beta-1,4-galactosyltransferase 4-like

Overview
Namebeta-1,4-galactosyltransferase 4-like
Smed IDSMED30004558
Length (bp)1139
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of beta-1,4-galactosyltransferase 4-like (SMED30004558) t-SNE clustered cells

Violin plots show distribution of expression levels for beta-1,4-galactosyltransferase 4-like (SMED30004558) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of beta-1,4-galactosyltransferase 4-like (SMED30004558) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for beta-1,4-galactosyltransferase 4-like (SMED30004558) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004558

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30004558SMESG000071011.1 dd_Smed_v4_8856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30004558SMESG000071011.1 dd_Smed_v6_8856_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004558SMESG000071011.1 OX_Smed_1.0.17425ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Human
Match: B4GALT3 (beta-1,4-galactosyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:926])

HSP 1 Score: 179.874 bits (455), Expect = 3.121e-52
Identity = 101/273 (37.00%), Postives = 147/273 (53.85%), Query Frame = 2
Query:  311 FCTERSQF-IDIKSMTYNEVTKFAEETE----IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPR 1111
            +C ERS   +   S++++ V   AE  E    ++ GG +  + C   +  AII+P R R      LL  LH  LQ+Q + Y I++I Q G+  FN+ ++ N G  E +    ++C+  HD DL+PE+    Y C   G  H+A A++   Y LPY    GGV A  P QYL +NG+ N YWGWG EDDD+  R++   +   R P +VG YK +KH    +   +N  R  LL   +     DG+NSL Y+++ +    LYT+I  DIGT PR
Sbjct:   76 YCPERSPLLVGPVSVSFSPVPSLAEIVERNPRVEPGGRYRPAGCEPRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHR-GDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPR 347          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Human
Match: B4GALT3 (beta-1,4-galactosyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:926])

HSP 1 Score: 179.874 bits (455), Expect = 3.121e-52
Identity = 101/273 (37.00%), Postives = 147/273 (53.85%), Query Frame = 2
Query:  311 FCTERSQF-IDIKSMTYNEVTKFAEETE----IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPR 1111
            +C ERS   +   S++++ V   AE  E    ++ GG +  + C   +  AII+P R R      LL  LH  LQ+Q + Y I++I Q G+  FN+ ++ N G  E +    ++C+  HD DL+PE+    Y C   G  H+A A++   Y LPY    GGV A  P QYL +NG+ N YWGWG EDDD+  R++   +   R P +VG YK +KH    +   +N  R  LL   +     DG+NSL Y+++ +    LYT+I  DIGT PR
Sbjct:   76 YCPERSPLLVGPVSVSFSPVPSLAEIVERNPRVEPGGRYRPAGCEPRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHR-GDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPR 347          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Human
Match: B4GALT3 (beta-1,4-galactosyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:926])

HSP 1 Score: 179.874 bits (455), Expect = 3.121e-52
Identity = 101/273 (37.00%), Postives = 147/273 (53.85%), Query Frame = 2
Query:  311 FCTERSQF-IDIKSMTYNEVTKFAEETE----IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPR 1111
            +C ERS   +   S++++ V   AE  E    ++ GG +  + C   +  AII+P R R      LL  LH  LQ+Q + Y I++I Q G+  FN+ ++ N G  E +    ++C+  HD DL+PE+    Y C   G  H+A A++   Y LPY    GGV A  P QYL +NG+ N YWGWG EDDD+  R++   +   R P +VG YK +KH    +   +N  R  LL   +     DG+NSL Y+++ +    LYT+I  DIGT PR
Sbjct:   76 YCPERSPLLVGPVSVSFSPVPSLAEIVERNPRVEPGGRYRPAGCEPRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHR-GDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPR 347          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Human
Match: B4GALT1 (beta-1,4-galactosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:924])

HSP 1 Score: 166.007 bits (419), Expect = 7.859e-47
Identity = 96/273 (35.16%), Postives = 141/273 (51.65%), Query Frame = 2
Query:  302 SVPFCTERSQFIDIK-----SMTYNEVTKFAEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGT 1102
            S+P C E S  +        +M  +      +   +K GG +    C++ + +AIIIPFR R       L  LH +LQ+Q + Y I++I Q G   FN+ ++ N GF E +  + + C +F D DLIP +    Y+C      HI+ A+D   + LPY    GGV A    Q+L++NG+ N YWGWG EDDD+  RL    +   R    VGR + ++H    + +    R + +  T E  M +DGLNSL Y+++      LYT I VDIGT
Sbjct:  126 SLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQ-PRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKET-MLSDGLNSLTYQVLDVQRYPLYTQITVDIGT 396          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Human
Match: B4GALT5 (beta-1,4-galactosyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:928])

HSP 1 Score: 165.236 bits (417), Expect = 1.208e-46
Identity = 93/247 (37.65%), Postives = 142/247 (57.49%), Query Frame = 2
Query:  374 FAEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQ----ILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGY--KRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDI 1096
            F+++  IK GG+W  S C+    +AI+IPFR R     E LPVL +    +LQ+Q + +  +++EQ+G++ FN+  + N GF E +    ++C+IFHD D IPES +  Y C      H A+ +D   Y+LPY+   GGV      Q+  +NG+ N +WGWG EDDD+  R++N  GY   R   + G+YK++ H    R ++Q L R  LL  +++R   DGLN+L Y     T   LY +I V++
Sbjct:  141 FSKDPTIKLGGHWKPSDCMPRWKVAILIPFRNR----HEHLPVLFRHLLPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKDLDWDCLIFHDVDHIPESDRNYYGCGQM-PRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVQNA-GYSVSRPEGDTGKYKSIPHH--HRGEVQFLGRYALLRKSKERQGLDGLNNLNY-FANITYDALYKNITVNL 378          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Celegans
Match: bre-4 (Beta-1,4-N-acetylgalactosaminyltransferase bre-4 [Source:UniProtKB/Swiss-Prot;Acc:Q9GUM2])

HSP 1 Score: 167.933 bits (424), Expect = 2.957e-48
Identity = 85/234 (36.32%), Postives = 133/234 (56.84%), Query Frame = 2
Query:  401 GGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGYK--RIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDI 1096
            GG+ +   C+  + +AII+P+R R      +L  LH +L +Q + Y IFI+EQ+ ++ FN+G++ N G+     ++ + C IFHD DL+PE  +  Y C      H++ A+D  NY LPYS + GG+ A        +NG+SN +WGWG EDDD+  R  +  G K  R P  + RYK +KH       +   R  ++  T ++R   DGL++LKY+++    K LYT  +VD+
Sbjct:  136 GGHGMPKDCVARHRVAIIVPYRDREAHLRIMLHNLHSLLAKQQLDYAIFIVEQVANQTFNRGKLMNVGYDVASRLYPWQCFIFHDVDLLPEDDRNLYTC-PIQPRHMSVAIDKFNYKLPYSAIFGGISALTKDHLKKINGFSNDFWGWGGEDDDLATR-TSMAGLKVSRYPTQIARYKMIKHSTEATNPVNKCRYKIMGQT-KRRWTRDGLSNLKYKLVNLELKPLYTRAVVDL 366          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Celegans
Match: bre-4 (Beta-1,4-N-acetylgalactosaminyltransferase bre-4 [Source:UniProtKB/Swiss-Prot;Acc:Q9GUM2])

HSP 1 Score: 167.933 bits (424), Expect = 2.957e-48
Identity = 85/234 (36.32%), Postives = 133/234 (56.84%), Query Frame = 2
Query:  401 GGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGYK--RIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDI 1096
            GG+ +   C+  + +AII+P+R R      +L  LH +L +Q + Y IFI+EQ+ ++ FN+G++ N G+     ++ + C IFHD DL+PE  +  Y C      H++ A+D  NY LPYS + GG+ A        +NG+SN +WGWG EDDD+  R  +  G K  R P  + RYK +KH       +   R  ++  T ++R   DGL++LKY+++    K LYT  +VD+
Sbjct:  136 GGHGMPKDCVARHRVAIIVPYRDREAHLRIMLHNLHSLLAKQQLDYAIFIVEQVANQTFNRGKLMNVGYDVASRLYPWQCFIFHDVDLLPEDDRNLYTC-PIQPRHMSVAIDKFNYKLPYSAIFGGISALTKDHLKKINGFSNDFWGWGGEDDDLATR-TSMAGLKVSRYPTQIARYKMIKHSTEATNPVNKCRYKIMGQT-KRRWTRDGLSNLKYKLVNLELKPLYTRAVVDL 366          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Celegans
Match: W02B12.11 (N-acetyllactosamine synthase [Source:UniProtKB/TrEMBL;Acc:G5EGS9])

HSP 1 Score: 165.622 bits (418), Expect = 3.325e-47
Identity = 98/262 (37.40%), Postives = 141/262 (53.82%), Query Frame = 2
Query:  341 IKSMTYNEVTKFAEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGY--KRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRK-TNKLLYTHIIVDIGTQPREF 1117
            I+++   EV   A   E+  GG W    C   + IA+IIP+R R      L+  L  ILQ+Q + +R  + EQ G++ FNKGR+ NA F+   S+   +CV+FHD D+ P+  + PY C   G  H+ + V    Y L Y  ++GGV+A     Y +VNGYSN +W WG EDDDM  R+  ++ Y  +R     GRY  +KH    R   + + +  LL  +  R+  DGLN      IRK T + LY H+ VD+G  P E+
Sbjct:  129 IQNLQEGEV--HAIHPELGPGGSWKPDDCQARDKIAVIIPYRERQTHLTRLIDFLIPILQRQRLDFRFIVTEQYGNDLFNKGRIMNAAFIFAESL-GVDCVVFHDVDMFPQDDRNPYSC-PPGPRHLGAFVSNLGYQLWYKEIVGGVLAVSMADYRAVNGYSNQFWAWGGEDDDMGQRIL-SLNYTIERPNPETGRYSMLKHVKRKRTAPKLIYK--LLGNSANRVAYDGLNETDKWTIRKVTTRPLYYHLYVDVGPVPEEW 383          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Celegans
Match: W02B12.11 (N-acetyllactosamine synthase [Source:UniProtKB/TrEMBL;Acc:G5EGS9])

HSP 1 Score: 165.622 bits (418), Expect = 3.325e-47
Identity = 98/262 (37.40%), Postives = 141/262 (53.82%), Query Frame = 2
Query:  341 IKSMTYNEVTKFAEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGY--KRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRK-TNKLLYTHIIVDIGTQPREF 1117
            I+++   EV   A   E+  GG W    C   + IA+IIP+R R      L+  L  ILQ+Q + +R  + EQ G++ FNKGR+ NA F+   S+   +CV+FHD D+ P+  + PY C   G  H+ + V    Y L Y  ++GGV+A     Y +VNGYSN +W WG EDDDM  R+  ++ Y  +R     GRY  +KH    R   + + +  LL  +  R+  DGLN      IRK T + LY H+ VD+G  P E+
Sbjct:  129 IQNLQEGEV--HAIHPELGPGGSWKPDDCQARDKIAVIIPYRERQTHLTRLIDFLIPILQRQRLDFRFIVTEQYGNDLFNKGRIMNAAFIFAESL-GVDCVVFHDVDMFPQDDRNPYSC-PPGPRHLGAFVSNLGYQLWYKEIVGGVLAVSMADYRAVNGYSNQFWAWGGEDDDMGQRIL-SLNYTIERPNPETGRYSMLKHVKRKRTAPKLIYK--LLGNSANRVAYDGLNETDKWTIRKVTTRPLYYHLYVDVGPVPEEW 383          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Celegans
Match: bre-4 (Beta-1,4-N-acetylgalactosaminyltransferase bre-4 [Source:UniProtKB/Swiss-Prot;Acc:Q9GUM2])

