G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30004551
Length (bp)1876
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30004551) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30004551) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30004551) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30004551) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004551

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30004551SMESG000016965.1 dd_Smed_v4_19397_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183SJQ7 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS4455 PE=4 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 3.431e-22
Identity = 107/369 (29.00%), Postives = 177/369 (47.97%), Query Frame = 3
Query:  570 MFIVKYINNCLIAQSNKTMIDNRESSSKIYATVSMAL-ATMAFIFNGFSLIILTRKNSNLRFGQIKXXXXXXXXVETFLTGFITLFHVVVEYKRSANSGGIGLLWLDLIVFYNITSLTCTRNWIVVIIACSRCEIIFVPFNSRRGLKFNHHNTKIIALI-ILFFSYCISFVRLFAKKALICQDTNVPQLANHLLDYRAYRLFKT---------YCFFIYQSVLPVVIVGIVSL-------------AMXXXXXXXXXXXXXXXTHINDCSYFRMNHLSDQRHSSRKLNSQRKATRTILVLAVVFTLLEVPVFIIQSVVDRDDFSNHSILKIK--LTELSNILVVLDSCSNIVVYLLTSDKFRLEVRRIF 1598
            M  + Y+NNC      + +       ++I  TVS+ + ++ A +    +LI+L R N   RFG ++ +L+ L+ +E +L   I   H V E   S +   +    L  I F  + S  C+RNW V +IA SRCE I  P   R   +    N +II L+ ++  +   S +RL     ++C +          L+++  RL  T           FF YQS +P+ IV + ++             A       +       ST     ++ ++     ++ ++ +L +Q +ATRTI  +A VFT+LE PVF I  +V    F NH  +++K  + +L   L++LDS +NIV+YLLTS+ FR E+ R+ 
Sbjct:    1 MLNLHYLNNC------QELPPVELEDARI--TVSLLVCSSFAIMLELIALIVLAR-NGAKRFGSMRKSLIALTSIEMWLNTSI-FVHKVWEDYGSPHPETLLAYILAAISFSLLNSAICSRNWCVTLIALSRCEAITRPLAHRSSKQILSPNRQIILLVCVVTLAMVFSAIRLTFLSIVVCTN----------LEHKVIRLPPTNSTNAQIFEKVFFAYQSAIPISIVALATVFMIWTLLRPRIESAKKSPSAKAQPQLQRQSTVSGTNNHGKILPRGYEKKNAPRLTNQVRATRTIFFIAAVFTILEAPVFFI--IV----FENHIGIEVKKVIVQLLKFLIILDSYTNIVIYLLTSEHFRTELIRML 343          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A3P7M935 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS14106 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 6.030e-21
Identity = 118/412 (28.64%), Postives = 195/412 (47.33%), Query Frame = 3
Query:  570 MFIVKYINNCLIAQSNKTMIDNRESSSKIYATVSMAL-ATMAFIFNGFSLIILTRKNSNLRFGQIKXXXXXXXXVETFLTGFITLFHVVVEYKRSANSGGIGLLWLDLIVFYNITSLTCTRNWIVVIIACSRCEIIFVPFNSRRGLKFNHHNTKIIALI-ILFFSYCISFVRLFAKKALICQDTN-----VPQLANHLLDYRAYRLFKTYCFFIYQSVLPVVIVGIVSLAM---------XXXXXXXXXXXXXXXTHINDCSYFRMNHLS------DQRHSSRKLNSQRKATRTILVLAVVFTLLEVPVFIIQSVVDRDDFSNH--SILKIKLTELSNILVVLDSCSNIVVYLLTSDKFRLEVRRIFWQISSCQLCDENNYLSATEHLVVHQNNV-LSLLSAIPLSTRSNPS 1730
