCVELC 937
            P T IC    D +   SL ++ + +   +I +  NCT I G++  L          GI  L+  ER   F +++EI G L I+    N  +   F NL  I G     R+L     +  SL++     +    F+SL  I+A NV   +N ++ +  ++I W  LF  P  ++L          L+ +  C   C      ++  CWGP  +QC        K    C  +C   NGE +          C+ QC  + G    C G G  +C  C N  +   CVE C
Sbjct:  266 PCTDICPKVCDGIGTGSLQTA-QTVDASNIDKFVNCTKINGNLIFLITGIKGDMYHGIGPLDP-ERLNVFRTVKEITGFLNIQSWPENMTDLSVFSNLVTIGG-----RSLYSG--SGISLLILKQRRISSFQFQSLNEISAGNVYIFNNSRLCFY-NTINWTSLFRTPSQKVLIRNNREPMECLQQQMICDRMC------SEDGCWGPGPDQCLSCRY--FKRGRTCVESCNLFNGEVREFANGSVCLECDSQCEKMDGNSLTCLGQGPDQCVKCLNFKDGPNCVEKC 536          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Medaka
Match: erbb4a (receptor tyrosine-protein kinase erbB-4 [Source:NCBI gene;Acc:101165379])

HSP 1 Score: 258.455 bits (659), Expect = 2.878e-69
Identity = 174/511 (34.05%), Postives = 260/511 (50.88%), Query Frame = 2
Query: 2156 GFTCLPCPELCSK-------CKGKSPKNDECEVCKGVWHKNTCRLRCPRD----ESYGTKIIDSISYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVI-KNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDP-YEIPSPH 3646
            G  CL C   C K       C G+ P  D+C  C        C  +CP       S+  K   + + C  CH +C +GC G  I +C    ++                PL +   I  G   IV ++L  +     ++ +                          K++A+   +ETEL        EP +         PN  +L I+ + +L      K LG GAFG VYKG W +P+ E            +PVAIK++ +  G +     M EA +MASV H H +R +GVCLS     L++  +  G L  ++  +K+ I S ++L+W  QIA GM+YL +R ++HRDLAARNVLV     ++ITDFGL+++L++  +KE     GK+PI+W+A+E +   K++H++DVW+YGVT+WE+ TFG  PY+   T +I D + KG RL QP IC++DVY++MV CW+   + RP F+ L   F    ++P RYL IQGD   ++PSP+
Sbjct:  641 GSVCLECDSQCEKMDGNSLTCLGQGP--DQCVKCLNFKDGPNCVEKCPDGLQGANSFIFKYAKANNECHPCHVNCTQGCIGPRIQDCVGMMDRT---------------PLIAAGII-GGLFIIVIVALTVAIYARRKSIK--------------------------KKRALRRFLETEL-------VEPLTPS----GTAPNQAQLRILKETEL---KRVKILGSGAFGTVYKGIW-VPEGETV---------KIPVAIKILNEATGPKANVEFMDEALIMASVEHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLDA-DEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFCRMARDPQRYLVIQGDDRMKLPSPN 1081          

HSP 2 Score: 166.777 bits (421), Expect = 6.911e-41
Identity = 166/655 (25.34%), Postives = 268/655 (40.92%), Query Frame = 2
Query:  179 ICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVS----GNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHS--IKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQ--QTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGP--YSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYF---KNKSNHCIKCYGNMCTN--DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLY-------ENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEIN-GPFRFFKNQKLCYMN-IPVNELFKNVKNFYYI-----PSNCTDK--ICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLN------TCVGPNPNQCIKGCKNKRENGTCVASCSKNF---------YPPLNDSKACLPCHPNCSEYNSTICTGP 2002
            +C   + ++ +L    ++ + L  +  +NC  + G++ I  I     + R L+F  SI E+ G++++  N  E +  +NLRIIRG        + +G    ++ ++    GN  L  L  RSL  I    V  D N   K+L H+  I W ++  +P+A++L  P+   +   R +C   C          CWG   +QCQ   +T+C  +    C    Y++     CC+ +C GGC G   + C AC N  +   CV  C  P  Y+        N   +Y  G FC ++CP   + +++ CV  C        +N+   CI C  ++C    D +     + A   D +N        + +  NC KI G ++     F+   I  +M +       E LN  + ++    +             ++           + +        + +  +     +SL EI+ G    F N +LC+ N I    LF+       I     P  C  +  IC + CSE GCWGPG   C  CR +    TCV  C+     +N       +   CL C  +C        TC+G  P+QC+K C N ++   CV  C             Y   N+   C PCH NC++     C GP
Sbjct:  118 VCPGTDNKLSTLSDLDQQYRTLRKLY-ENCEVVMGNLEITSI----DRNRNLSFLKSIREVTGYVLVALNQFEYLPLENLRIIRGTT------LYEGRYALAIFLNYRRDGNYGLKQLGLRSLTEILNGGVYVDQN---KFLCHADTIHWQDVIKNPQAELLVVPSNNSNNGCR-RCHRSC-------NGRCWGHQEDQCQTLTKTVCAEQCDGRCFG-PYVSD----CCHRECAGGCFGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTSFQLEHNPRAKYTYGAFCVRECPHNFVVDHSSCVRACPSNKMEVEENRIKMCIPCT-DICPKVCDGIGTGSLQTAQTVDASN--------IDKFVNCTKINGNLI-----FLITGIKGDMYHGIGPLDPERLNVFRTVKEITGFLNIQSWPENMTDLSVFSNLVTIGGRSLYSGSGISLLILKQRRISSFQFQSLNEISAGNVYIFNNSRLCFYNTINWTSLFRTPSQKVLIRNNREPMECLQQQMICDRMCSEDGCWGPGPDQCLSCRYFKRGRTCVESCN----LFNGEVREFANGSVCLECDSQCEKMDGNSLTCLGQGPDQCVK-CLNFKDGPNCVEKCPDGLQGANSFIFKYAKANNE--CHPCHVNCTQG----CIGP 720          

HSP 3 Score: 61.2326 bits (147), Expect = 1.007e-8
Identity = 78/289 (26.99%), Postives = 119/289 (41.18%), Query Frame = 2
Query:  167 PGTIICQN--DNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYIL----------GITKLESKERELNFDSIEEIDGHLIIEG---NDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDK--CSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECT-TCRYINGEEQGC--------CNDQC--LGG----CNGGGASKCTACKNMLNEKKCVELC 937
            P T IC    D +   SL ++ + +   +I +  NCT I G++  L          GI  L+  ER   F +++EI G L I+    N  +   F NL  I G     R+L     +  SL++     +    F+SL  I+A NV   +N ++ +  ++I W  LF  P  ++L          L+ +  C   C      ++  CWGP  +QC        K    C  +C   NGE +          C+ QC  + G    C G G  +C  C N  +   CVE C