HSP 1 Score: 147.517 bits (371), Expect = 3.389e-42
Identity = 76/204 (37.25%), Postives = 117/204 (57.35%), Query Frame = 2
Query:  491 LLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGYK--RIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDI 1096
            +L  LH +L +Q + Y IFI+EQ+ ++ FN+G++ N G+     ++ + C IFHD DL+PE  +  Y C      H++ A+D  NY LPYS + GG+ A        +NG+SN +WGWG EDDD+  R  +  G K  R P  + RYK +KH       +   R  ++  T ++R   DGL++LKY+++    K LYT  +VD+
Sbjct:    1 MLHNLHSLLAKQQLDYAIFIVEQVANQTFNRGKLMNVGYDVASRLYPWQCFIFHDVDLLPEDDRNLYTC-PIQPRHMSVAIDKFNYKLPYSAIFGGISALTKDHLKKINGFSNDFWGWGGEDDDLATR-TSMAGLKVSRYPTQIARYKMIKHSTEATNPVNKCRYKIMGQT-KRRWTRDGLSNLKYKLVNLELKPLYTRAVVDL 201          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Fly
Match: beta4GalNAcTA (gene:FBgn0027538 transcript:FBtr0087539)

HSP 1 Score: 163.696 bits (413), Expect = 2.996e-46
Identity = 81/220 (36.82%), Postives = 126/220 (57.27%), Query Frame = 2
Query:  392 IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNT-IGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEI 1048
            ++ GG +    C   + +AI++PFR R+   +  L  +H  L +Q + YRIFI+EQ   + FN+  + N G+LE + ++ ++C IFHD DL+P   +  Y C      H++ A+D  N+ LPY ++ GGV A     + +VNG+SN ++GWG EDDDM  RLK+  +   R P N+ RYK +KH+        N +R   L     ++  DG+NS+KY I
Sbjct:  166 LRPGGAFEPENCNAQHHVAIVVPFRDRYAHLLLFLRNIHPFLMKQRIAYRIFIVEQTNGKPFNRAAMMNIGYLEALKLYQWDCFIFHDVDLLPLDDRNLYNC-PRQPRHMSVAIDTLNFRLPYRSIFGGVSAMTREHFQAVNGFSNSFFGWGGEDDDMSNRLKHANLFISRYPVNIARYKMLKHQKEK----ANPKRYENLQNGMSKIEQDGINSIKYSI 380          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Fly
Match: beta4GalNAcTB (gene:FBgn0039625 transcript:FBtr0085419)

HSP 1 Score: 156.377 bits (394), Expect = 3.055e-44
Identity = 90/237 (37.97%), Postives = 126/237 (53.16%), Query Frame = 2
Query:  386 TEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKN-TIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVD 1093
             EI+ GG +    C      AII+P+R R  Q    L  +H  L QQ + YRIF++EQ   + FN+  + N G  ++ + + F C+I HD DL+P +S   Y C +    H++SA+D   + LPY  L GGV+A    QY  +NG SN Y+GWG EDDD+  RL+   I   R      +Y  +KH+        N  R  LL +A  R   DGLNSL Y  + +    L+THI+VD
Sbjct:   92 AEIRPGGEFRPEGCQARYSTAIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQFDHKPFNRAMLFNIG-AQVAAEYGFPCLILHDVDLLPLNSGQIYACSER-PRHMSSALDHWRFRLPYRGLFGGVVAINTAQYQQINGMSNLYYGWGGEDDDLYERLQALNIDICRFAMEFSKYTMLKHKQEQ----PNANRVALLRSATLRQHADGLNSLVYTEMERRMHSLFTHILVD 322          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Fly
Match: beta4GalT7 (gene:FBgn0039258 transcript:FBtr0084755)

HSP 1 Score: 92.0485 bits (227), Expect = 1.173e-20
Identity = 63/222 (28.38%), Postives = 116/222 (52.25%), Query Frame = 2
Query:  443 IAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDT-GALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGYKRIPENV--GRYKTMKHEPTTRFKIQNLRRNV-LLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDI 1096
            +A+++PFR R+ + ++ +P +   L++Q V + IF++ Q+    FN+  + N GF     ++ +  +  HD DL+P +  + Y+   + G LHIA       Y   Y   +GG++  R   +  +NG SN YWGWGLEDD+  +R+++       P+N+  G   T  H      + ++ ++         KR    GL+++KY+I+ K +++L   + V I
Sbjct:   77 MALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVGFQFASDVYDY--IAMHDVDLLPLNDNLLYEYPSSLGPLHIAGPKLHPKY--HYDNFVGGILLVRREHFKQMNGMSNQYWGWGLEDDEFFVRIRDAGLQVTRPQNIKTGTNDTFSHIHNRYHRKRDTQKCFNQKEMTRKRDHKTGLDNVKYKIL-KVHEMLIDQVPVTI 293          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Zebrafish
Match: b4galt3 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-110624-1])

HSP 1 Score: 182.185 bits (461), Expect = 3.734e-53
Identity = 93/240 (38.75%), Postives = 136/240 (56.67%), Query Frame = 2
Query:  392 IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQP 1108
            +  GG++    C   +  AI++P+R R      LL  LH  LQ+Q + Y I+I+ Q G+  FN+ ++ N G  E++    ++C+  HD DL+PE+    Y CH     H++ A+D   Y LPYS   GGV A  P QYL +NG+ N YWGWG EDDD+  R++ + +   R P  +G YK +KH+   +   QN RR  LL        +DGLNSL YE++ K  + LYT++ V+IG  P
Sbjct:  111 VTLGGHYRPPDCEPRHHTAIVVPYRNRQSHLRTLLYHLHPFLQRQQLHYAIYIVHQSGNSTFNRAKLLNVGVREVLKEEDWSCIFLHDVDLLPENDHNTYTCHPQNPTHLSVAMDKFRYRLPYSQYFGGVSAVTPQQYLKMNGFPNQYWGWGGEDDDIAARVRLSGMKIMRPPLAIGHYKMIKHK-GDQGNEQNPRRFDLLKRTRLNWRSDGLNSLTYELLSKKLEPLYTNLSVNIGDDP 349          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Zebrafish
Match: b4galt3 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-110624-1])

HSP 1 Score: 182.185 bits (461), Expect = 3.734e-53
Identity = 93/240 (38.75%), Postives = 136/240 (56.67%), Query Frame = 2
Query:  392 IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQP 1108
            +  GG++    C   +  AI++P+R R      LL  LH  LQ+Q + Y I+I+ Q G+  FN+ ++ N G  E++    ++C+  HD DL+PE+    Y CH     H++ A+D   Y LPYS   GGV A  P QYL +NG+ N YWGWG EDDD+  R++ + +   R P  +G YK +KH+   +   QN RR  LL        +DGLNSL YE++ K  + LYT++ V+IG  P
Sbjct:  111 VTLGGHYRPPDCEPRHHTAIVVPYRNRQSHLRTLLYHLHPFLQRQQLHYAIYIVHQSGNSTFNRAKLLNVGVREVLKEEDWSCIFLHDVDLLPENDHNTYTCHPQNPTHLSVAMDKFRYRLPYSQYFGGVSAVTPQQYLKMNGFPNQYWGWGGEDDDIAARVRLSGMKIMRPPLAIGHYKMIKHK-GDQGNEQNPRRFDLLKRTRLNWRSDGLNSLTYELLSKKLEPLYTNLSVNIGDDP 349          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Zebrafish
Match: b4galt3 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-110624-1])

HSP 1 Score: 182.185 bits (461), Expect = 3.986e-53
Identity = 93/240 (38.75%), Postives = 136/240 (56.67%), Query Frame = 2
Query:  392 IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQP 1108
            +  GG++    C   +  AI++P+R R      LL  LH  LQ+Q + Y I+I+ Q G+  FN+ ++ N G  E++    ++C+  HD DL+PE+    Y CH     H++ A+D   Y LPYS   GGV A  P QYL +NG+ N YWGWG EDDD+  R++ + +   R P  +G YK +KH+   +   QN RR  LL        +DGLNSL YE++ K  + LYT++ V+IG  P
Sbjct:  112 VTLGGHYRPPDCEPRHHTAIVVPYRNRQSHLRTLLYHLHPFLQRQQLHYAIYIVHQSGNSTFNRAKLLNVGVREVLKEEDWSCIFLHDVDLLPENDHNTYTCHPQNPTHLSVAMDKFRYRLPYSQYFGGVSAVTPQQYLKMNGFPNQYWGWGGEDDDIAARVRLSGMKIMRPPLAIGHYKMIKHK-GDQGNEQNPRRFDLLKRTRLNWRSDGLNSLTYELLSKKLEPLYTNLSVNIGDDP 350          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Zebrafish
Match: CR318611.2 (si:dkey-199f5.8 [Source:NCBI gene;Acc:556544])

HSP 1 Score: 173.326 bits (438), Expect = 2.592e-50
Identity = 102/273 (37.36%), Postives = 146/273 (53.48%), Query Frame = 2
Query:  305 VPFCTERS-QFIDIKSMTYNEVTKFAEETE----IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQ 1105
            +P+C ++S   +    +T+      A+       +  GG +    C   +  AIIIP R R      LL  LH  LQ+Q + Y I+II Q G+  FN+ ++ N GF E +    ++C+ FHD DLIPE  +  Y C D    H A A+D   Y LPY    GGV A  P QYL +NG+ N YWGWG EDDD+ +R+    +   R   NVGRYK +KH+     ++   R N+L  T       DG+N+++YEII +  + LY +I V+IGT+
Sbjct:   76 MPYCPKQSPHLVGPIHVTFPSGLTLADVERKNPLVVRGGRYRPPNCEARHRTAIIIPHRSREHHLKFLLYYLHPFLQRQQLNYGIYIIHQAGNYTFNRAKLMNVGFREAMRDEDWDCLFFHDVDLIPEDDRNTYIC-DAHPKHAAIAMDKFGYKLPYKMYFGGVSALSPDQYLKMNGFPNNYWGWGGEDDDIGVRVSLGGMVISRPSINVGRYKMIKHKHDKGNEVNPKRFNMLAKTRHT-WKEDGMNTVEYEIISRDYQPLYANITVNIGTE 346          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Zebrafish
Match: si:dkey-199f5.8 (si:dkey-199f5.8 [Source:ZFIN;Acc:ZDB-GENE-030131-4733])