            M  ++Y+N+C      K +       ++I  TVS+ + ++ A +    +LI+L R  +  RFG ++ +L+ L+ +E +L   I   H V E   S +   +    L  I+F  + S  C+RNW V +IA SRCE I  P   R   +    N ++I L+ ++      S VRL     ++C + N     +P  AN      A R  K   FF YQS +P+ IV + ++ M         + +    +             ++   NH        ++R+ SR L +Q +ATRTI  +A VFT+LE PVF I  +V    F NH  S +++ + +L   L++LDS +NI +YLLTS+ FR E+ R+     +C       Y +   H  +    + +   S  PL ++++P 
Sbjct:    1 MLNLQYLNDC------KELPPVVLEDARI--TVSLLVCSSFAILLELIALIVLARHRAK-RFGSMRKSLIALTSIEMWLNTSI-FVHKVWEDYGSPHPETLLSYILAAILFSLLNSAICSRNWCVTLIALSRCEAITRPLAHRSSKQLLSPNRQLILLVFVIILGIIFSAVRLTFLNIVVCTNLNNTVIRLPP-AN---STNAGRFEKV--FFAYQSAIPISIVALATVFMIWTLLRPKIAAAKRTPSSPEIQRQLQCPSTAHGSHNHGKILPRGYEKRNVSR-LTNQVRATRTIFFIAAVFTVLEAPVFFI--IV----FENHIGSDVRVVIVQLLKFLIILDSYTNIAIYLLTSEHFRTELIRML----TC-----GRYRTEKAHSRIRNTKLAIQRPSKTPLPSQASPP 380          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3T6F1 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS2638 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.044e-18
Identity = 109/379 (28.76%), Postives = 179/379 (47.23%), Query Frame = 3
Query:  576 IVKYINNCLIAQSNKTMIDNRESSSKIYATVSMALATMAFIFNGFSLIILTRKNSNLRFGQIKXXXXXXXXVETFLTGFITL-----FHVVVEYKRSANSGGIGLLWLDLIVFYNITSLTCTRNWIVVIIACSRCEIIFVPFNSRRGLK-FNHHNTKIIALIILFFSYCISFVRLFAKKALICQDTNVPQLANHLLDYRAY-RLFK--TYCFFIYQSVLPVVIVGIVSLAMXXXXXXXXXXXXXXXTHIN------------DCSYFRMNHLSDQ-------------------RHSSRKLNSQRKATRTILVLAVVFTLLEVPVFIIQSVVDRDDFSN--HSILKIKLTELSNILVVLDSCSNIVVYLLTSDKFRLEV 1586
            +V Y + C  A  N+T   ++  SSK + T+ M LA  A +    +L +LTR  +  RFG ++ +L+ L+ +E +LT  I +      +V+ ++++      +  L    I+F ++ S TC+RNW V  IA +RCE+I  P  +R     F+     I  +I +     ++ +R+  +  +IC  TN+  +  H  +  +Y R  K     FF YQS +P+ +V I +L M  +LL     S   +   N            +C   +    S+                    RH+ R L +Q +ATR I+ +A VF + E PVF   +VV +   S      L I L     +L+++DS SN  +YLLTS  FR+E+
Sbjct:   24 LVYYSDTCDPAILNRTNEYDQVQSSKAHITL-MVLAAFAVVLEAIALGVLTRPGAT-RFGSMRQSLVTLTAIEMWLTSTILVNKLWDLYVIEKHEK------LPELCFSFILFLSVNSATCSRNWAVTFIALARCEVITRPVATRISTHIFSPRRQLIYIVIFILIGVIMATIRISIRPMVIC--TNLDSIV-HFPNVSSYSRTSKIIENTFFAYQSAIPITVVTIATLFMIVALLRHRMPSEKKTKQRNAFNCTNDEEKSWNCCRIQGKRGSNGTPGKEENGTGSVVKSIQTVRHAQR-LPNQIRATRFIIFIATVFIVCEAPVFF--AVVFKSAISELFGKFLNIYL----RLLIIIDSFSNFFIYLLTSKPFRVEL 384          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3SJV1 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS5214 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.321e-18