Sbjct:  415 PCTDICPKVCDGIGTGSLQTA-QTVDASNIDKFVNCTKINGNLIFLITGIKGDMYHGIGPLDP-ERLNVFRTVKEITGFLNIQSWPENMTDLSVFSNLVTIGG-----RSLYSG--SGISLLILKQRRISSFQFQSLNEISAGNVYIFNNSRLCFY-NTINWTSLFRTPSQKVLIRNNREPMECLQQQMICDRMC------SEDGCWGPGPDQCLSCRYF--KRGRTCVESCNLFNGEVREFANGSVCLECDSQCEKMDGNSLTCLGQGPDQCVKCLNFKDGPNCVEKC 685          
BLAST of Receptor protein-tyrosine kinase vs. Planmine SMEST
Match: SMESG000005947.1 (SMESG000005947.1)

HSP 1 Score: 2849.31 bits (7385), Expect = 0.000e+0
Identity = 1474/1479 (99.66%), Postives = 1478/1479 (99.93%), Query Frame = 2
Query:   86 MTHKTYXXXXXXXXXXXXNNATFEEEYPGTIICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNFDSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEINGPFRFFKNQKLCYMNIPVNELFKNVKNFYYIPSNCTDKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRCPRDESYGTKIIDSISYCKTCHSSCKGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDPYEIPSPHSIEMTNFNNHYGEDQFNFPSMTAETMLPLLNGRDSIDRDVKDFTDNNEIDESLLSSTDKEPLPTRSMNRTSNIFKLFQDNKQSXXXXXXXXXXXXXXXXXXXXXVSLASQEEPTFRNQPLITDDDPRYVADPTEKSIKMRQQLPLQSQFLQETPRFHSNISRENHTPFNNVXXXXXXXXXXXXDDYLEPNAPGPKNTSLVDTGDPEGYLEPINPSNKSSLLNQDDYVVPSLTNTPRESMLNSKPPRNSNAFKQSKQYISMDDGNPHFSNSIDDDDGYLEPEPKSRLLNSSNR 4522
            MTHKTYLILFLFLIQFQINNATFEEEYPGTIICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNFDSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLN+KKCVELCRGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLYENLNKLQELEGGFSYFKDNHLKNLTFLRNLLRFRAAYLHSDIPNLPSYHKFAISETELEFLGLKSLKEINGPFRFFKNQKLCYMNIPVNELFKNVKNFYYIPSNCTDKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRCP+DESYGTKIIDSISYCKTCHSSCKGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHITVGVVVTMLILVIIVIVTIVVYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWA+GVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDPYEIPSPHSIEMTNFNNHYGEDQFNFPSMTAETMLPLLNGRDSIDRDVKDFTDNNEIDESLLSSTDKEPLPTRSMNRTSNIFKLFQDNKQSQNPQNLNTRNNNTNNNNTPRLVSLASQEEPTFRNQPLITDDDPRYVADPTEKSIKMRQQLPLQSQFLQETPRFHSNISRENHTPFNN+SASQSPQISQISDDYLEPNAPGPKNTSLVDTGD EGYLEPINPSNKSSLLNQDDYVVPSLTNTPRESMLNSKPPRNSNAFKQSKQYISMDDGNPHFSNSIDDDDGYLEPEPKSRLLNSSNR
Sbjct:    1 MTHKTYLILFLFLIQFQINNATFEEEYPGTIICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNFDSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNKKKCVELCRGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLYENLNKLQELEGGFSYFKDNHLKNLTFLRNLLRFRAAYLHSDIPNLPSYHKFAISETELEFLGLKSLKEINGPFRFFKNQKLCYMNIPVNELFKNVKNFYYIPSNCTDKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYPVTGFTCLPCPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRCPKDESYGTKIIDSISYCKTCHSSCKGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHITVGVVVTMLILVIIVIVTIVVYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAFGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDPYEIPSPHSIEMTNFNNHYGEDQFNFPSMTAETMLPLLNGRDSIDRDVKDFTDNNEIDESLLSSTDKEPLPTRSMNRTSNIFKLFQDNKQSQNPQNLNTRNNNTNNNNTPRLVSLASQEEPTFRNQPLITDDDPRYVADPTEKSIKMRQQLPLQSQFLQETPRFHSNISRENHTPFNNISASQSPQISQISDDYLEPNAPGPKNTSLVDTGDSEGYLEPINPSNKSSLLNQDDYVVPSLTNTPRESMLNSKPPRNSNAFKQSKQYISMDDGNPHFSNSIDDDDGYLEPEPKSRLLNSSNR 1479          
BLAST of Receptor protein-tyrosine kinase vs. Planmine SMEST
Match: SMESG000016935.1 (SMESG000016935.1)

HSP 1 Score: 711.064 bits (1834), Expect = 0.000e+0
Identity = 442/1192 (37.08%), Postives = 641/1192 (53.78%), Query Frame = 2
Query:  140 NNATFEEEYPGTIICQNDNVQIESLHSSVEKLKIL--SIIRSKNCTHIQGSIYILGITKLES-KERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQV---FCWGPSANQCQQQTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMC---TNDHLPCNLFKIAGHTDGANDFY-LRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLYENLNKLQELEGGFSY--FKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEINGPFRFFKNQKLCYMN-IPVNELFKNVKNFYYIPSNCTDKICHKDCS---EKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLNDSKA---CLPCHPNCSEYNSTI-----CTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYP--VTGFTCLPCPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRCPRDESYGTKIIDSISYCKTCHSSCK-GCY-GSTIFNCTRCKNKKIYLD--KKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEET---KRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKD--EDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYL 3607
            N + F  +YP   IC        S  +  E  K L  ++   + CTHI G++ I  +++ ++  + +L+F +SI EI G L I  ND+++I   NL++IRG     RN  D  +   +   +G   L ++D R+LR+I + NVI   NP ++YL  ++ W+++  DP  Q L      +      KC  +C+ W     V   FC+GPS N+CQ+QT C    + +   C++    E  C + +C GGC+G  +  CT C  ++ +  CV  C  P    I G  +  + RY  G  C+ QCPA +L +N  CV++C     +   N CI+C    C   T  +  CNL  I       N  Y L  Q L+QL NC  ILG + + + SF K+ +TV MLY +L  ++E+ G FS   F+                 +   H+    +  + K+      +EFLGLK LK++ G          CY++ IP  E+          P N     C+K C       CWGPGN++CY C  Y A  +CV  CS   G++   + +     KC  CHP C   C GP P  C   C+   E  TCV +CS +F+P  N+  A   C  CH +C    + +     CTGPS++ G GGC+KCE+++ +     +    +C +G Y    ++ +IS  +   V   +C PC  +C  C G + +   C  CKG +  N C   C   ++   K+ +    C  CH  C+ GC   +    CTRC N K+++D  K KF C   CP  ++  E +   GD +CL       K EET   K+      ++      ++ +I   V+Y + +A   RI  E+KA YSN  EP+ K+  ED +++PPNM R+ ++   DL+F+  SKPLG GAFG VY+G WK+P+ +   +        L V IKVI N      +  ++EAK+MASVSH HCL  IGVCLS EKPCL+S Y + GSLDK+L +N  KI+S  ML W++QIADGM YL KR IIHRDLAARNVLV+  + +QITDFGL+++++ T D  I+IK+GKVPIRWLAIETL    YS  TDVWAYGVTLWEIFT+ K PYE+ AT +I  F+ +G RL QP+I +L+VY++M+ CWL+ P++RP F  L+ TF  + ++P R+L