HSP 1 Score: 172.94 bits (437), Expect = 8.361e-50
Identity = 102/273 (37.36%), Postives = 146/273 (53.48%), Query Frame = 2
Query:  305 VPFCTERS-QFIDIKSMTYNEVTKFAEETE----IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQ 1105
            +P+C ++S   +    +T+      A+       +  GG +    C   +  AIIIP R R      LL  LH  LQ+Q + Y I+II Q G+  FN+ ++ N GF E +    ++C+ FHD DLIPE  +  Y C D    H A A+D   Y LPY    GGV A  P QYL +NG+ N YWGWG EDDD+ +R+    +   R   NVGRYK +KH+     ++   R N+L  T       DG+N+++YEII +  + LY +I V+IGT+
Sbjct:  108 MPYCPKQSPHLVGPIHVTFPSGLTLADVERKNPLVVRGGRYRPPNCEARHRTAIIIPHRSREHHLKFLLYYLHPFLQRQQLNYGIYIIHQAGNYTFNRAKLMNVGFREAMRDEDWDCLFFHDVDLIPEDDRNTYIC-DAHPKHAAIAMDKFGYKLPYKMYFGGVSALSPDQYLKMNGFPNNYWGWGGEDDDIGVRVSLGGMVISRPSINVGRYKMIKHKHDKGNEVNPKRFNMLAKTRHTWK-EDGMNTVEYEIISRDYQPLYANITVNIGTE 378          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Xenopus
Match: fbln2 (fibulin 2 [Source:Xenbase;Acc:XB-GENE-959371])

HSP 1 Score: 181.8 bits (460), Expect = 1.198e-53
Identity = 92/240 (38.33%), Postives = 139/240 (57.92%), Query Frame = 2
Query:  392 IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQP 1108
            +K GGY+    C      A+IIP+R R      LL  LH  LQ+Q + Y +FI+ Q G+  FN+ ++ N G  E + +  ++C++ HD DL+PE+    Y C +    H+ASA+D  +Y LPY T  GGV A  P  Y+ +NG  N YWGWG EDDD+ +R++   +   R P +VGRYK + H+  +  ++ N +R   L+   +    DG+NSL ++++ +T   LYT+I VDIG  P
Sbjct:   81 VKPGGYFSPRHCFGRYRTAVIIPYRNREPHLRTLLYYLHPFLQRQQLHYAVFIVHQAGNGTFNRAKLLNIGVREALKLDDWDCLVLHDVDLVPENDYNLYICDEEYPKHLASAMDKFDYSLPYWTYFGGVSALTPDHYMRINGLPNNYWGWGGEDDDIAMRIRLAGMSIARTPLSVGRYKMISHDRDSGNEV-NSQRYDQLSNTRQTWREDGMNSLDFKLLSRTKAALYTNITVDIGEPP 319          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Xenopus
Match: ranbp2 (RAN binding protein 2 [Source:Xenbase;Acc:XB-GENE-492821])

HSP 1 Score: 176.022 bits (445), Expect = 3.764e-51
Identity = 104/272 (38.24%), Postives = 146/272 (53.68%), Query Frame = 2
Query:  305 VPFCTERSQFIDIKSMTYNEVTKFAEETE-----IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGT 1102
            +PFC E S +I              EE E     +  GG +    C + +  A+IIP RGR      LL  LH  LQ+Q + Y I+II Q G+  FN+ ++ N GF E +    ++C+ +HD DLIPE  +  Y C D    H + A+D   Y LPY +  GGV A  P QY+ +NG+ N YWGWG EDDD+ IR+  + +   R     GRYK +KH    +   QN +R  +LT   +    DG+NSL+Y ++ K  + LYT+I V+IGT
Sbjct:   78 LPFCPETSPYIGGPIRVTLPENLLLEEVEKKNPYVSKGGRYKPPDCESTHKTAVIIPHRGREQHLKYLLYYLHPFLQRQQLNYGIYIIHQAGNFTFNRAKLLNVGFKEAMKDEDWDCLFYHDVDLIPEDDRNIYTC-DKFPKHASIAMDKFGYKLPYKSYFGGVSALSPEQYMKMNGFPNNYWGWGGEDDDIGIRVALSGMIISRPSIQHGRYKMIKHG-HDKGNEQNPKRFNMLTKTRRTWRQDGMNSLQYLLLSKELQPLYTNITVNIGT 347          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Xenopus
Match: B4GALT2 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 [Source:NCBI gene;Acc:100492356])

HSP 1 Score: 171.785 bits (434), Expect = 2.185e-49
Identity = 93/244 (38.11%), Postives = 130/244 (53.28%), Query Frame = 2
Query:  380 EETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQP 1108
            E  ++  GG +    C     +AIIIPFR R       L  LH IL++Q V Y I+II Q G + FN+ ++ N GFLE +    ++C IF D DLIP   +  Y C++    H A A+D   + LPY+   GGV      Q+L +NG+ N YWGWG EDDD+  R+  N +   R    +GRY+ +KHE   +    N +R   +   +  M  DG+NSL Y +I      +YT+I VDIG  P
Sbjct:  127 ENPDVTEGGRYTPPDCQPKEKVAIIIPFRHREHHLKYWLHYLHPILRRQKVAYGIYIINQFGEDTFNRAKLLNVGFLEAMKEADYDCFIFSDVDLIPMDDRNLYHCYEQ-PRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLKINGFPNEYWGWGGEDDDIYNRITLNGMKISRPDIRIGRYRMIKHE-RDKHNEPNPQRFTKIQNTKMTMKKDGINSLHYRVIHSAKYPMYTNITVDIGKPP 368          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Xenopus
Match: B4GALT3 (beta-1,4-galactosyltransferase 3-like [Source:NCBI gene;Acc:100486704])

HSP 1 Score: 169.474 bits (428), Expect = 2.184e-48
Identity = 92/242 (38.02%), Postives = 132/242 (54.55%), Query Frame = 2
Query:  392 IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGYK--RIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPR 1111
            +  GG +    C   +  AIIIP R R      LL  LH  LQ+Q + YRI+II Q G+  FN+ ++ N G  E +    ++C+  HD DLIPE+    Y C      H + A++  +Y LPY    GGV A  P QY+ +NG+ N YWGWG EDDD+  R++   G K  R   +VG YK +KH+   +   +N  R  LL   ++    DG+NSL Y ++ +  + LYT++ VD+G  PR
Sbjct:   24 VTRGGEYKPPNCEARHRTAIIIPHRNRETHLRHLLYYLHPFLQRQQLHYRIYIINQAGNATFNRAKLLNVGVKEALRDEEWDCLFLHDVDLIPENDYNLYVCDPWNPKHASVAMNKFSYSLPYPQYFGGVSALTPDQYMKMNGFPNEYWGWGGEDDDIATRVR-LAGMKITRPSVSVGHYKMVKHK-VDQGNEENPHRFDLLIRTQRMWKADGMNSLTYTLLERALEPLYTNVTVDVGEDPR 263          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Xenopus
Match: nkx6-3 (NK6 homeobox 3 [Source:Xenbase;Acc:XB-GENE-478609])

HSP 1 Score: 161.77 bits (408), Expect = 1.196e-45
Identity = 83/234 (35.47%), Postives = 135/234 (57.69%), Query Frame = 2
Query:  401 GGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGYKRIPEN-VGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIG 1099
            GG++    C     +AIIIPFR R       L  +H IL++Q + Y +++I Q G + FN+ ++ N G++E +  ++++C +F D DLIP   +  Y+C +    H+++A+D   + LPY+   GGV A    Q+L +NG+ N YWGWG EDDD+  R+ +   Y   P+  +GR + ++H    +    N +R  LL    + M +DG+N+L Y+++  T   LYT+I VDIG
Sbjct:  128 GGHYRPKDCNALQKVAIIIPFRNRDEHLKYWLYYMHPILKRQQLDYGVYVINQDGDKTFNRAKLLNIGYVESLKDYAYDCFVFSDVDLIPMDDRNTYRCFNQ-PRHLSAAMDKFGFGLPYNQFFGGVSALSKEQFLKINGFPNNYWGWGGEDDDIYNRIASRGMYISRPDTLIGRCRMIRHNRDDK-NDPNPKRFDLLAHTRQTMDSDGINTLSYKVVSTTRFPLYTYITVDIG 359          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Mouse
Match: B4galt3 (UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 3 [Source:MGI Symbol;Acc:MGI:1928767])

HSP 1 Score: 181.8 bits (460), Expect = 4.148e-53
Identity = 102/273 (37.36%), Postives = 147/273 (53.85%), Query Frame = 2
Query:  311 FCTERSQF-IDIKSMTYNEVTKFAEETE----IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPR 1111
            +C ERS F +   S++++ V   AE  E    ++ GG +  + C   +  AII+P R R      LL  LH  LQ+Q + Y I++I Q G+  FN+ ++ N G  E +    ++C+  HD DL+PE+    Y C   G  H+A A++   Y LPY    GGV A  P QYL +NG+ N YWGWG EDDD+  R++   +   R P +VG YK +KH    +   +N  R  LL   +     DG+NSL Y ++ +    LYT+I  DIGT PR
Sbjct:   78 YCPERSPFLVGPVSVSFSPVPSLAEIVERNPRVESGGRYRPAGCEPRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHR-GDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYRLLARELGPLYTNITADIGTDPR 349          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Mouse
Match: B4galt3 (UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 3 [Source:MGI Symbol;Acc:MGI:1928767])

HSP 1 Score: 181.8 bits (460), Expect = 4.148e-53
Identity = 102/273 (37.36%), Postives = 147/273 (53.85%), Query Frame = 2
Query:  311 FCTERSQF-IDIKSMTYNEVTKFAEETE----IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPR 1111
            +C ERS F +   S++++ V   AE  E    ++ GG +  + C   +  AII+P R R      LL  LH  LQ+Q + Y I++I Q G+  FN+ ++ N G  E +    ++C+  HD DL+PE+    Y C   G  H+A A++   Y LPY    GGV A  P QYL +NG+ N YWGWG EDDD+  R++   +   R P +VG YK +KH    +   +N  R  LL   +     DG+NSL Y ++ +    LYT+I  DIGT PR
Sbjct:   78 YCPERSPFLVGPVSVSFSPVPSLAEIVERNPRVESGGRYRPAGCEPRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHR-GDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYRLLARELGPLYTNITADIGTDPR 349          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Mouse
Match: B4galt1 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1 [Source:MGI Symbol;Acc:MGI:95705])

HSP 1 Score: 170.629 bits (431), Expect = 9.743e-49
Identity = 105/279 (37.63%), Postives = 146/279 (52.33%), Query Frame = 2
Query:  296 LHSVPFCTERSQF------IDIKSMTYNEVTKFAEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRL-KNTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPR 1111
            L S+P C E S        ID       E+    +  EIK GG +    C++ + +AIIIPFR R       L  LH ILQ+Q + Y I++I Q G   FN+ ++ N GF E +  + +NC +F D DLIP   +  Y+C  +   HI+ A+D   + LPY    GGV A    Q+L++NG+ N YWGWG EDDD+  RL    +   R    VGR + ++H    + +    R + +  T E   F DGLNSL Y+++      LYT I VDIGT PR
Sbjct:  125 LLSLPACPEESPLLVGPMLIDFNIAVDLELLA-KKNPEIKTGGRYSPKDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGDTMFNRAKLLNIGFQEALKDYDYNCFVFSDVDLIPMDDRNAYRCF-SQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLAINGFPNNYWGWGGEDDDIFNRLVHKGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMRF-DGLNSLTYKVLDVQRYPLYTQITVDIGT-PR 399          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Mouse
Match: B4galt5 (UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5 [Source:MGI Symbol;Acc:MGI:1927169])