Identity = 106/377 (28.12%), Postives = 175/377 (46.42%), Query Frame = 3
Query:  576 IVKYINNCLIAQSNKTMIDNRESSSKIYATVSMALATMAFIFNGFSLIILTRKNSNLRFGQIKXXXXXXXXVETFLTGFITL-----FHVVVEYKRSANSGGIGLLWLDLIVFYNITSLTCTRNWIVVIIACSRCEIIFVPFNSRRGLK-FNHHNTKIIALIILFFSYCISFVRLFAKKALICQD-TNVPQLANHLLDYRAYRLFKTYCFFIYQSVLPVVIVGIVSLAMXXXXXXXXXXXXXXXTHIND-------------CSYFRMNHLSDQ------------------RHSSRKLNSQRKATRTILVLAVVFTLLEVPVFIIQSVVDRDDFSN--HSILKIKLTELSNILVVLDSCSNIVVYLLTSDKFRLEV 1586
            +V Y + C  A  N+T    +  +SK + T+ M LA  A +    +L +LTR  +  RFG ++ +L+ L+ +E +LT  I +      +V+ +Y++      +  L    I+F ++ S TC+RNW+V  IA +RCE+I  P  +R     F+     I   I +     ++ +R+  +  +IC +  ++    N     +A ++ +   FF YQS +P+ +V I +L M  +LL     S                      C   R    +D                   RH+ R L +Q +ATR I+ +A VF + E PVF   +VV +   S      L I L     +L+++DS SN V+YLLTS  FR+E+
Sbjct:    9 LVYYSDACDPAILNQTNEYEQVQNSKAHITL-MILAAFAVVLEAIALGVLTRPGAT-RFGSMRQSLVTLTAIEMWLTSTILVNKLWDLYVIEKYEK------LPELCFSFILFLSVNSATCSRNWVVTFIALARCEVITRPVATRVSTHIFSPRRQLIYIAIFILVGVIMATIRISIRPMVICTNLESIVHFPNVSRYSKASKIIEN-TFFAYQSAIPITVVTIATLFMIIALLRHRMPSEKKEKQEEKFKCETDQRQSWTCCRIQRKRQRTDTSGKDEDGCGSVVKSIQTVRHAQR-LPNQIRATRFIIFIATVFIVCEAPVFF--AVVFKSAISELFGKFLNIYL----RLLIIVDSFSNFVIYLLTSRPFRVEL 369          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: G7Y2I6 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Clonorchis sinensis OX=79923 GN=CLF_100044 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.460e-17
Identity = 97/367 (26.43%), Postives = 173/367 (47.14%), Query Frame = 3
Query:  570 MFIVKYINNCLIAQSNKTMIDNRESSSKIYATVSMAL-ATMAFIFNGFSLIILTRKNSNLRFGQIKXXXXXXXXVETFLTGFITLFHVVVEYKRSANSGGIG----LLWLDLIVFYNITSLTCTRNWIVVIIACSRCEIIFVPFNSR--RGLKFNHHNTKIIALIILFFSYCISFVRLFAKKALICQDTNVPQLANHLLDYRAYRLFKTYCFFIYQSVLPVVIVGIVSLAMXXXXXXXXXXXXXXX-----THINDCSYFRMNHLSDQRHSS---------RKLNSQRKATRTILVLAVVFTLLEVPVF---IIQSVVDRDDFSNHSILKIKLTELSNILVVLDSCSNIVVYLLTSDKFRLEVRRIF 1598
            M  V + N+C+     +     + S+   Y  + + + ++ A +   F+L++LTR+ S +R G +++NL+ L++ E  L   I++F+ ++   R   S  I     +  +++  F  +    CTRNWI+ +IA +RC  I  P  SR      F       + ++ +   Y + F RL   +  ICQ+ +         D      F  Y +FI+Q+ LP++I+ I ++ M   LL +   +         T    CS  ++ + S  +H+          R+  +Q +ATR I +LA  F + E PVF   +++   +R  F +       +T     LVVLDSC+N+ +Y+L S +FR E  R+ 