Sbjct:   17 NGSNFNPDYPNFRICVVSEAH-GSFKTPAEAYKYLKYTLGLGQRCTHIYGNLPISDLSRFKNGSDPDLSFLESIIEISGSLSIINNDVKRIPLTNLKVIRGVT--LRNEPDALNIIHNHSENG-TFLEEIDLRNLRAIMSKNVIISQNPGLEYLEKNLDWSQILDDPTTQKLKVSEFVRPSNGTAKCHTECEYWTGEDGVRSQFCFGPSKNECQKQTKCVK--NKDLKWCKFTKTGEIPC-SHECAGGCDGRTSKDCTVCNKLVKDSDCVSSC-APRPNHIFGMDSKDKLRYTVGGLCTSQCPASLLDQNKICVYECDFDAHQKIGNRCIECPNGNCNSSTAGYKLCNLATIDKFYPKNNRKYSLNKQTLMQLTNCTLILGDLDIDDISFNKNGVTVPMLYHHLKNVREIIGLFSLVTFRTKISNLTFLSNLEEIRLSVKSHTVASAMNIHGKY------IEFLGLKKLKKVYGKISIGGTNGTCYLDRIPWEEIS---------PDNRVKFSCNKTCDPLCTGQCWGPGNEMCYSCAYYKAGNSCVKQCSDSPGYF--ASQTEFKTIKCQTCHPLCRQNCTGPTPKNCGGQCRYAIEENTCVKNCSIDFFPVANNVNAPITCQLCHSSCFVDKTLVGTNHACTGPSNILGTGGCSKCEKLIKTSNNQYLCHKGSCPKGFYQSVINQ-NISHLHKKIVHQSSCEPCHSMCRTCSGPTNEKRMCHQCKGYFLDNKCVKECDNMKNVTMKL-EIGDECPQCHKECRNGCLLANDSTACTRCLNHKLFVDDDKNKFSCVTRCPHDRNFTEYQ--DGDFICL-------KFEETINSKQRKTIFIILSGCFGFLVFIIGFCVLYFRWRANQTRILAEIKALYSNFKEPDMKNMKEDYITRPPNMRRMQMIPISDLVFDTSSKPLGSGAFGKVYRGYWKVPRQDNKYIN-------LEVVIKVIHNSSKGSTDEFLEEAKIMASVSHRHCLPLIGVCLSLEKPCLVSTYAQHGSLDKYLQQNSKKISSHSMLKWAKQIADGMAYLNKRGIIHRDLAARNVLVNDDDNIQITDFGLARLVDET-DDSIVIKSGKVPIRWLAIETLLSATYSPATDVWAYGVTLWEIFTYAKRPYEELATGEIKSFLQQGNRLCQPEISTLEVYMVMIKCWLDDPHMRPSFMELVSTFEQFIQSPKRFL 1164          
BLAST of Receptor protein-tyrosine kinase vs. Planmine SMEST
Match: SMESG000070834.1 (SMESG000070834.1)

HSP 1 Score: 567.385 bits (1461), Expect = 7.008e-177
Identity = 402/1175 (34.21%), Postives = 588/1175 (50.04%), Query Frame = 2
Query:  263 NCTHIQGSIYILGI-TKLESKERELNFDS-IEEIDGHLIIEGNDLEKITFKNLRIIRGANSI-KRNLIDKGHTDFSLVVSGNAHLVD-----LDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELC--RGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFY-LRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLYEN-----LNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEINGPFRFFKNQ-KLCYMNIPVNELFKNV-------------KNFYYIPSNCTDK--ICHKDC-SEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFY-NPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLND-SKACLPCHPNCSEYNST---ICTGPSSVPGIGGCNKCERILLSRKADIVSCVK-TCHEGTYAF----PNDRPDISRFYPVTGFTCL--PCPELCSKC------KGKSPKND--ECEVCKGVWHKNTCRLRCPRDESY--GTKIIDSISYCKTCHSSCKGCYGSTIFNCTRCKNKKIYLDKK--KFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKN--EETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLS 3610
            NCTH+ G+I+I  + ++    E +L F S I+EI G L I  +++  +  +NLR+IRG + +   + +      F + +  +  + +     +D RSLRSI + N+   S  +      +++WNEL  DP  Q +      +      KC  + K        FCWGP  +QCQ  + C  +  +    C      ++ CCN QCLGGC    +S C AC+ +L+   C   C  +   +   G    NK FR      C  +CP  +L +   C  +C+   ++ + + C+ C   +C      C L +I    D    ++ L    L +L NC    G++ +  +SFVKH   +  +  +     L  L+ + G  S + D                   + S +P + +     I  T + +LGLKSLK I     FFKN  KLCY +I   + FKN+              N    P  C  +  +C   C S+ GCWGPG   C  C        C  +C  + G+  NP ++S    + CL+CH EC  TC G   +QCI GCK+  EN  CV  CS+  +  LN  +K C PCH +C   + T   +CTGPS+ PG GGCNKC+ ++L R   +  C + T   G ++      N  P  +     T    +  PC +LCS+C      +    K D   C  CKG W  + C   CP+  ++    +   S+  C  CH  C GCYG    +C  C N K+  ++    F C ++CP   + +E    S + +C+ ++ S  +L         + ++  + I VII + TI+         +R   +LKA +SN  E +S+       PPNM  L+++S ++L F    + LG G FG VY GKWK+     ++     +  D  + V IKV+ +  ++     M E ++MASV H HCLR IGV     +  LIS+Y+  GS++K+L +NK  +T  I+L W+EQIA+GMLYL   +IIHRDLA RNVL+ +   VQITDFGLSK++   KD E+ I  G VP+RWLAIETL DG YSH+TDVWAY VTLWEIFTF  VPYE    H+I D ++KG RL QPDICSLD+YI+M+ CW   P  RP+F+ L   F +Y  N   YLS
Sbjct:   69 NCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLRSIVSGNIYISS--QFCSSLANVEWNELLEDPTRQSVTGKCTPQPTKCSKKCMQKGK------SGFCWGPLTSQCQIFSKCRKRMCA--NRCFLSETGDEECCNSQCLGGCTSSDSSSCIACQGVLDNNVCQPECPPKKIINRETGIPEPNKYFRPLFVNICLNKCPEGLLEQEGECKTQCTFRKYERQGDQCVPC-KILCEQ---ICTLEEIFSPNDFKYSYFSLDYPKLKKLANCTTFKGFVQIDTESFVKHRPEIVPISNSDDLKFLENLRNISG--SVYIDLKDAPFKLDSLSFLSNLQAIESLVPIIST--SLTIINTNISYLGLKSLKTIKNKAIFFKNNTKLCYFDI---KKFKNIVKTDTLNDVTIISDNGMADPKLCEQRGNVCSVQCDSQLGCWGPGPNHCISCANVRLGTICAENCLVQPGYLTNPDSTS----KVCLKCHDECAKTCSGLRSDQCIGGCKHAMENSMCVRECSRTHF--LNKITKTCEPCHKDCHSRSITRLPVCTGPSNTPGPGGCNKCQSMILRRDYQVERCYQNTSLNGYFSLNHPNTNSSPHSNFIEKFTDLIVILEPCHDLCSQCTIGTDQRISLSKTDWKGCTQCKGYWFDDKCVSICPKVRTFLKADETNSSLGKCHPCHPQCNGCYGVDNNHCIHCNNFKLPENENLTLFSCVESCP--SNYKETSGNSNENICVFVFLSGWEL--------ALVILAVVFIFVIITLFTIITKFCHARNGKRKRDKLKAYFSNAKESDSQTPS----PPNMNHLLVISSDNLEFIMGGEILGKGTFGSVYAGKWKLDNGCFDDNSSMNSCKDSKVDVVIKVLNHSCDQ--NEFMDEVRIMASVRHKHCLRLIGVSYKGSEKLLISSYMPLGSMEKYLEKNKKSLTGKILLKWAEQIANGMLYLENNHIIHRDLATRNVLIYKENHVQITDFGLSKIINPNKD-EMQIFGGMVPVRWLAIETLRDGIYSHKTDVWAYAVTLWEIFTFATVPYEFLKAHEIRDEIIKGTRLRQPDICSLDIYILMLKCWSVDPEERPNFEYLWTEFKNYSNNSETYLS 1199          