HSP 1 Score: 166.007 bits (419), Expect = 3.817e-47
Identity = 91/243 (37.45%), Postives = 138/243 (56.79%), Query Frame = 2
Query:  374 FAEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGY--KRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDI 1096
            F+ +  IK GG+W  + C+    +AI+IPFR R      LL  L  +LQ+Q + +  ++IEQ+G++ FN+  + N GF E +    ++C+IFHD D IPES +  Y C      H A+ +D   Y+LPY+   GGV      Q+  +NG+ N +WGWG EDDD+  R++N  GY   R   + G+YK++ H    R ++Q L R  LL  +++R   DGLN+L Y     T   LY +I V++
Sbjct:  141 FSRDPAIKLGGHWKPADCVPRWKVAILIPFRNRHEHLPVLLRHLLPMLQRQRLQFAFYVIEQVGTQPFNRAMLFNVGFQEAMKDLDWDCLIFHDVDHIPESDRNYYGCGQM-PRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVQNA-GYSVSRPEGDTGKYKSIPHH--HRGEVQFLGRYALLRKSKERQGLDGLNNLNYS-ANVTYDALYKNITVNL 378          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Mouse
Match: B4galt4 (UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4 [Source:MGI Symbol;Acc:MGI:1928387])

HSP 1 Score: 155.221 bits (391), Expect = 1.759e-43
Identity = 96/268 (35.82%), Postives = 143/268 (53.36%), Query Frame = 2
Query:  308 PFCTERSQFIDIKSMTYNEVTKFAEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQ--NLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGT 1102
            P    +S+ +    +T  E+   AE  ++  G Y  + +C     +AI+IP R R    + LL  LH  LQ+Q + Y I+II Q GS+ FN+ ++ N G+LE +   +++C +FHD DL+PE+    Y C D    H+    +   Y L YS   GGV A    Q+L VNG+SN YWGWG EDDD+ +R++ + +   R   +VG+Y  + H   TR K    N+ R  LL    +   TDGL+S  Y ++   +  LY +I VD  T
Sbjct:   82 PNLRGQSKLVFKPDLTLEEIE--AENPKVSRGRYHPE-ECKALQRVAILIPHRNREKHLIYLLEHLHPFLQRQQLDYGIYIIHQTGSKKFNRAKLLNVGYLEALKEENWDCFVFHDVDLVPENDFNLYTCGDQ-PKHLVVGRNSTGYRLRYSKYFGGVTALSREQFLKVNGFSNNYWGWGGEDDDLRLRVELHKMKISRPKPDVGKYTMIFH---TRDKGNEVNMGRMKLLQQMSRVWKTDGLSSCSYRLLSVEHNPLYANITVDFWT 342          
BLAST of beta-1,4-galactosyltransferase 4-like vs. UniProt/SwissProt
Match: sp|Q80WN8|B4GT3_CRIGR (Beta-1,4-galactosyltransferase 3 OS=Cricetulus griseus OX=10029 GN=B4GALT3 PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 4.440e-56
Identity = 107/297 (36.03%), Postives = 157/297 (52.86%), Query Frame = 2
Query:  239 IHQKMKLLESSPKLCDIKLLHSVPFCTERSQF-IDIKSMTYNEVTKFAEETE----IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPR 1111
            ++  +  L  +P         ++PFC ERS F +   S++++ V   AE  E    ++ GG +  + C   +  AII+P R R      LL  LH  LQ+Q + Y I++I Q G+  FN+ ++ N G  E +    ++C+  HD DL+PE+    Y C   G  H+A A++   Y LPY    GGV A  P QYL +NG+ N YWGWG EDDD+  R++   +   R P +VG YK +KH    +   +N  R  LL   +     DG+NSL Y+++ K    LYT+I  DIGT PR
Sbjct:   54 VYSNLSHLPGAPVAAGASPAEALPFCPERSPFLVGPVSVSFSPVPSLAEIVERNPRVEPGGRYRPAGCEARSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGMFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHR-GDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLAKELGPLYTNITADIGTDPR 349          
BLAST of beta-1,4-galactosyltransferase 4-like vs. UniProt/SwissProt
Match: sp|Q5EA87|B4GT3_BOVIN (Beta-1,4-galactosyltransferase 3 OS=Bos taurus OX=9913 GN=B4GALT3 PE=2 SV=2)

HSP 1 Score: 182.956 bits (463), Expect = 1.263e-52
Identity = 101/276 (36.59%), Postives = 150/276 (54.35%), Query Frame = 2
Query:  302 SVPFCTERSQF-IDIKSMTYNEVTKFAEETE----IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPR 1111
             +P+C +RS   +   S++++ V   AE  E    ++ GG +  ++C   +  AII+P R R      LL  LH  LQ+Q + Y I++I Q G+  FN+ ++ N G  E +    ++C+  HD DL+PE+    Y C   G  H+A A++   Y LPY    GGV A  P QYL +NG+ N YWGWG EDDD+  R++   +   R P +VG YK +KH    +   +N  R  LL   +     DG+NSL Y+++ +    LYT+I  DIGT PR
Sbjct:   76 GLPYCPKRSPLLVGPISVSFSPVPSLAEIVERNPRVEPGGRYRPARCEPRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHR-GDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLSRELGPLYTNITADIGTDPR 350          
BLAST of beta-1,4-galactosyltransferase 4-like vs. UniProt/SwissProt
Match: sp|Q6P768|B4GT3_RAT (Beta-1,4-galactosyltransferase 3 OS=Rattus norvegicus OX=10116 GN=B4galt3 PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.005e-52
Identity = 103/275 (37.45%), Postives = 148/275 (53.82%), Query Frame = 2
Query:  305 VPFCTERSQF-IDIKSMTYNEVTKFAEETE----IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPR 1111
            +P C ERS F +   S++++ V   AE  E    ++ GG +  + C   +  AII+P R R      LL  LH  LQ+Q + Y I++I Q G+  FN+ ++ N G  E +    ++C+  HD DL+PE+    Y C   G  H+A A++   Y LPY    GGV A  P QYL +NG+ N YWGWG EDDD+  R++   +   R P +VG YK +KH    +   +N  R  LL   +     DG+NSL Y ++ +    LYT+I  DIGT PR
Sbjct:   76 LPDCPERSPFLVGPVSVSFSPVPSLAEIVERNPRVESGGRYRPAGCEPRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHR-GDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYRLLARELGPLYTNITADIGTDPR 349          
BLAST of beta-1,4-galactosyltransferase 4-like vs. UniProt/SwissProt
Match: sp|Q91YY2|B4GT3_MOUSE (Beta-1,4-galactosyltransferase 3 OS=Mus musculus OX=10090 GN=B4galt3 PE=1 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 2.901e-52
Identity = 102/273 (37.36%), Postives = 147/273 (53.85%), Query Frame = 2
Query:  311 FCTERSQF-IDIKSMTYNEVTKFAEETE----IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPR 1111
            +C ERS F +   S++++ V   AE  E    ++ GG +  + C   +  AII+P R R      LL  LH  LQ+Q + Y I++I Q G+  FN+ ++ N G  E +    ++C+  HD DL+PE+    Y C   G  H+A A++   Y LPY    GGV A  P QYL +NG+ N YWGWG EDDD+  R++   +   R P +VG YK +KH    +   +N  R  LL   +     DG+NSL Y ++ +    LYT+I  DIGT PR
Sbjct:   78 YCPERSPFLVGPVSVSFSPVPSLAEIVERNPRVESGGRYRPAGCEPRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHR-GDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYRLLARELGPLYTNITADIGTDPR 349          
BLAST of beta-1,4-galactosyltransferase 4-like vs. UniProt/SwissProt
Match: sp|O60512|B4GT3_HUMAN (Beta-1,4-galactosyltransferase 3 OS=Homo sapiens OX=9606 GN=B4GALT3 PE=1 SV=2)