Sbjct:    1 MSFVTFKNDCVAISGGQ-----KPSTEATYIYILLVVVSSWALVMGIFALVVLTRRRS-IRMGSMRVNLMTLTIFEIILN--ISIFYCILT--RLTVSADIAERLVVALVNIFSFCVLQGSLCTRNWIITLIALARCVAITRPMASRLMSTHLFRPKPLGCLTVLCILTGYILGFSRLVEMEITICQNLDKRVRLTETTDPWK---FPRYTYFIFQAALPIIILFISTVIMVTVLLRARVLTIDTRENNQGTKRIKCSPSQLRNSSGAQHTRMCAEKRVNYRRAQNQLRATRMITLLAATFIIFESPVFFCVVLEHHFERAHFRS-------VTWAVKSLVVLDSCANVFIYVLVSKRFRQESARLL 347          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO38784 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBY6])

HSP 1 Score: 48.521 bits (114), Expect = 6.178e-6
Identity = 36/94 (38.30%), Postives = 51/94 (54.26%), Query Frame = 3
Query: 1377 TRTILVLAVVFTLLEVPVFIIQSVVDRDDFSNHSILKIKLTELSNILVVLDSCSNIVVYLLTSDKFRLEVRRIFWQISSCQLCDENNYLSATEH 1658
            TRT+ V+ V+F LL +P  I   ++D     N S L   L + S IL  L SCSN +VY L + +FR +VR+  +    C    + +Y S TEH
Sbjct:  233 TRTLAVIVVLFALLMLPHEIAWMLLDFGPDPN-SKLADTLIKFSPILTYLHSCSNPLVYGLMTTQFRNDVRKYVY----CCRRYQGSYESETEH 321          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000016965.1 (SMESG000016965.1)

HSP 1 Score: 702.205 bits (1811), Expect = 0.000e+0
Identity = 373/373 (100.00%), Postives = 373/373 (100.00%), Query Frame = 3
Query:  624 MIDNRESSSKIYATVSMALATMAFIFNGFSLIILTRKNSNLRFGQIKXXXXXXXXVETFLTGFITLFHVVVEYKRSANSGGIGLLWLDLIVFYNITSLTCTRNWIVVIIACSRCEIIFVPFNSRRGLKFNHHNTKIIALIILFFSYCISFVRLFAKKALICQDTNVPQLANHLLDYRAYRLFKTYCFFIYQSVLPVVIVGIVSLAMXXXXXXXXXXXXXXXTHINDCSYFRMNHLSDQRHSSRKLNSQRKATRTILVLAVVFTLLEVPVFIIQSVVDRDDFSNHSILKIKLTELSNILVVLDSCSNIVVYLLTSDKFRLEVRRIFWQISSCQLCDENNYLSATEHLVVHQNNVLSLLSAIPLSTRSNPSHDKE 1742
            MIDNRESSSKIYATVSMALATMAFIFNGFSLIILTRKNSNLRFGQIKLNLLLLSLVETFLTGFITLFHVVVEYKRSANSGGIGLLWLDLIVFYNITSLTCTRNWIVVIIACSRCEIIFVPFNSRRGLKFNHHNTKIIALIILFFSYCISFVRLFAKKALICQDTNVPQLANHLLDYRAYRLFKTYCFFIYQSVLPVVIVGIVSLAMSFSLLGSTRSSSYNSTHINDCSYFRMNHLSDQRHSSRKLNSQRKATRTILVLAVVFTLLEVPVFIIQSVVDRDDFSNHSILKIKLTELSNILVVLDSCSNIVVYLLTSDKFRLEVRRIFWQISSCQLCDENNYLSATEHLVVHQNNVLSLLSAIPLSTRSNPSHDKE
Sbjct:    1 MIDNRESSSKIYATVSMALATMAFIFNGFSLIILTRKNSNLRFGQIKLNLLLLSLVETFLTGFITLFHVVVEYKRSANSGGIGLLWLDLIVFYNITSLTCTRNWIVVIIACSRCEIIFVPFNSRRGLKFNHHNTKIIALIILFFSYCISFVRLFAKKALICQDTNVPQLANHLLDYRAYRLFKTYCFFIYQSVLPVVIVGIVSLAMSFSLLGSTRSSSYNSTHINDCSYFRMNHLSDQRHSSRKLNSQRKATRTILVLAVVFTLLEVPVFIIQSVVDRDDFSNHSILKIKLTELSNILVVLDSCSNIVVYLLTSDKFRLEVRRIFWQISSCQLCDENNYLSATEHLVVHQNNVLSLLSAIPLSTRSNPSHDKE 373          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000078733.1 (SMESG000078733.1)