BLAST of Receptor protein-tyrosine kinase vs. Planmine SMEST
Match: SMESG000070834.1 (SMESG000070834.1)

HSP 1 Score: 566.614 bits (1459), Expect = 9.448e-177
Identity = 402/1175 (34.21%), Postives = 588/1175 (50.04%), Query Frame = 2
Query:  263 NCTHIQGSIYILGI-TKLESKERELNFDS-IEEIDGHLIIEGNDLEKITFKNLRIIRGANSI-KRNLIDKGHTDFSLVVSGNAHLVD-----LDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECTTCRYINGEEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELC--RGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFY-LRAQDLVQLKNCKKILGYIVLTEDSFVKHNITVEMLYEN-----LNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAISETELEFLGLKSLKEINGPFRFFKNQ-KLCYMNIPVNELFKNV-------------KNFYYIPSNCTDK--ICHKDC-SEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFY-NPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLND-SKACLPCHPNCSEYNST---ICTGPSSVPGIGGCNKCERILLSRKADIVSCVK-TCHEGTYAF----PNDRPDISRFYPVTGFTCL--PCPELCSKC------KGKSPKND--ECEVCKGVWHKNTCRLRCPRDESY--GTKIIDSISYCKTCHSSCKGCYGSTIFNCTRCKNKKIYLDKK--KFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKN--EETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLS 3610
            NCTH+ G+I+I  + ++    E +L F S I+EI G L I  +++  +  +NLR+IRG + +   + +      F + +  +  + +     +D RSLRSI + N+   S  +      +++WNEL  DP  Q +      +      KC  + K        FCWGP  +QCQ  + C  +  +    C      ++ CCN QCLGGC    +S C AC+ +L+   C   C  +   +   G    NK FR      C  +CP  +L +   C  +C+   ++ + + C+ C   +C      C L +I    D    ++ L    L +L NC    G++ +  +SFVKH   +  +  +     L  L+ + G  S + D                   + S +P + +     I  T + +LGLKSLK I     FFKN  KLCY +I   + FKN+              N    P  C  +  +C   C S+ GCWGPG   C  C        C  +C  + G+  NP ++S    + CL+CH EC  TC G   +QCI GCK+  EN  CV  CS+  +  LN  +K C PCH +C   + T   +CTGPS+ PG GGCNKC+ ++L R   +  C + T   G ++      N  P  +     T    +  PC +LCS+C      +    K D   C  CKG W  + C   CP+  ++    +   S+  C  CH  C GCYG    +C  C N K+  ++    F C ++CP   + +E    S + +C+ ++ S  +L         + ++  + I VII + TI+         +R   +LKA +SN  E +S+       PPNM  L+++S ++L F    + LG G FG VY GKWK+     ++     +  D  + V IKV+ +  ++     M E ++MASV H HCLR IGV     +  LIS+Y+  GS++K+L +NK  +T  I+L W+EQIA+GMLYL   +IIHRDLA RNVL+ +   VQITDFGLSK++   KD E+ I  G VP+RWLAIETL DG YSH+TDVWAY VTLWEIFTF  VPYE    H+I D ++KG RL QPDICSLD+YI+M+ CW   P  RP+F+ L   F +Y  N   YLS
Sbjct:   61 NCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLRSIVSGNIYISS--QFCSSLANVEWNELLEDPTRQSVTGKCTPQPTKCSKKCMQKGK------SGFCWGPLTSQCQIFSKCRKRMCA--NRCFLSETGDEECCNSQCLGGCTSSDSSSCIACQGVLDNNVCQPECPPKKIINRETGIPEPNKYFRPLFVNICLNKCPEGLLEQEGECKTQCTFRKYERQGDQCVPC-KILCEQ---ICTLEEIFSPNDFKYSYFSLDYPKLKKLANCTTFKGFVQIDTESFVKHRPEIVPISNSDDLKFLENLRNISG--SVYIDLKDAPFKLDSLSFLSNLQAIESLVPIIST--SLTIINTNISYLGLKSLKTIKNKAIFFKNNTKLCYFDI---KKFKNIVKTDTLNDVTIISDNGMADPKLCEQRGNVCSVQCDSQLGCWGPGPNHCISCANVRLGTICAENCLVQPGYLTNPDSTS----KVCLKCHDECAKTCSGLRSDQCIGGCKHAMENSMCVRECSRTHF--LNKITKTCEPCHKDCHSRSITRLPVCTGPSNTPGPGGCNKCQSMILRRDYQVERCYQNTSLNGYFSLNHPNTNSSPHSNFIEKFTDLIVILEPCHDLCSQCTIGTDQRISLSKTDWKGCTQCKGYWFDDKCVSICPKVRTFLKADETNSSLGKCHPCHPQCNGCYGVDNNHCIHCNNFKLPENENLTLFSCVESCP--SNYKETSGNSNENICVFVFLSGWEL--------ALVILAVVFIFVIITLFTIITKFCHARNGKRKRDKLKAYFSNAKESDSQT----PSPPNMNHLLVISSDNLEFIMGGEILGKGTFGSVYAGKWKLDNGCFDDNSSMNSCKDSKVDVVIKVLNHSCDQ--NEFMDEVRIMASVRHKHCLRLIGVSYKGSEKLLISSYMPLGSMEKYLEKNKKSLTGKILLKWAEQIANGMLYLENNHIIHRDLATRNVLIYKENHVQITDFGLSKIINPNKD-EMQIFGGMVPVRWLAIETLRDGIYSHKTDVWAYAVTLWEIFTFATVPYEFLKAHEIRDEIIKGTRLRQPDICSLDIYILMLKCWSVDPEERPNFEYLWTEFKNYSNNSETYLS 1191          
BLAST of Receptor protein-tyrosine kinase vs. Planmine SMEST
Match: SMESG000044603.1 (SMESG000044603.1)

HSP 1 Score: 543.117 bits (1398), Expect = 6.699e-167
Identity = 397/1243 (31.94%), Postives = 632/1243 (50.84%), Query Frame = 2
Query:  155 EEEYPGTIICQNDNVQIESLHSSVEKLKILSIIRS--KNCTHIQGSIYILGITKLESKERELNFDSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDK---CSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECTTCRYING--EEQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGPYSGGIGGTITNKEFRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTE-----DSFVKHNITVE---MLYENLNKLQELEGGFSYFKDNHXXXXXXXXXXXXXXXXXXHSDIPNLPSYHKFAI---SETELEFLGLKSLKEI-NGPFRFFKNQKLCYMNIPVNELFKNVKNFYYI----PSNCTDKICHKDCSEK-GCWGPGNKLCYECRKY--DAAGTCVSDCSQKKGFYNPINSSLLSNQKCLRCHPECL---NTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLNDSKACLPCHPNCSEYNS---TICTGPSSVPGIGGCNKCERILLSRKA----------DIVSCVKT---CHEGTY--------------AFPNDRPDISRFYPV-------TGFTCLPCPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRCPRDESYGTKIIDSI---SYCKTCHSSC-KGCYGSTIFNCTRCKNKKIYLD-KKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHXXXXXXXXXXXXXXXXXXXXXXYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWK-----IPKNEETL---LKKASGD--FYLPVAIKVIKNMGN-EEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGDPYEIP 3637