HSP 1 Score: 179.874 bits (455), Expect = 1.499e-51
Identity = 101/273 (37.00%), Postives = 147/273 (53.85%), Query Frame = 2
Query:  311 FCTERSQF-IDIKSMTYNEVTKFAEETE----IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPR 1111
            +C ERS   +   S++++ V   AE  E    ++ GG +  + C   +  AII+P R R      LL  LH  LQ+Q + Y I++I Q G+  FN+ ++ N G  E +    ++C+  HD DL+PE+    Y C   G  H+A A++   Y LPY    GGV A  P QYL +NG+ N YWGWG EDDD+  R++   +   R P +VG YK +KH    +   +N  R  LL   +     DG+NSL Y+++ +    LYT+I  DIGT PR
Sbjct:   76 YCPERSPLLVGPVSVSFSPVPSLAEIVERNPRVEPGGRYRPAGCEPRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHR-GDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPR 347          
BLAST of beta-1,4-galactosyltransferase 4-like vs. TrEMBL
Match: A0A1I8I9I3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 3.700e-85
Identity = 127/248 (51.21%), Postives = 167/248 (67.34%), Query Frame = 2
Query:  386 TEIKYGGYWVQS-KCITDNMIAIIIPFRGRWLQTMELLPVLHQILQ-QQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK--NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPREF 1117
            T I  GG W  S KC     +AI+IPFR RW Q   LL VLH +LQ QQ+ CYR+F++EQ G  AFNKGR+NNAGFLE +   +F CVIF DTD++PE+ + PY C      H+A AVD N Y LPY+ L+GGVIAF    +  VNGYSN YWGWGLEDDDME+R+K    + Y+R P +V R+K + H     +++Q  RR  LL TA +R   DGLN++KY ++  +N+ L+TH+++DIG QP +F
Sbjct:   11 TRILPGGAWCPSAKCRHQQSLAIVIPFRDRWRQLRNLLSVLHPMLQRQQSGCYRVFVVEQYGGGAFNKGRLNNAGFLEAMRRHNFTCVIFQDTDIVPENDRNPYLCGSVRPRHLAVAVDTNRYRLPYAALVGGVIAFTTRHFFRVNGYSNLYWGWGLEDDDMELRMKIGTKLKYERPPASVARFKALPHASQRIYRLQASRRMPLLKTALQRYSKDGLNTVKYRVLFSSNEPLFTHLLIDIGEQPLDF 258          
BLAST of beta-1,4-galactosyltransferase 4-like vs. TrEMBL
Match: A0A1I8G124 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 1.048e-84
Identity = 127/249 (51.00%), Postives = 167/249 (67.07%), Query Frame = 2
Query:  383 ETEIKYGGYWVQS-KCITDNMIAIIIPFRGRWLQTMELLPVLHQILQ-QQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK--NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPREF 1117
             T I  GG W  S KC     +AI+IPFR RW Q   LL VLH +LQ QQ+ CYR+F++EQ G  AFNKGR+NNAGFLE +   +F CVIF DTD++PE+ + PY C      H+A AVD N Y LPY+ L+GGVIAF    +  VNGYSN YWGWGLEDDDME+R+K    + Y+R P +V R+K + H     +++Q  RR  LL TA +R   DGLN++KY ++  +N+ L+TH+++DIG QP +F
Sbjct:   47 STRILPGGAWCPSAKCRHQQSLAIVIPFRDRWRQLRNLLSVLHPMLQRQQSGCYRVFVVEQYGGGAFNKGRLNNAGFLEAMRRHNFTCVIFQDTDIVPENDRNPYLCGSVRPRHLAVAVDTNRYRLPYAALVGGVIAFTTRHFFRVNGYSNLYWGWGLEDDDMELRMKIGTKLKYERPPASVARFKALPHASQRIYRLQASRRMPLLKTALQRYSKDGLNTVKYRVLFSSNEPLFTHLLIDIGEQPLDF 295          
BLAST of beta-1,4-galactosyltransferase 4-like vs. TrEMBL
Match: A0A267FGV4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019227g2 PE=4 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 4.257e-83
Identity = 127/249 (51.00%), Postives = 167/249 (67.07%), Query Frame = 2
Query:  383 ETEIKYGGYWVQS-KCITDNMIAIIIPFRGRWLQTMELLPVLHQILQ-QQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK--NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPREF 1117
             T I  GG W  S KC     +AI+IPFR RW Q   LL VLH +LQ QQ+ CYR+F++EQ G  AFNKGR+NNAGFLE +   +F CVIF DTD++PE+ + PY C      H+A AVD N Y LPY+ L+GGVIAF    +  VNGYSN YWGWGLEDDDME+R+K    + Y+R P +V R+K + H     +++Q  RR  LL TA +R   DGLN++KY ++  +N+ L+TH+++DIG QP +F
Sbjct:  211 STRILPGGAWCPSAKCRHQQSLAIVIPFRDRWRQLRNLLSVLHPMLQRQQSGCYRVFVVEQYGGGAFNKGRLNNAGFLEAMRRHNFTCVIFQDTDIVPENDRNPYLCGSVRPRHLAVAVDTNRYRLPYAALVGGVIAFTTRHFFRVNGYSNLYWGWGLEDDDMELRMKIGTKLKYERPPASVARFKALPHASQRIYRLQASRRMPLLKTALQRYSKDGLNTVKYRVLFSSNEPLFTHLLIDIGEQPLDF 459          
BLAST of beta-1,4-galactosyltransferase 4-like vs. TrEMBL
Match: A0A267GUX3 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013190g1 PE=4 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 4.330e-83
Identity = 127/249 (51.00%), Postives = 167/249 (67.07%), Query Frame = 2
Query:  383 ETEIKYGGYWVQS-KCITDNMIAIIIPFRGRWLQTMELLPVLHQILQ-QQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK--NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPREF 1117
             T I  GG W  S KC     +AI+IPFR RW Q   LL VLH +LQ QQ+ CYR+F++EQ G  AFNKGR+NNAGFLE +   +F CVIF DTD++PE+ + PY C      H+A AVD N Y LPY+ L+GGVIAF    +  VNGYSN YWGWGLEDDDME+R+K    + Y+R P +V R+K + H     +++Q  RR  LL TA +R   DGLN++KY ++  +N+ L+TH+++DIG QP +F
Sbjct:  212 STRILPGGAWCPSAKCRHQQSLAIVIPFRDRWRQLRNLLSVLHPMLQRQQSGCYRVFVVEQYGGGAFNKGRLNNAGFLEAMRRHNFTCVIFQDTDIVPENDRNPYLCGSVRPRHLAVAVDTNRYRLPYAALVGGVIAFTTRHFFRVNGYSNLYWGWGLEDDDMELRMKIGTKLKYERPPASVARFKALPHASQRIYRLQASRRMPLLKTALQRYSKDGLNTVKYRVLFSSNEPLFTHLLIDIGEQPLDF 460          
BLAST of beta-1,4-galactosyltransferase 4-like vs. TrEMBL
Match: A0A1I8HUT0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 1.455e-79
Identity = 127/273 (46.52%), Postives = 167/273 (61.17%), Query Frame = 2
Query:  383 ETEIKYGGYWVQS-KCITDNMIAIIIPFRGRWLQTMELLPVLHQILQ-QQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFH------------------------DTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK--NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPREF 1117
             T I  GG W  S KC     +AI+IPFR RW Q   LL VLH +LQ QQ+ CYR+F++EQ G  AFNKGR+NNAGFLE +   +F CVIF                         DTD++PE+ + PY C      H+A AVD N Y LPY+ L+GGVIAF    +  VNGYSN YWGWGLEDDDME+R+K    + Y+R P +V R+K + H     +++Q  RR  LL TA +R   DGLN++KY ++  +N+ L+TH+++DIG QP +F
Sbjct:   10 STRILPGGAWCPSAKCRHQQSLAIVIPFRDRWRQLRNLLSVLHPMLQRQQSGCYRVFVVEQYGGGAFNKGRLNNAGFLEAMRRHNFTCVIFQSARARPLGYGSLMFTCNCPINAFQDTDIVPENDRNPYLCGSVRPRHLAVAVDTNRYRLPYAALVGGVIAFTTRHFFRVNGYSNLYWGWGLEDDDMELRMKIGTKLKYERPPASVARFKALPHASQRIYRLQASRRMPLLKTALQRYSKDGLNTVKYRVLFSSNEPLFTHLLIDIGEQPLDF 282          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Cavefish
Match: b4galt3 (beta-1,4-galactosyltransferase 3 [Source:NCBI gene;Acc:103022975])

HSP 1 Score: 178.718 bits (452), Expect = 8.928e-52
Identity = 92/237 (38.82%), Postives = 134/237 (56.54%), Query Frame = 2
Query:  401 GGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQP 1108
            GG++    C   +  AI++P+R R      LL  LH  LQ+Q + Y I+I+ Q G+  FN+ ++ N G  E +   S++C+  HD DL+PE+    Y CH     H++ A+D   Y LPY    GGV A  P QYL +NG+ N YWGWG EDDD+  R++ + +   R P  +G YK +KH+   +   QN RR  LL        +DGL+SL YE++ K  + LYT++ V+IG  P
Sbjct:  117 GGHYRPPDCEPRHHTAIVVPYRNRQSHLRALLYHLHPFLQRQQIHYSIYIVHQSGNATFNRAKLLNVGVREALKEDSWSCIFLHDVDLLPENDHNTYTCHPQYPTHLSVAMDKFRYRLPYPQYFGGVSAVTPDQYLKMNGFPNQYWGWGGEDDDIATRVRLSGMKIVRPPVAIGHYKMIKHK-GDQGNEQNPRRFDLLKRTRLNWRSDGLSSLTYELLSKELEPLYTNLSVNIGEDP 352          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Cavefish
Match: si:dkey-199f5.8 (beta-1,4-galactosyltransferase 3-like [Source:NCBI gene;Acc:103031892])

HSP 1 Score: 176.407 bits (446), Expect = 3.516e-51
Identity = 103/284 (36.27%), Postives = 149/284 (52.46%), Query Frame = 2
Query:  278 LCDIKLLHSVPFCTERSQFID-------IKSMTYNEVTKFAEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQ 1105
            L +++    VP+C ++S              +T  ++ +  +   +  GG +    C   +  AIIIP R R      LL  LH  LQ+Q + Y I++I Q G+  FN+ ++ N GF E +    +NC+ FHD DLIPE  +  Y C D    H A A+D   Y LPY    GGV A  P  YL +NG+ N YWGWG EDDD+ IR+    +   R    VGRYK +KH+     ++   R N+L  T +     DG+NS +YE+I + +  LYT+I V+IGT+
Sbjct:   70 LVNVQSKDDVPYCPKKSPLTGGPIHVSFPSGLTMAQIER--KNPLVVRGGRYRPPDCEARHRTAIIIPHRNRENHLKFLLYYLHPFLQRQQLNYAIYVIHQAGNYTFNRAKLMNVGFREAMREEDWNCLFFHDVDLIPEDDRNTYTC-DQNPKHAAIAMDKFGYKLPYKMYFGGVSALSPLHYLKMNGFPNNYWGWGGEDDDIGIRVSLAGMVITRPSVKVGRYKMIKHKLDQGNEVNPKRFNMLAKTRQTWKL-DGMNSAEYEVISREHLPLYTNITVNIGTE 349          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Cavefish
Match: b4galt1 (beta-1,4-galactosyltransferase 1-like [Source:NCBI gene;Acc:103028729])

HSP 1 Score: 162.54 bits (410), Expect = 4.663e-46
Identity = 82/241 (34.02%), Postives = 135/241 (56.02%), Query Frame = 2
Query:  380 EETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIG 1099
            ++  +  GG +   +C++ + +A+IIP+R R       L  LH ILQ+Q + Y +++I+Q G + FN+ ++ N G+ E +  + +NC +F D DL+P   +  Y+C D    H+A ++D   + LPY+   GGV A    Q+L +NG+ N YWGWG EDDD+  RL    +   R    +GR K ++H    +    N +R   +    + + TDG+N+L Y +++     L+T IIVDIG
Sbjct:  132 QDPRLSEGGRYTPRECVSPHKVALIIPYRNRENHLKYWLYYLHPILQRQQLDYGVYVIQQDGEDTFNRAKLLNVGYAEALKEYDYNCFVFSDVDLVPVDDRNIYRCFDQ-PRHLAVSMDKFGFRLPYNQYFGGVSAMSKEQFLKINGFPNNYWGWGGEDDDIYNRLTYRGMSVSRPDGVIGRCKMIQHN-RDKMNEPNPQRFDRIARTRQTINTDGINTLTYTVVKTEKDKLFTKIIVDIG 370          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Cavefish
Match: b4galt2 (beta-1,4-galactosyltransferase 2 [Source:NCBI gene;Acc:103033307])

HSP 1 Score: 162.155 bits (409), Expect = 8.318e-46
Identity = 93/254 (36.61%), Postives = 133/254 (52.36%), Query Frame = 2
Query:  350 MTYNEVTKFAEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQP 1108
            MT   V +  E   +  GG +  + C     +AIIIPFR R       L  LH IL++Q + Y I+II QLG + FN+ ++ N G+ E +    ++C IF D DLIP   +  Y C+D    H A A+D   + LPY+   GGV      Q+L +NG+ N YWGWG EDDD+  R+  N +   R    +GRY+ +KHE   +    N +R   +   +  M  DG++SL Y +       LYT+I V+IG  P
Sbjct:  126 MTMERVQR--ENPNVTEGGKYTPTDCRPKQKVAIIIPFRHRDHHLKYWLHYLHPILRRQKIDYGIYIINQLGEDTFNRAKLLNVGYTEALKDAEYDCFIFSDVDLIPMDDRNLYHCYDQ-PRHFAIAMDKFGFRLPYAGYFGGVSGLSKKQFLKINGFPNEYWGWGGEDDDIYNRITLNGMKVSRPDVRIGRYRMIKHE-RDKHNEPNPQRFNKIQNTKNTMRKDGISSLTYRLASVKKYPLYTNISVEIGKPP 375          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Cavefish
Match: b4galt1l (beta-1,4-galactosyltransferase 1-like [Source:NCBI gene;Acc:103039461])