HSP 1 Score: 266.929 bits (681), Expect = 2.530e-83
Identity = 167/391 (42.71%), Postives = 245/391 (62.66%), Query Frame = 3
Query:  570 MFIVKYINNCLIAQSNKTMIDNRESSSKIYATVSMALATMAFIFNGFSLIILTRKNSNLRFGQIKXXXXXXXXVETFLTGFITLFHV-----VVEYKRSANSGGIGLLWLDLIVFYNITSLTCTRNWIVVIIACSRCEIIFVPFNSRRGLKFNHHNTKIIALIILFFSYCISFVRLFAKKALICQDTNVPQLANHLLDYRAYRLFKTYCFFIYQSVLPVVIVGIVSLAMXXXXXXXXXXXXXXXTHINDCSYFRMNHLSDQRHSSR---KLNSQRKATRTILVLAVVFTLLEVPVFIIQSVVDRDDF-----SNHSILKIKLTELSNILVVLDSCSNIVVYLLTSDKFRLEVRRIFWQISSC-----QLCDENNYLSATEHLVVHQNNVLS 1688
            MF++ + NNC+     +  +    +S  IY+ + +  + +A + NG S++IL+R NS+ RFGQI+LNLL+LS+ ET L  FIT+F++     + +Y R      IG LW+D ++F+NITSL C RNWIV++IACSRCEI+F+P +S  GLKFN+   + ++++I   SY +S VRLF+KKA++C + +  +L  HL    AY +++TYCFFI+QSVLPV++VG +S  M++SL+           +         N LS + +S     + +SQRKAT+TI VLA+VFT LE PVFIIQ ++    F     SN  ++   +    N LVVLDSCSN +VYL+TSDKFR E RR+ W+ S C     Q    N+  S TE L+V Q+  ++
Sbjct:    1 MFLISFSNNCVFENITRPTL----ASKPIYSYMMILFSILASLANGVSVVILSRPNSSQRFGQIRLNLLILSISETSLNAFITVFNLTHIVNISQYSR------IGALWIDTMLFWNITSLICNRNWIVILIACSRCEIVFLPLHSVSGLKFNNKVIRNLSILIFIISYLLSSVRLFSKKAIVCTNIDEVKLQPHLSGQWAYSVYETYCFFIFQSVLPVLVVGGISAGMTYSLIKEPNPQLLRPQN---------NTLSQKSYSKTSNIRGSSQRKATKTIFVLAIVFTTLEAPVFIIQILIQNGTFAFILNSNPHVVYFII----NFLVVLDSCSNFMVYLVTSDKFRAEFRRLIWR-SGCYSQGRQRSVINDNFSVTEQLIVTQSQKMA 367          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000031763.1 (SMESG000031763.1)

HSP 1 Score: 243.047 bits (619), Expect = 3.184e-74
Identity = 166/374 (44.39%), Postives = 231/374 (61.76%), Query Frame = 3
Query:  570 MFIVKYINNCLIAQSNKTMIDNRESSSKIYATVSMALATMAFIFNGFSLIILTRKNSNLRFGQIKXXXXXXXXVETFLTGFITLFHVVVEYKRSANSGGIGLLWLDLIVFYNITSLTCTRNWIVVIIACSRCEIIFVPFNSRRGLKFNHHNTKIIALIILFFSYCISFVRLFAKKALICQDTNVPQLANHLLDYRAYRLFKTYCFFIYQSVLPVVIVGIVSLAMXXXXXXXXXXXXXXXTHINDCSYFRMNHLSDQRHSSRKLNSQRKATRTILVLAVVFTLLEVPVFIIQSVVDRD---DFSNHSILKIKLTELSNILVVLDSCSNIVVYLLTSDKFRLEVRRIFWQISSCQLCDEN---NYLSATEHLVVHQ 1673
            M I+ + N+C+   SN T   N E     Y  + + L+ +A   NG S+IIL+R N++ RFG I+LNLL+LS+ ET L   I +F++  E +         LL+ D  VF+NI +L CTRNWIVV+IA SRCE++F+P NS RGL FN+   K+ ++IIL  SY +SFVRLF+KKA++C + +   L  HL     Y +++TYCFFIYQSVLPV++V  VSLAM                 + +C   R N L  +R + +   SQRKATRTI VLA+VFT LE PVFIIQ++         +N++ L+ ++  L N+LVV DSC N+ VY++TSDKFR E+RR+      C    ++     LSATEHL+V+Q