            ++ Y    +C++   QI+   +S E LK     R+  KNC++I G + I  IT     E     +SIE+I G+L+I  N +E I+   L++IRG N     L+ KG   FSL+V  N+ L ++ F +L+ I  HNV F++NPK+ Y    I WN L    + +++   T  KD  L ++   C + C+  A+  + +CWG S++ CQ+   C ++   + T C YIN   + + CC+++C+GGC G   S+C ACKN  N   CVE C   +       I N   +    + C  +CP     E+  CV +CS       +  C+ C    C        + +     D     Y+  + L +L+NC    G I++       D+F  HN++ +   +  ++L KL+ LE  + Y +  H+   +   + L F          N+ S+    I       L++LGL++LKE+ NG    F N +LC+ N   N+   +   F         NC+ K CH +C ++ GCWGP    C +C+ +    + TC+S CS + G++   +S    N+ C RCH ECL   NTC G N N+C  GCKN +   +C+  C   +Y  ++  K C PCH NC+E +    ++C GP    G  GC+ C  I++S             +I+ C+K    C +G Y              A  +    + ++  +           C PC   CS+C G S  +  C +CK     N C  +CP++  Y   + ++    S CK CH  C +GC GST ++C RCK+ KIY++   +F+CN TC     + +    + +I+C              R ++ + +     I++  V + +   L  K   ++ +T+L  +          +  +L   PNM  L+++++  L  ++    +G GAFG VYKG W+     I K+   L   + K S D    L VA+K++ ++ +      +++EAK+MASV H  CLR + VCL+   P LI+ ++  GSL +F+ RN++ I S+ +L W++QIA GM YL  + IIH DLAARNVL+     V+ITDFGL+KML+ ++ ++   K G++PI+WLA+E + +  +S ++DVW+YGVTLWE+F++G+ P+ D   +DI + + KG RL+QP ICS+D Y I+V CWL  P+ RP F  L +TF     NP RYL +Q +    P
Sbjct:   70 DKRYRHGKVCKSTQTQIDVSKNSYESLK-----RNFDKNCSYIIGDVVIAHITN----ENISFLNSIEDISGYLMIFSNAVESISLIKLKVIRGENP----LLIKG-LKFSLIVGYNSMLENILFPNLQVILRHNVFFNNNPKLCYASRKINWNSLMRRSQ-EVVIVETNEKDCGLNNEELSCHESCQ--AHLNKTYCWGNSSSACQKINDCANRTCYDSTKC-YINEILKTEECCHEECVGGCTGPARSQCLACKNFNNNGICVENCPPEFKHDGMKYIQNPLGKLAFYYICVDKCPKKFFNEHGNCVTQCSAEKTYAVNQTCVPCPNGKCPK------ICRARDILDSQEISYVHRKVLGRLENCTVYDGNILINRFSLEGDNF--HNLSKQNDGIRKQDLKKLENLEEIYGYLRI-HVPFNSNWTDSLEFLKNLRIIRAENVRSHKSRGIEIVGNPALKYLGLRNLKEVRNGNIIIFSNNQLCFSNTLTNKSILHKGTFLRALNGKKGNCSKKKCHSECEQRLGCWGPEKYHCVKCKSFVIRESKTCLSKCSNEPGYFYNSSSDHEVNRSCSRCHSECLPGINTCHGSNENECNLGCKNYKFGESCIKKCPAKYY--VDSMKNCYPCHTNCTENSQNKESMCHGPEDSLGQKGCSICNHIIVSSNHSTSYKNSSNFNILKCLKNSDICPKGFYKSIIDFRSGMKVNAAMQSTMKILEKWIEIGTNHDLPIASVCFPCHPYCSECHGGSSWH--CSLCKYFRSDNKCIQKCPKE--YFITVNETAKPESECKKCHEECSEGCLGSTNYDCLRCKHAKIYVNGSTQFFCNSTCGDRIQLFQ----TSEIICTDHLI-------YSRFNMYIYIGGPAGIVICFVFIIVCFILSSKNQEKKFKTKLVNQGDFYPSDTGTNSGVL---PNMATLLLITESQLTRQE---IIGSGAFGIVYKGIWQPNIDAIDKSNSFLKRNISKISQDSSIKLNVAVKILTDISDPSNNREILEEAKVMASVDHPCCLRILAVCLT-AHPKLITQFMPLGSLLEFVQRNRSLINSITLLIWAKQIASGMEYLESKGIIHCDLAARNVLIQSPRQVKITDFGLAKMLDYSQ-QQYQFKGGRMPIKWLAVECIRNRIFSSKSDVWSYGVTLWEMFSYGEKPFADIKAYDILEHLEKGQRLNQPKICSIDAYTILVQCWLVDPDARPSFTELRKTFEMMSSNPNRYLLVQDEDSNEP 1260          
The following BLAST results are available for this feature:
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ERBB47.051e-7233.01erb-b2 receptor tyrosine kinase 4 [Source:HGNC Sym... [more]
ERBB41.142e-7133.01erb-b2 receptor tyrosine kinase 4 [Source:HGNC Sym... [more]
ERBB44.369e-7133.12erb-b2 receptor tyrosine kinase 4 [Source:HGNC Sym... [more]
EGFR5.448e-6639.42epidermal growth factor receptor [Source:HGNC Symb... [more]
EGFR5.656e-6639.42epidermal growth factor receptor [Source:HGNC Symb... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
let-239.598e-12329.84Receptor tyrosine-protein kinase let-23 [Source:U... [more]
let-234.456e-12229.84Receptor tyrosine-protein kinase let-23 [Source:U... [more]
let-234.766e-12229.84Receptor tyrosine-protein kinase let-23 [Source:U... [more]
let-234.784e-12229.84Receptor tyrosine-protein kinase let-23 [Source:U... [more]
R151.12.279e-4735.97pep chromosome:WBcel235:III:7218813:7221186:1 gene... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Egfr1.121e-13029.31gene:FBgn0003731 transcript:FBtr0071653[more]
Egfr1.512e-13029.31gene:FBgn0003731 transcript:FBtr0071654[more]
Eph4.396e-4533.66gene:FBgn0025936 transcript:FBtr0301285[more]
Eph7.207e-4533.66gene:FBgn0025936 transcript:FBtr0089083[more]
Eph8.047e-4533.66gene:FBgn0025936 transcript:FBtr0089082[more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
erbb4a5.685e-7333.72erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Ac... [more]
erbb4a1.234e-7133.89erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Ac... [more]
si:ch73-383l1.12.853e-7133.22si:ch73-383l1.1 [Source:ZFIN;Acc:ZDB-GENE-121214-6... [more]
si:ch73-383l1.12.933e-7143.04si:ch73-383l1.1 [Source:ZFIN;Acc:ZDB-GENE-121214-6... [more]
erbb4a3.437e-7133.84erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Ac... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ERBB42.625e-7132.61erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
ERBB43.386e-7132.61erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
ERBB43.879e-7132.61erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
ERBB45.750e-7132.40erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