HSP 1 Score: 160.229 bits (404), Expect = 2.182e-45
Identity = 85/246 (34.55%), Postives = 134/246 (54.47%), Query Frame = 2
Query:  377 AEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNT-IGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPR 1111
            +E   ++ GG +    CI    +AIIIPFR R       L  LH ILQ+Q + Y ++II Q G E FN+ ++ N G+ E +  + + C +F D DLIP   +  YKC  +   H++ ++D   + LPY+   GGV +    Q+L +NG+ N YWGWG EDDD+  RL +  +   R    +G+ + ++H+   +      R + +  T E  M  DG+NSL Y++++     L+T I VD+G  P+
Sbjct:  113 SENPALQEGGRFKPKDCIALQKVAIIIPFRKRDEHLKFWLYYLHPILQRQQLDYGVYIINQDGDETFNRAKLLNVGYAEALKEYGYECFVFSDVDLIPMDDRNTYKCF-SQPRHLSVSMDKFGFRLPYNQYFGGVSSMSKEQFLKINGFPNNYWGWGGEDDDIFNRLSSKGMSISRPSGAIGKCRMIRHDRDKQNDPNPQRFDRIAHTRET-MHKDGINSLSYKVVKVEKDQLFTKITVDLGEAPK 356          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Sea Lamprey
Match: b4galt2 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-070912-258])

HSP 1 Score: 167.548 bits (423), Expect = 8.680e-49
Identity = 89/256 (34.77%), Postives = 139/256 (54.30%), Query Frame = 2
Query:  344 KSMTYNEVTKFAEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIR-LKNTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQP 1108
            K+ T  EV K     E+  GG +    C++   +AIIIPFR R       L  LH +LQ+Q V Y ++++ Q G   FN+ ++ N G++E +    ++C IF D DL+P   +  Y+C+D    H + A+D  ++ LPY++  GGV      QYL +NG+ N YWGWG EDDD+  R +   +   R   ++GRY+ +KH    + +  N +R   +      M  DG+N+LKY  +    + LYT++ VD+G  P
Sbjct:  113 KTPTLEEVQKSNPNVEL--GGRFRPKDCLSSQKVAIIIPFRHRDEHLKHWLYYLHPVLQRQRVEYGVYVLNQFGEGMFNRAKLMNIGYVEALKDAPYDCFIFSDVDLVPMDDRNLYRCYDN-PRHFSVAMDKFSFRLPYNSYFGGVSGLSKAQYLKINGFPNEYWGWGGEDDDIYNRVVVQGMRLSRPDGSLGRYRMVKHARDAKNE-PNPKRFTQIKNTRHNMGRDGINTLKYRHVETVRQPLYTNVTVDVGKMP 364          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Sea Lamprey
Match: B4GALT1 (beta-1,4-galactosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:924])

HSP 1 Score: 164.466 bits (415), Expect = 2.338e-48
Identity = 85/239 (35.56%), Postives = 133/239 (55.65%), Query Frame = 2
Query:  392 IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNT-IGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQ 1105
            ++ GG +  S CI    +AII+PFR R       L  LH ILQ+Q V Y ++I+ Q G   FN+ ++ N G++E +    ++C IF D DL+P   +  Y+C+D    H + AVD  N+ LPY    GGV      Q+  +NG+ N YWGWG EDDD+  R++   +   R    +GRY+ ++H      +  N  R+  +T     M+ DG+N+L+Y++I+     LYT +IV++G +
Sbjct:   53 VELGGQFHPSDCIPSQKVAIIVPFRHRDEHLKHWLYYLHPILQRQRVEYGVYIVNQFGEGVFNRAKLMNIGYVEALKDAPYDCFIFSDVDLVPMDDRNLYRCYDN-PRHFSVAVDKFNFSLPYKECFGGVSGLTKKQFEKINGFPNNYWGWGGEDDDIYNRIRKVGMNISRPDMTIGRYRMIRHNRDAHNE-NNPFRSWQITKTAFTMWRDGINTLEYKLIKAERWPLYTKVIVEVGKR 289          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Sea Lamprey
Match: B4GALT1 (beta-1,4-galactosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:924])

HSP 1 Score: 160.229 bits (404), Expect = 1.052e-46
Identity = 83/238 (34.87%), Postives = 134/238 (56.30%), Query Frame = 2
Query:  389 EIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIG 1099
            +++ GG +  + CI+   +AIIIPFR R       L  LH ILQ+Q + Y I+I+ Q G   FN+ ++ N G++E +    ++C IF D DL+P   +  Y+C+D    H + A+D   + LPY++  GGV      Q+  +NG+ N YWGWG EDDD+  R+    +   R    +GR + ++H    +    N +R  L+ +    M+ DG+NSL+Y ++ KT   LYT++ V++G
Sbjct:   65 KVQEGGRFRPANCISKQKVAIIIPFRHRDEHLKYWLYYLHPILQRQTIEYGIYIVNQFGEGVFNRAKLMNIGYVEALKDAPYDCFIFSDVDLVPMDDRNLYRCYDN-PRHFSVAMDKFGFHLPYNSYFGGVSGLSKAQFEKINGFPNNYWGWGGEDDDIYTRVSLAGMHISRPSGEIGRCRMIRHT-NDKNNEPNPQRFNLIQSTRSTMWKDGINSLQYSLVEKTLYPLYTNLTVNVG 300          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Sea Lamprey
Match: B4GALT1 (beta-1,4-galactosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:924])

HSP 1 Score: 125.561 bits (314), Expect = 9.589e-35
Identity = 69/180 (38.33%), Postives = 104/180 (57.78%), Query Frame = 2
Query:  563 GSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIR-LKNTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIG 1099
            G+  FN+ ++ N G++E +    F+C IF D DLIP   +  Y+C +    H++ AVD  ++ LPY    GGV A    Q+ ++NG+SN YWGWG EDDD   R + + +   R    +GRY  +KH+     +  N +R  L+  A  RM  DGLNSL Y ++++T   LYT++ V+IG
Sbjct:    1 GNGIFNRAKLMNVGYVEALRDAPFDCFIFSDVDLIPLDDRNLYRCGEQ-PQHLSVAVDKFDFRLPYLQSFGGVSALSRAQFKTINGFSNLYWGWGGEDDDFFRRTVASGLHVSRPRAGIGRYTMVKHKADAHNE-PNPQRFHLIRRAVSRMKWDGLNSLHYLLVKRTMSPLYTNLTVNIG 178          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004173.1 (pep scaffold:Pmarinus_7.0:GL478483:39914:44753:1 gene:ENSPMAG00000003809.1 transcript:ENSPMAT00000004173.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.997 bits (271), Expect = 1.917e-28
Identity = 54/166 (32.53%), Postives = 93/166 (56.02%), Query Frame = 2
Query:  368 TKFAEETEIKYGGYWVQSKCITDNMIAIIIPFRGR-WLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDT-GALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDD 859
            T+ A+   ++ GG++    C   +  A+++P   R  ++   LL  LH +LQ+Q + Y +++++Q+    F +  + N G  E +S   F C++ HD DL+PE+ +  Y C    G  H+A A+D   Y LPY +  GGV A  P QY+ +NG+ + +WG G +D+
Sbjct:   33 TRAAQPGGLRRGGHYRPPNCEARHRTAVVVPSGSRDRVRLRVLLRRLHGVLQRQQLEYTVYVVQQVTDGPFYRAWLLNVGVREALSDAEFECLVMHDVDLLPENDRNLYTCEPQLGPKHLAVAIDKFRYKLPYESYFGGVAALTPGQYMRINGFPSNHWGRGADDE 198          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Nematostella
Match: EDO48920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHV5])

HSP 1 Score: 171.785 bits (434), Expect = 2.110e-51
Identity = 89/238 (37.39%), Postives = 139/238 (58.40%), Query Frame = 2
Query:  392 IKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGYKRIPE-NVGRYKTMK--HEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDI 1096
            +K GG W  ++C     +A+I+PFR R+ Q    +  +H +L++QNV YRI I+EQ G   FN+  + N G+ E +   +F+C IFHD DLIPE  +  Y C  T   H+++AVD  NY LPY+++ GG  +F+   +  +NG+SN +WGWG EDDD+  R+     +   P   +GRYK ++  H  +++    +  R  LL    +RM  DGLN+L Y+++    + LYT I + +
Sbjct:   16 VKKGGAWKPTECKARTKVALIVPFRKRYEQLGIFVRHMHPMLKRQNVEYRIIIVEQSGDTPFNRAILFNIGYKESLKFNNFDCFIFHDVDLIPEDDRNEYSC-PTSPRHMSAAVDKFNYHLPYASIFGGAGSFKRKDFEEINGFSNKFWGWGGEDDDLYQRITAKGFHLTRPSLQIGRYKMVRTHHHQSSK---ADPNRFALLQNPVERMPRDGLNTLAYKLLEVKEESLYTIITIHV 249          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Nematostella
Match: EDO37163 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGJ5])

HSP 1 Score: 137.117 bits (344), Expect = 6.343e-39
Identity = 72/183 (39.34%), Postives = 103/183 (56.28%), Query Frame = 2
Query:  575 FNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRL-KNTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPREFF 1120
            FN+G + N GF E +    ++C IFHD DLIPE  +  Y C  +   H+++AVD   Y L Y  L GGV AF P  Y  VNG+ N YWGWG EDDD+ +R+ ++++   R    +GRY  +KH    +   +N  R+  L  ++  + TDGL+ LKY++I      LYT I V +G +    F
Sbjct:    3 FNRGMLMNVGFQEAMKADIYDCAIFHDIDLIPEDDRNDYSC-PSSPRHMSTAVDTMKYKLGYKKLFGGVEAFWPEHYRKVNGFPNRYWGWGGEDDDLYVRIVEHSLTLTRPAHQIGRYTMLKH--GHKKSDKNPDRHAQLQQSQTHLKTDGLSVLKYDVISSMEHPLYTMIGVKLGEKRWSLF 182          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Nematostella
Match: EDO48803 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIF8])

HSP 1 Score: 101.679 bits (252), Expect = 5.387e-25
Identity = 47/147 (31.97%), Postives = 88/147 (59.86%), Query Frame = 2
Query:  437 NMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRL 877
            +++ +++P+R R+ + +E +P +++ L ++ + +RIFI+ Q+    FN+  + N G+L  ++    + ++ HD DL+P +SK+ Y   + G  HI+S      Y   Y T +GG++     Q+  VNG SN +WGWG EDD++  R+
Sbjct:   13 HVLGVVVPYRNRFEELLEFVPHMNKFLSEKKIRHRIFIMNQVDKHRFNRASLLNVGYL--VARNECDYIVMHDVDLLPLNSKLFYGYPEKGPFHISSPHLHPKY--HYRTFVGGILMMTLEQFEKVNGLSNKFWGWGREDDELYQRM 155          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Medaka
Match: si:dkey-199f5.8 (beta-1,4-galactosyltransferase 3 [Source:NCBI gene;Acc:101162708])