ERBB48.092e-7132.71erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Erbb48.618e-7333.05erb-b2 receptor tyrosine kinase 4 [Source:MGI Symb... [more]
Erbb43.637e-7133.98erb-b2 receptor tyrosine kinase 4 [Source:MGI Symb... [more]
Egfr1.085e-6633.46epidermal growth factor receptor [Source:MGI Symbo... [more]
Erbb21.110e-5938.96erb-b2 receptor tyrosine kinase 2 [Source:MGI Symb... [more]
Erbb31.576e-5939.43erb-b2 receptor tyrosine kinase 3 [Source:MGI Symb... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P04412|EGFR_DROME5.887e-12629.05Epidermal growth factor receptor OS=Drosophila mel... [more]
sp|P0CY46|EGFR_APIME9.912e-12229.64Epidermal growth factor receptor OS=Apis mellifera... [more]
sp|P24348|LET23_CAEEL6.062e-12129.84Receptor tyrosine-protein kinase let-23 OS=Caenorh... [more]
sp|Q62956|ERBB4_RAT2.669e-7134.34Receptor tyrosine-protein kinase erbB-4 OS=Rattus ... [more]
sp|P11273|ERBB_AVIEU1.796e-7040.29Tyrosine-protein kinase transforming protein erbB ... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B1ACY50.000e+099.93Receptor protein-tyrosine kinase OS=Schmidtea medi... [more]
A0A1B1ACX90.000e+036.91Receptor protein-tyrosine kinase OS=Schmidtea medi... [more]
A0A1B1ACY20.000e+036.02Receptor protein-tyrosine kinase OS=Schmidtea medi... [more]
A0A564YLA10.000e+035.46Receptor protein-tyrosine kinase OS=Hymenolepis di... [more]
A0A0X3PH980.000e+033.46Receptor protein-tyrosine kinase OS=Schistocephalu... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egfra1.503e-7234.45epidermal growth factor receptor-like [Source:NCBI... [more]
egfra2.620e-7234.45epidermal growth factor receptor-like [Source:NCBI... [more]
ENSAMXT00000002946.25.540e-7133.57pep primary_assembly:Astyanax_mexicanus-2.0:12:281... [more]
erbb4b7.149e-7133.11erb-b2 receptor tyrosine kinase 4b [Source:ZFIN;Ac... [more]
ENSAMXT00000030092.14.922e-6832.77receptor tyrosine-protein kinase erbB-4 [Source:NC... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003172.13.019e-6940.23pep scaffold:Pmarinus_7.0:GL476855:1052:76454:1 ge... [more]
EGFR1.406e-5329.04epidermal growth factor receptor [Source:HGNC Symb... [more]
ENSPMAT00000005822.13.431e-5149.41pep scaffold:Pmarinus_7.0:GL476959:64997:68848:-1 ... [more]
EPHB21.522e-4430.41EPH receptor B2 [Source:HGNC Symbol;Acc:HGNC:3393][more]
NTRK21.964e-4432.88neurotrophic receptor tyrosine kinase 2 [Source:HG... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIN15.489e-1825.18Serine/threonine protein kinase involved in regula... [more]
STE112.205e-1726.90Signal transducing MEK kinase; involved in pheromo... [more]
CDC151.540e-1625.29Protein kinase of the Mitotic Exit Network; locali... [more]
KIN22.196e-1625.12Serine/threonine protein kinase involved in regula... [more]
KIC11.143e-1528.51Protein kinase of the PAK/Ste20 family, required f... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470941.607e-4535.92Predicted protein; Vascular endothelial growth fac... [more]
EDO337361.867e-4534.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409942.021e-4531.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355942.285e-4536.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491264.513e-4434.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
erbb4b3.158e-7032.10erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
erbb4b4.670e-7032.15erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
erbb4b5.930e-7032.10erb-b2 receptor tyrosine kinase 4 [Source:NCBI gen... [more]
erbb4a1.474e-6934.05receptor tyrosine-protein kinase erbB-4 [Source:NC... [more]
erbb4a2.878e-6934.05receptor tyrosine-protein kinase erbB-4 [Source:NC... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005947.10.000e+099.66SMESG000005947.1[more]
SMESG000016935.10.000e+037.08SMESG000016935.1[more]
SMESG000070834.17.008e-17734.21SMESG000070834.1[more]
SMESG000070834.19.448e-17734.21SMESG000070834.1[more]
SMESG000044603.16.699e-16731.94SMESG000044603.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004568 ID=SMED30004568|Name=Receptor protein-tyrosine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=4710bp
TTTAGATATACTGAAAAAGATTAATTTGATTTGGAAATTATTATTACTGT
AAATTAAAACTCTTTTTTTAAATATATTTTACAAGATGACTCATAAAACC
TATCTAATTTTATTTTTGTTTCTTATTCAATTTCAAATAAACAATGCAAC
ATTTGAAGAAGAATATCCAGGAACAATAATCTGTCAGAATGACAATGTAC
AAATAGAATCGCTACATAGCTCAGTTGAAAAATTGAAAATCCTTAGTATT
ATACGATCAAAAAATTGCACTCACATTCAAGGAAGCATATATATTCTTGG
AATTACCAAATTAGAGAGTAAAGAAAGAGAATTAAATTTTGATTCCATTG
AAGAGATAGACGGACATTTAATTATTGAAGGAAACGATCTCGAAAAAATT
ACTTTTAAAAACTTACGAATAATCCGCGGGGCAAATTCAATTAAACGCAA
CCTGATTGATAAAGGCCATACAGATTTCTCTCTCGTCGTTTCTGGAAATG
CGCATTTAGTTGACTTGGATTTTCGTAGCTTACGATCCATTAATGCTCAC
AATGTGATCTTCGATTCAAACCCAAAAATGAAATATTTACCTCATTCGAT
CAAGTGGAATGAATTATTCACAGACCCCAAAGCACAAATACTTTTTTCGC
CCACCGTAACTAAAGATTTGATTCTTCGTGATAAATGCTCAGATCAGTGT
AAATTATGGGCAAATTTTACTCAGGTATTTTGCTGGGGTCCTTCAGCAAA
TCAATGTCAACAACAAACTTTATGTGGTTCTAAATATTCTTCTGAATGCA
CCACATGTCGATATATTAACGGCGAAGAGCAAGGATGTTGCAATGATCAA
TGTCTTGGAGGTTGTAACGGCGGGGGAGCATCCAAGTGCACGGCTTGCAA
AAACATGTTGAATGAGAAAAAATGTGTGGAACTGTGCCGAGGACCATATT
CTGGGGGAATAGGTGGAACAATAACAAATAAGGAATTTAGATATCACGCG
GGTTTTTTTTGCTCAAAACAATGCCCTGCGATGATGCTCCCCGAAAACAC
TGGATGCGTACATAAATGTAGTGAAGGATACTTTAAAAACAAATCCAACC
ACTGCATCAAGTGCTACGGGAATATGTGCACAAATGATCATCTTCCCTGT
AACCTATTTAAAATCGCTGGCCACACTGATGGAGCAAATGATTTCTATTT
AAGGGCTCAAGATTTAGTTCAACTAAAAAATTGCAAAAAGATTCTGGGAT
ATATAGTTCTTACTGAGGATTCATTTGTCAAGCATAATATAACAGTTGAA
ATGCTGTATGAAAATTTAAACAAACTCCAAGAATTGGAAGGCGGATTCAG
CTATTTCAAAGATAATCATCTGAAAAACTTAACTTTTCTTCGCAACCTTC
TTAGATTTAGGGCGGCATACTTACATTCGGATATACCTAACTTACCTAGC
TATCACAAATTTGCTATAAGCGAAACAGAACTTGAATTTTTGGGTTTAAA
ATCTCTTAAAGAAATTAATGGACCGTTTAGATTTTTCAAGAATCAAAAAC
TTTGTTACATGAATATTCCAGTAAACGAATTATTTAAAAACGTGAAAAAT
TTCTATTATATTCCATCGAATTGTACAGATAAAATTTGTCACAAAGATTG
CTCTGAAAAGGGATGTTGGGGACCCGGGAATAAACTTTGTTATGAATGCA
GAAAATATGATGCAGCTGGCACTTGTGTTTCGGATTGTAGTCAGAAAAAG
GGATTTTATAATCCCATTAACTCATCACTTTTAAGCAATCAGAAATGTCT
TCGATGCCACCCTGAATGTTTGAATACCTGCGTGGGTCCTAATCCAAATC
AGTGCATTAAAGGATGTAAAAATAAAAGGGAAAATGGAACCTGTGTTGCA
TCATGCTCTAAGAATTTTTATCCCCCCCTAAATGATAGTAAAGCTTGTCT
ACCTTGTCATCCAAATTGTAGTGAATATAATTCCACAATTTGTACTGGTC
CATCGTCGGTACCGGGCATTGGGGGATGTAACAAATGCGAAAGAATTTTA
CTAAGCAGGAAAGCTGATATCGTTAGTTGTGTAAAGACGTGTCATGAGGG
CACATATGCGTTTCCAAATGACCGTCCAGATATTTCACGGTTTTATCCAG
TTACTGGCTTTACTTGTCTTCCTTGTCCAGAATTATGCTCAAAATGTAAA
GGGAAAAGTCCTAAAAATGATGAATGCGAAGTTTGCAAAGGTGTTTGGCA
CAAAAACACTTGTCGATTACGTTGTCCAAGAGATGAAAGTTATGGTACAA
AAATAATTGATTCAATTTCCTACTGTAAAACGTGTCATTCATCTTGTAAA
GGTTGTTATGGCTCTACAATATTTAATTGTACCCGTTGCAAAAACAAAAA
AATCTATCTTGATAAAAAAAAATTTTATTGTAATGACACATGTCCACCAC
TAAAAAGTGTTGAAGAAATAGAGAAAGGTTCTGGGGATATTGTTTGTTTG
TCTCTTTGGGAAAGTAAAGCTAAACTTGAGGAAACAAAAAGGACACATAT
TACCGTAGGTGTTGTAGTGACAATGCTGATATTAGTTATTATTGTCATTG
TCACTATTGTGGTTTATCTAAAAAGAAAAGCAATTGCCGAAAGAATAGAA
ACTGAATTGAAAGCTCGATACTCAAATTTAACTGAACCCAATTCAAAGGA
TGAAGATCTTCTGAGTAAACCTCCAAATATGGGACGATTGATGATTGTGA
GTAAGGAGGATTTAATTTTTGAAGACGAATCAAAACCTTTGGGATTTGGG
GCTTTTGGATATGTGTATAAAGGCAAATGGAAAATTCCCAAAAACGAAGA
AACTTTATTAAAAAAGGCAAGTGGTGATTTTTATCTTCCTGTAGCAATCA
AAGTGATAAAAAATATGGGCAATGAAGAAATTGAATCTGTAATGCAGGAA
GCTAAGATGATGGCATCCGTTTCCCATATGCACTGTTTGAGATTTATTGG
AGTTTGTTTGTCATATGAAAAGCCGTGTCTTATTTCGGCATATGTTAAAG
AAGGAAGTTTAGACAAGTTTTTGATTAGAAACAAGAACAAAATCACCAGC
CTCATCATGCTCAGTTGGAGTGAGCAAATTGCAGATGGGATGCTATATTT
AACAAAACGAAACATTATTCATAGAGATTTGGCAGCGAGAAATGTGTTAG
TCAGTCGACTGGAATGTGTTCAGATTACAGATTTTGGTCTCTCAAAAATG
TTGGAAAGCACAAAAGATAAAGAAATAATTATCAAAACTGGTAAAGTCCC
GATTCGATGGCTGGCTATTGAGACTCTTACAGATGGGAAATATTCCCATG
AAACTGATGTTTGGGCATACGGTGTCACATTGTGGGAGATTTTCACATTT
GGAAAAGTGCCATATGAGGATCAGGCAACTCACGATATCTTTGATTTCGT
TTTGAAGGGAGGCCGTTTATCTCAACCAGATATATGCTCATTAGATGTAT
ACATCATCATGGTTAATTGCTGGTTAGAGAGTCCGAATTTAAGACCAGAT
TTTCAGAATTTGATGCAAACTTTCACGGATTACTGCAAAAATCCAGGGAG
ATATTTGAGTATTCAAGGTGATCCGTATGAAATTCCATCTCCACACAGCA
TAGAAATGACAAATTTCAATAACCATTATGGGGAAGACCAATTTAATTTC
CCATCTATGACCGCTGAGACAATGCTTCCATTGCTTAATGGGCGGGACTC
AATAGATCGTGACGTTAAGGACTTCACTGACAATAATGAAATTGATGAAT
CTTTGCTTTCAAGTACTGATAAGGAACCTCTTCCCACAAGAAGTATGAAT
CGAACTAGTAACATTTTTAAATTGTTTCAAGATAATAAACAATCACAGAA
TCCACAAAATCTCAATACTCGTAATAATAATACCAACAACAACAATACTC
CAAGATTGGTTTCGTTAGCATCTCAAGAAGAACCCACTTTCAGAAATCAG
CCTCTGATTACAGATGATGACCCACGTTATGTAGCTGATCCAACTGAGAA
ATCTATAAAAATGAGACAACAATTACCTTTGCAATCTCAATTTTTGCAAG
AAACTCCGAGATTTCACAGCAACATCAGTAGAGAAAATCACACTCCCTTT
AATAATGTTTCAGCTTCTCAATCTCCACAGATCAGTCAGATCTCTGACGA
TTATCTCGAACCAAATGCGCCAGGTCCCAAAAATACGTCCCTTGTTGATA
CAGGAGATCCAGAAGGCTATTTGGAACCGATAAATCCATCTAACAAAAGT
TCTTTATTAAATCAAGATGATTATGTTGTGCCTTCTTTGACAAATACGCC
GAGAGAATCAATGTTAAACTCAAAACCCCCTCGAAATTCCAATGCATTTA
AACAGTCTAAACAGTATATCTCTATGGATGATGGAAACCCTCATTTCTCA
AATAGTATAGATGATGATGATGGATATTTGGAGCCTGAACCTAAAAGTCG
CTTGCTGAATTCGTCAAATAGATAACTAGATATATGATTAGAGGATATTA
TAAATTTGTCTTCCAACGCAAAACCTCTAGTCAATCTATACTGGAATTTC
TACGAAATATCTTTTTTTTCTAATTAATTTACATCGTATATGCAAATCTA
TGGAACTCTGCTTCTTTCATTGTGTATATAATCAATAAATTTTAATATTT
TGAAAAAAAA
back to top

protein sequence of SMED30004568-orf-1

>SMED30004568-orf-1 ID=SMED30004568-orf-1|Name=SMED30004568-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1480bp
MTHKTYLILFLFLIQFQINNATFEEEYPGTIICQNDNVQIESLHSSVEKL
KILSIIRSKNCTHIQGSIYILGITKLESKERELNFDSIEEIDGHLIIEGN
DLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLR
SINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDK
CSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECTTCRYINGEEQG
CCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGPYSGGIGGTITNKE
FRYHAGFFCSKQCPAMMLPENTGCVHKCSEGYFKNKSNHCIKCYGNMCTN
DHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKH
NITVEMLYENLNKLQELEGGFSYFKDNHLKNLTFLRNLLRFRAAYLHSDI
PNLPSYHKFAISETELEFLGLKSLKEINGPFRFFKNQKLCYMNIPVNELF
KNVKNFYYIPSNCTDKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSD
CSQKKGFYNPINSSLLSNQKCLRCHPECLNTCVGPNPNQCIKGCKNKREN