HSP 1 Score: 176.022 bits (445), Expect = 4.600e-51
Identity = 103/276 (37.32%), Postives = 144/276 (52.17%), Query Frame = 2
Query:  302 SVPFCTERSQFID-------IKSMTYNEVTKFAEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQ 1105
            ++P C + S F+           +T   V    +   + +GG +    C   +  AIIIP R R      LL  LH  LQ+Q + Y I+II Q G+  FN+ ++ N GF E +    ++C+ FHD DLIPE  +  Y C D    H A A+D   Y LPY+   GGV A  P QYL +NG+ N YWGWG EDDD+ IR+    +   R P   GRYK +KH       +   R N+L  T +     DG+NSL+YE++ +    LY +I V+IGT+
Sbjct:   78 NLPLCPKTSPFVGGPIHVSFPSRLTLANVE--GKNPLVMHGGRYRPPDCEARHKTAIIIPHRNREHHLKYLLYFLHPFLQRQQLNYGIYIIHQAGNYTFNRAKLMNIGFREAMREEDWDCLFFHDVDLIPEDDRNTYIC-DANPKHAAIAMDKFGYKLPYNMYFGGVSALSPLQYLKMNGFPNNYWGWGGEDDDIGIRVSLAGMHISRPPLKHGRYKMIKHNLDQGNDVNPKRFNMLAKTRQTWKL-DGMNSLEYELVSRQYLPLYANITVNIGTE 349          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Medaka
Match: b4galt3 (beta-1,4-galactosyltransferase 3 [Source:NCBI gene;Acc:101159351])

HSP 1 Score: 176.407 bits (446), Expect = 2.514e-50
Identity = 90/234 (38.46%), Postives = 133/234 (56.84%), Query Frame = 2
Query:  401 GGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIG 1099
            GG +    C   +  AI++P+R R      LL  LH  LQ+Q + Y I+I++Q G+  FN+ ++ N G  E +    ++C+  HD DL+PE+    Y CH    +H++ A+D   Y LPY    GGV A  P QY+ +NG+ N YWGWG EDDD+  R++ + +   R P  +G YK +KH+   +   QN RR  LL        +DGLNSL YE++ K  + LYT++ V+IG
Sbjct:  182 GGRYRPPDCEPRHHTAIVVPYRNRQTHLRALLYHLHPFLQRQQIHYSIYIVQQWGNSTFNRAKLLNVGVREALRDEDWSCIFLHDVDLLPENDHNTYTCHKQFPMHLSVAMDKFRYRLPYPQYFGGVSAVTPDQYMKMNGFPNQYWGWGGEDDDIAARVRLSGMKIVRPPVAIGHYKMIKHK-GDKGNEQNPRRFDLLKRTRLSWRSDGLNSLTYELLSKELEPLYTNLTVNIG 414          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Medaka
Match: b4galt3 (beta-1,4-galactosyltransferase 3 [Source:NCBI gene;Acc:101159351])

HSP 1 Score: 176.407 bits (446), Expect = 2.514e-50
Identity = 90/234 (38.46%), Postives = 133/234 (56.84%), Query Frame = 2
Query:  401 GGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIG 1099
            GG +    C   +  AI++P+R R      LL  LH  LQ+Q + Y I+I++Q G+  FN+ ++ N G  E +    ++C+  HD DL+PE+    Y CH    +H++ A+D   Y LPY    GGV A  P QY+ +NG+ N YWGWG EDDD+  R++ + +   R P  +G YK +KH+   +   QN RR  LL        +DGLNSL YE++ K  + LYT++ V+IG
Sbjct:  182 GGRYRPPDCEPRHHTAIVVPYRNRQTHLRALLYHLHPFLQRQQIHYSIYIVQQWGNSTFNRAKLLNVGVREALRDEDWSCIFLHDVDLLPENDHNTYTCHKQFPMHLSVAMDKFRYRLPYPQYFGGVSAVTPDQYMKMNGFPNQYWGWGGEDDDIAARVRLSGMKIVRPPVAIGHYKMIKHK-GDKGNEQNPRRFDLLKRTRLSWRSDGLNSLTYELLSKELEPLYTNLTVNIG 414          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Medaka
Match: b4galt3 (beta-1,4-galactosyltransferase 3 [Source:NCBI gene;Acc:101159351])

HSP 1 Score: 176.407 bits (446), Expect = 2.514e-50
Identity = 90/234 (38.46%), Postives = 133/234 (56.84%), Query Frame = 2
Query:  401 GGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIG 1099
            GG +    C   +  AI++P+R R      LL  LH  LQ+Q + Y I+I++Q G+  FN+ ++ N G  E +    ++C+  HD DL+PE+    Y CH    +H++ A+D   Y LPY    GGV A  P QY+ +NG+ N YWGWG EDDD+  R++ + +   R P  +G YK +KH+   +   QN RR  LL        +DGLNSL YE++ K  + LYT++ V+IG
Sbjct:  182 GGRYRPPDCEPRHHTAIVVPYRNRQTHLRALLYHLHPFLQRQQIHYSIYIVQQWGNSTFNRAKLLNVGVREALRDEDWSCIFLHDVDLLPENDHNTYTCHKQFPMHLSVAMDKFRYRLPYPQYFGGVSAVTPDQYMKMNGFPNQYWGWGGEDDDIAARVRLSGMKIVRPPVAIGHYKMIKHK-GDKGNEQNPRRFDLLKRTRLSWRSDGLNSLTYELLSKELEPLYTNLTVNIG 414          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Medaka
Match: b4galt6 (beta-1,4-galactosyltransferase 6 [Source:NCBI gene;Acc:101160972])

HSP 1 Score: 160.614 bits (405), Expect = 1.162e-45
Identity = 93/248 (37.50%), Postives = 136/248 (54.84%), Query Frame = 2
Query:  368 TKFAEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQ----ILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLK-NTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDI 1096
             KF+   +++YGG W    C     +AI+IPFR R     E LP+L Q    +LQ+Q + +  ++IEQ GS+ FN+  + N GFLE +    ++C+IFHD D IPE+ +  Y C      H A+ +D   Y+LPY    GGV      Q+  +NG+ N +WGWG EDDD+  R+    +   R    +GRYK++ H    R ++Q L R  LL  + +R   DGLN+L Y      +  LYT+I VD+
Sbjct:   93 VKFSRFFDVEYGGRWKPKDCKPRWKVAILIPFRNR----HEHLPILFQHLIPMLQRQRLQFGFYVIEQSGSQPFNRAMLFNVGFLEAMKDLDWDCLIFHDVDHIPENDRNYYGCGRM-PRHFAAKLDKYMYILPYHEFFGGVSGLTVDQFRKINGFPNAFWGWGGEDDDLWNRVHFADLNVTRPEGEIGRYKSIPHH--HRGEVQFLGRYKLLRYSRERQQLDGLNNLHYSPHTSISS-LYTNISVDL 332          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Planmine SMEST
Match: SMESG000071011.1 (SMESG000071011.1)

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 257/257 (100.00%), Postives = 257/257 (100.00%), Query Frame = 2
Query:  350 MTYNEVTKFAEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPREFF 1120
            MTYNEVTKFAEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPREFF
Sbjct:    1 MTYNEVTKFAEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPREFF 257          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Planmine SMEST
Match: SMESG000071011.1 (SMESG000071011.1)

HSP 1 Score: 445.662 bits (1145), Expect = 4.175e-159
Identity = 212/212 (100.00%), Postives = 212/212 (100.00%), Query Frame = 2
Query:  485 MELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPREFF 1120
            MELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPREFF
Sbjct:    1 MELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQPREFF 212          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Planmine SMEST
Match: SMESG000071011.1 (SMESG000071011.1)

HSP 1 Score: 275.404 bits (703), Expect = 6.278e-93
Identity = 129/129 (100.00%), Postives = 129/129 (100.00%), Query Frame = 2
Query:  350 MTYNEVTKFAEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVD 736
            MTYNEVTKFAEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVD
Sbjct:    1 MTYNEVTKFAEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVD 129          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Planmine SMEST
Match: SMESG000002057.1 (SMESG000002057.1)

HSP 1 Score: 212.231 bits (539), Expect = 7.393e-66
Identity = 102/249 (40.96%), Postives = 158/249 (63.45%), Query Frame = 2
Query:  371 KFAEETEIKYGGYWVQSKC--ITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNT-IGYKRIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIVDIGTQP 1108
            K  E++       W + KC   + N +AII+P+R R  Q   L+  L ++L++Q  CY+I+I+EQ G   FNKG + NAGFLE + ++ F+CV+FHD DLIPES  +PY C      H++ ++D  +Y LPYS L+GGVI  + +Q+L++NGYSN YW WG EDDD+ IR+  T +   R   ++ R++ +KH+   +  I+   R+ LL+ ++ R   DGLNS+ Y + ++T   LYTH+++D+G  P
Sbjct:   74 KLIEDSTNNLTQIWTKLKCNLSSSNKLAIIVPYRDRRYQLEILIQYLDELLRRQMQCYQIYIVEQFGQSKFNKGLLMNAGFLEAMKLWKFDCVMFHDVDLIPESFNVPYSCSSLPT-HLSVSIDTFDYKLPYSYLVGGVIVMKTYQFLTLNGYSNMYWDWGAEDDDLYIRINATNLQVTRPAASIARFRMLKHKARQKSPIE--LRHKLLSFSKARYRLDGLNSISYAVQQRTYCELYTHLLIDVGPSP 319          
BLAST of beta-1,4-galactosyltransferase 4-like vs. Planmine SMEST
Match: SMESG000008535.1 (SMESG000008535.1)