GTCVASCSKNFYPPLNDSKACLPCHPNCSEYNSTICTGPSSVPGIGGCNK
CERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYPVTGFTCLPCPEL
CSKCKGKSPKNDECEVCKGVWHKNTCRLRCPRDESYGTKIIDSISYCKTC
HSSCKGCYGSTIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSG
DIVCLSLWESKAKLEETKRTHITVGVVVTMLILVIIVIVTIVVYLKRKAI
AERIETELKARYSNLTEPNSKDEDLLSKPPNMGRLMIVSKEDLIFEDESK
PLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIE
SVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNK
NKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDF
GLSKMLESTKDKEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLW
EIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESP
NLRPDFQNLMQTFTDYCKNPGRYLSIQGDPYEIPSPHSIEMTNFNNHYGE
DQFNFPSMTAETMLPLLNGRDSIDRDVKDFTDNNEIDESLLSSTDKEPLP
TRSMNRTSNIFKLFQDNKQSQNPQNLNTRNNNTNNNNTPRLVSLASQEEP
TFRNQPLITDDDPRYVADPTEKSIKMRQQLPLQSQFLQETPRFHSNISRE
NHTPFNNVSASQSPQISQISDDYLEPNAPGPKNTSLVDTGDPEGYLEPIN
PSNKSSLLNQDDYVVPSLTNTPRESMLNSKPPRNSNAFKQSKQYISMDDG
NPHFSNSIDDDDGYLEPEPKSRLLNSSNR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036941Rcpt_L-dom_sf
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR020635Tyr_kinase_cat_dom
IPR006212Furin_repeat
IPR006211Furin-like_Cys-rich_dom
IPR000494Rcpt_L-dom
IPR032778GF_recep_IV
IPR008266Tyr_kinase_AS
IPR000719Prot_kinase_dom
IPR009030Growth_fac_rcpt_cys_sf
IPR032675LRR_dom_sf
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0005524ATP binding
GO:0004714transmembrane receptor protein tyrosine kinase activity
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007169transmembrane receptor protein tyrosine kinase signaling pathway
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 1021..1039
score: 64.19
coord: 1071..1081
score: 46.7
coord: 984..997
score: 35.08
coord: 1090..1112
score: 54.68
coord: 1134..1156
score: 39.21
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 900..1162
e-value: 2.8E-78
score: 262.8
IPR020635Tyrosine-protein kinase, catalytic domainSMARTSM00219tyrkin_6coord: 896..1163
e-value: 6.2E-106
score: 367.9
IPR006212Furin-like repeatSMARTSM00261furin_3coord: 568..613
e-value: 7.3E-9
score: 45.5
coord: 744..792
e-value: 7.9E-4
score: 28.7
coord: 510..559
e-value: 1.1E-5
score: 34.9
coord: 248..290
e-value: 0.012
score: 24.8
coord: 691..737
e-value: 0.0015
score: 27.8
coord: 618..675
e-value: 5.9E-4
score: 29.1
IPR006212Furin-like repeatCDDcd00064FUcoord: 750..788
e-value: 2.12394E-5
score: 41.3504
IPR006212Furin-like repeatCDDcd00064FUcoord: 574..619
e-value: 1.26611E-6
score: 44.8172
IPR006212Furin-like repeatCDDcd00064FUcoord: 518..564
e-value: 2.69057E-4
score: 38.2688
IPR006212Furin-like repeatCDDcd00064FUcoord: 623..680
e-value: 0.00528761
score: 34.4168
IPR006212Furin-like repeatCDDcd00064FUcoord: 251..284
e-value: 0.00286719
score: 35.1872
IPR000494Receptor L-domainPFAMPF01030Recep_L_domaincoord: 60..177
e-value: 2.3E-18
score: 66.3
coord: 382..494
e-value: 7.9E-8
score: 32.4
IPR006211Furin-like cysteine-rich domainPFAMPF00757Furin-likecoord: 203..349
e-value: 1.2E-14
score: 54.4
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 890..1169
e-value: 1.9E-71
score: 242.2
NoneNo IPR availableGENE3DG3DSA:2.10.220.10coord: 694..803
e-value: 2.0E-9
score: 39.3
NoneNo IPR availableGENE3DG3DSA:2.10.220.10coord: 587..642
e-value: 9.2E-11
score: 43.7
coord: 527..586
e-value: 1.3E-15
score: 59.2
NoneNo IPR availableGENE3DG3DSA:2.10.220.10coord: 227..348
e-value: 1.8E-17
score: 65.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1419..1453
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1265..1286
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1419..1479
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1454..1468
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 481..1286
coord: 58..519
NoneNo IPR availablePANTHERPTHR24416:SF95EPIDERMAL GROWTH FACTOR RECEPTORcoord: 58..519
NoneNo IPR availablePANTHERPTHR24416:SF95EPIDERMAL GROWTH FACTOR RECEPTORcoord: 481..1286
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.811
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 58..221
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 376..531
NoneNo IPR availableTMHMMTMhelixcoord: 823..845
IPR032778Growth factor receptor domain 4PFAMPF14843GF_recep_IVcoord: 517..610
e-value: 3.4E-16
score: 59.3
IPR036941Receptor L-domain superfamilyGENE3DG3DSA:3.80.20.20coord: 357..520
e-value: 4.9E-18
score: 67.3
IPR036941Receptor L-domain superfamilyGENE3DG3DSA:3.80.20.20coord: 27..226
e-value: 1.6E-35
score: 124.4
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 1027..1039
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 896..1164
score: 34.252
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 900..1188
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 643..788
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 517..633
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 201..348