HSP 1 Score: 176.407 bits (446), Expect = 4.973e-52
Identity = 104/236 (44.07%), Postives = 143/236 (60.59%), Query Frame = 2
Query:  404 GYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGF-LEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGYK--RIPENVGRYKTMKHEPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKL--LYTHIIVDI 1096
            GYW  + C+ +  IAIIIP+R R     +LL  LH  LQ+QN  Y+IF+IEQ     +NKG ++N+GF +   S   F+C IFHD D++P  ++  Y+C +   LH+ +AVD  NY L Y T++GGV+A    Q++ VNGYSN + GWG EDDDM  R+K    YK  R P  +G+Y  +KH+      I N +R  +LT  + R  TDGLN+LKY+I    N +  L T I VDI
Sbjct:   88 GYWSPTNCLKNYTIAIIIPYREREQHLRKLLSHLHPFLQRQNAKYQIFVIEQSSLGIYNKGAISNSGFDIANSSDRKFDCFIFHDVDMLPIKNQNIYQCSEQ-PLHLGAAVDKFNYKLVYGTIVGGVLALNREQFVKVNGYSNIFEGWGGEDDDMAERIK-LENYKVFRYPIEIGQYMMIKHQHDKGNPI-NEKRVKMLTETKNRYKTDGLNTLKYKIKEVNNHISNLVTWITVDI 320          
The following BLAST results are available for this feature:
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B4GALT33.121e-5237.00beta-1,4-galactosyltransferase 3 [Source:HGNC Symb... [more]
B4GALT33.121e-5237.00beta-1,4-galactosyltransferase 3 [Source:HGNC Symb... [more]
B4GALT33.121e-5237.00beta-1,4-galactosyltransferase 3 [Source:HGNC Symb... [more]
B4GALT17.859e-4735.16beta-1,4-galactosyltransferase 1 [Source:HGNC Symb... [more]
B4GALT51.208e-4637.65beta-1,4-galactosyltransferase 5 [Source:HGNC Symb... [more]
back to top
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bre-42.957e-4836.32Beta-1,4-N-acetylgalactosaminyltransferase bre-4 ... [more]
bre-42.957e-4836.32Beta-1,4-N-acetylgalactosaminyltransferase bre-4 ... [more]
W02B12.113.325e-4737.40N-acetyllactosamine synthase [Source:UniProtKB/Tr... [more]
W02B12.113.325e-4737.40N-acetyllactosamine synthase [Source:UniProtKB/Tr... [more]
bre-43.389e-4237.25Beta-1,4-N-acetylgalactosaminyltransferase bre-4 ... [more]
back to top
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
beta4GalNAcTA2.996e-4636.82gene:FBgn0027538 transcript:FBtr0087539[more]
beta4GalNAcTB3.055e-4437.97gene:FBgn0039625 transcript:FBtr0085419[more]
beta4GalT71.173e-2028.38gene:FBgn0039258 transcript:FBtr0084755[more]
back to top
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b4galt33.734e-5338.75UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
b4galt33.734e-5338.75UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
b4galt33.986e-5338.75UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
CR318611.22.592e-5037.36si:dkey-199f5.8 [Source:NCBI gene;Acc:556544][more]
si:dkey-199f5.88.361e-5037.36si:dkey-199f5.8 [Source:ZFIN;Acc:ZDB-GENE-030131-4... [more]
back to top
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbln21.198e-5338.33fibulin 2 [Source:Xenbase;Acc:XB-GENE-959371][more]
ranbp23.764e-5138.24RAN binding protein 2 [Source:Xenbase;Acc:XB-GENE-... [more]
B4GALT22.185e-4938.11UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
B4GALT32.184e-4838.02beta-1,4-galactosyltransferase 3-like [Source:NCBI... [more]
nkx6-31.196e-4535.47NK6 homeobox 3 [Source:Xenbase;Acc:XB-GENE-478609][more]
back to top
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B4galt34.148e-5337.36UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase,... [more]
B4galt34.148e-5337.36UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase,... [more]
B4galt19.743e-4937.63UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
B4galt53.817e-4737.45UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase,... [more]
B4galt41.759e-4335.82UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase,... [more]
back to top
BLAST of beta-1,4-galactosyltransferase 4-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80WN8|B4GT3_CRIGR4.440e-5636.03Beta-1,4-galactosyltransferase 3 OS=Cricetulus gri... [more]
sp|Q5EA87|B4GT3_BOVIN1.263e-5236.59Beta-1,4-galactosyltransferase 3 OS=Bos taurus OX=... [more]
sp|Q6P768|B4GT3_RAT2.005e-5237.45Beta-1,4-galactosyltransferase 3 OS=Rattus norvegi... [more]
sp|Q91YY2|B4GT3_MOUSE2.901e-5237.36Beta-1,4-galactosyltransferase 3 OS=Mus musculus O... [more]
sp|O60512|B4GT3_HUMAN1.499e-5137.00Beta-1,4-galactosyltransferase 3 OS=Homo sapiens O... [more]
back to top
BLAST of beta-1,4-galactosyltransferase 4-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8I9I33.700e-8551.21Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8G1241.048e-8451.00Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FGV44.257e-8351.00Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GUX34.330e-8351.00Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8HUT01.455e-7946.52Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b4galt38.928e-5238.82beta-1,4-galactosyltransferase 3 [Source:NCBI gene... [more]
si:dkey-199f5.83.516e-5136.27beta-1,4-galactosyltransferase 3-like [Source:NCBI... [more]
b4galt14.663e-4634.02beta-1,4-galactosyltransferase 1-like [Source:NCBI... [more]
b4galt28.318e-4636.61beta-1,4-galactosyltransferase 2 [Source:NCBI gene... [more]
b4galt1l2.182e-4534.55beta-1,4-galactosyltransferase 1-like [Source:NCBI... [more]
back to top
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b4galt28.680e-4934.77UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
B4GALT12.338e-4835.56beta-1,4-galactosyltransferase 1 [Source:HGNC Symb... [more]
B4GALT11.052e-4634.87beta-1,4-galactosyltransferase 1 [Source:HGNC Symb... [more]
B4GALT19.589e-3538.33beta-1,4-galactosyltransferase 1 [Source:HGNC Symb... [more]
ENSPMAT00000004173.11.917e-2832.53pep scaffold:Pmarinus_7.0:GL478483:39914:44753:1 g... [more]
back to top
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO489202.110e-5137.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371636.343e-3939.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488035.387e-2531.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of beta-1,4-galactosyltransferase 4-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-199f5.84.600e-5137.32beta-1,4-galactosyltransferase 3 [Source:NCBI gene... [more]
b4galt32.514e-5038.46beta-1,4-galactosyltransferase 3 [Source:NCBI gene... [more]
b4galt32.514e-5038.46beta-1,4-galactosyltransferase 3 [Source:NCBI gene... [more]
b4galt32.514e-5038.46beta-1,4-galactosyltransferase 3 [Source:NCBI gene... [more]
b4galt61.162e-4537.50beta-1,4-galactosyltransferase 6 [Source:NCBI gene... [more]
back to top
BLAST of beta-1,4-galactosyltransferase 4-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071011.10.000e+0100.00SMESG000071011.1[more]
SMESG000071011.14.175e-159100.00SMESG000071011.1[more]
SMESG000071011.16.278e-93100.00SMESG000071011.1[more]
SMESG000002057.17.393e-6640.96SMESG000002057.1[more]
SMESG000008535.14.973e-5244.07SMESG000008535.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004558 ID=SMED30004558|Name=beta-1,4-galactosyltransferase 4-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1139bp
TTTTATTTACAATTTCAAGAATTTCGAATGAATTTATAAAATGAGAACAT
TTTACAGGTTCAGCCTTTTCCTAGTAATATCTCTGTTTATTTTAATTTTT
ATTTGGAATATTTTATCGGATGATACACCAAAAAGCGAAAACAATATATC
AGAATACTCAGACAGCTATGTCAGAAATTTACTCTCTCAAATTGAAGCAG
AAATAAAATCTTTATCAAAGGTTTCATTTAATAATTTCATTCACCAAAAA
ATGAAATTGTTAGAAAGTTCACCAAAACTTTGTGATATCAAATTGTTGCA
TTCCGTTCCATTCTGTACTGAACGCAGTCAATTTATTGACATTAAATCTA
TGACATATAACGAAGTGACGAAGTTTGCCGAAGAGACAGAAATAAAATAT
GGCGGATATTGGGTTCAAAGTAAATGCATTACAGATAACATGATTGCAAT
TATAATACCTTTCAGAGGTAGGTGGCTTCAAACAATGGAATTACTGCCGG
TACTCCATCAGATTTTGCAGCAACAAAATGTTTGTTATAGAATTTTCATT
ATAGAACAACTTGGTAGTGAAGCATTTAATAAAGGTCGAGTCAATAATGC
CGGATTTCTGGAGATTATTTCAATGTTTTCTTTCAATTGTGTCATATTCC
ATGATACAGATTTAATACCGGAATCATCTAAAATCCCATATAAATGCCAT
GACACAGGCGCTTTGCACATTGCATCAGCAGTAGATGTAAATAATTATGT
CTTGCCATATTCAACTTTAATAGGCGGTGTTATAGCATTTAGGCCATTTC
AATATTTATCTGTCAATGGTTATTCGAATTATTACTGGGGCTGGGGCCTA
GAAGATGATGATATGGAGATACGGTTGAAAAACACAATTGGCTATAAAAG
AATTCCTGAGAATGTTGGCAGATATAAAACAATGAAACATGAGCCAACGA
CAAGATTCAAAATTCAAAATTTAAGAAGAAATGTCTTATTAACAACAGCA
GAAAAGCGAATGTTCACAGACGGTTTGAATAGTTTAAAGTATGAAATAAT
CAGAAAAACAAACAAATTACTATATACACATATCATTGTAGATATCGGAA
CTCAACCACGAGAGTTTTTTTAATAAATTTTGTTTCACT
back to top

protein sequence of SMED30004558-orf-1

>SMED30004558-orf-1 ID=SMED30004558-orf-1|Name=SMED30004558-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=361bp
MRTFYRFSLFLVISLFILIFIWNILSDDTPKSENNISEYSDSYVRNLLSQ
IEAEIKSLSKVSFNNFIHQKMKLLESSPKLCDIKLLHSVPFCTERSQFID
IKSMTYNEVTKFAEETEIKYGGYWVQSKCITDNMIAIIIPFRGRWLQTME
LLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNC
VIFHDTDLIPESSKIPYKCHDTGALHIASAVDVNNYVLPYSTLIGGVIAF
RPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGYKRIPENVGRYKTMKH
EPTTRFKIQNLRRNVLLTTAEKRMFTDGLNSLKYEIIRKTNKLLYTHIIV
DIGTQPREFF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR003859Galactosyl_T
IPR029044Nucleotide-diphossugar_trans
IPR027791Galactosyl_T_C
IPR027995Galactosyl_T_N
Vocabulary: molecular function
TermDefinition
GO:0016757transferase activity, transferring glycosyl groups
GO:0003945N-acetyllactosamine synthase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003859Beta-1,4-galactosyltransferasePRINTSPR02050B14GALTRFASEcoord: 260..278
score: 62.88
coord: 200..219
score: 45.0
coord: 238..259
score: 38.64
coord: 169..188
score: 37.14
IPR003859Beta-1,4-galactosyltransferasePANTHERPTHR19300BETA-1,4-GALACTOSYLTRANSFERASEcoord: 50..356
IPR027791Galactosyltransferase, C-terminalPFAMPF02709Glyco_transf_7Ccoord: 226..300
e-value: 5.3E-20
score: 70.9
IPR029044Nucleotide-diphospho-sugar transferasesGENE3DG3DSA:3.90.550.10coord: 79..356
e-value: 3.0E-83
score: 281.3
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILYSSF53448Nucleotide-diphospho-sugar transferasescoord: 116..354
IPR027995Galactosyltransferase, N-terminalPFAMPF13733Glyco_transf_7Ncoord: 103..220
e-value: 2.2E-34
score: 117.9
NoneNo IPR availablePANTHERPTHR19300:SF52BETA4GALNACTAcoord: 50..356
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..26
score: 0.591
NoneNo IPR availableTMHMMTMhelixcoord: 7..26