Sbjct:    1 MLILNFSNSCI--PSNVTSNVNSEP----YRPLIICLSILATFLNGISVIILSRSNASHRFGPIRLNLLILSISETALNSLIAVFNIASESELDKLFSVTALLF-DTFVFWNILTLICTRNWIVVLIALSRCEVVFLPLNSVRGLTFNNSVIKLCSVIILLLSYLLSFVRLFSKKAIVCSNLSKILLEPHLYKSWQYVIYETYCFFIYQSVLPVILVAGVSLAM------FVSLIRGPKEELTECKSSR-NQLGMKRKTIKAF-SQRKATRTIFVLAIVFTSLEGPVFIIQALTQSGMILTGNNNAKLRRQVFFLINLLVVFDSCCNVFVYMITSDKFRGEIRRLMGVFGYCTNGQQSFALGKLSATEHLIVNQ 359          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000063918.1 (SMESG000063918.1)

HSP 1 Score: 130.183 bits (326), Expect = 9.395e-33
Identity = 102/353 (28.90%), Postives = 184/353 (52.12%), Query Frame = 3
Query:  570 MFIVKYINNC---LIAQSNKTMIDNR----ESSSKIYATVSMALATMAFIFNGFSLIILTRKNSNLRFGQIKXXXXXXXXVETFLTGFITLFHVVVEYKRSANSGGIGLLWLDLIVFYNITSLTCTRNWIVVIIACSRCEIIFVPFNSRRGLKFNHHNTKIIALIILFFSYCISFVRLFAKKALICQDTNVPQLANHLLDYRAYRLFKTYCFFIYQSVLPVVIVGIVSLAMXXXXXXXXXXXXXXXTHINDCSYFRMNHLSDQRHSSRKLNSQRKATRTILVLAVVFTLLEVPVFIIQSVVDRDDFSNHSILKIKLTELSNILVVLDSCSNIVVYLLTSDKFRLEVRRIFWQI 1607
            MF++ Y+ NC        N     N     + S+ I+  V   +A + F+ N  ++  L++     R   ++      +++E  L  +I     +  +    +   +  +    + F++I +L C+RNW+V+++A +R E IF P   R    F+   +++  +I+L  S+ +S +R+F KKA++C++ N     +H  +   Y+ F+   +FIYQSV PVVIV I +L M    +      ++ STH+    YFR N        ++ + SQ+KAT TI VLA VFT+ E+P+FII   + +  + N     + L +++  LVV+DSC N ++Y+ TS+ +R ++  +F +I
Sbjct:    1 MFLIHYVRNCSNVYYFHKNLNFSSNEYELFDYSTNIFIAV---VAIIGFVTNTLTVFTLSQPRFKGRSHNMRYTSFYHAIIELVLDLWI-FTDKISMFAHLPDDKYVSAMIFSTLTFWSINALLCSRNWMVMLVALARLEAIFRPLKIRSYSIFSSCKSRLYTIIVLLLSFSLSVIRVFYKKAIVCENENKIIFDSHWKNSSLYQCFEI-GYFIYQSVFPVVIVTISTLTM----IYFLFKQTFKSTHLLK-QYFREN-------ETQCMTSQQKATLTITVLAGVFTVTEIPIFII--TLLKFTYPNGLSNLMVLYQITRALVVVDSCCNFLIYVSTSEHYRRDLWYLFQRI 334          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000037130.1 (SMESG000037130.1)

HSP 1 Score: 83.9593 bits (206), Expect = 2.282e-17
Identity = 66/245 (26.94%), Postives = 110/245 (44.90%), Query Frame = 3
Query:  900 YNITSLTCTRNWIVVIIACSRCEIIFVPFNSRRGLKFNHHNTKIIALIILFFSYCISFVRLFAKKALICQDTNVPQLANHLL-DYRAYRLFKTYCFFIYQSVLPVVIVGIVSLAMXXXXXXXXXXXXXXXTHINDCSYFRMNHLSDQRHSSRKLNSQRKATRTILVLAVVFTLLEVPVFIIQSVVDRDDFSNHSILKIKLTELSNILVVLDSCSNIVVYLLTSDKFRLEVRRIFWQISSCQLCDE 1631
            + I S  C RNW VV++  SRCE++  P ++R  + F+H+ T I  +  +  S+ +SF+        IC++     L    L  YR +  F+ Y  F++QS +PV++  I ++ +   L  ++      S             +    HS R        T  +LV ++VF LL++P FI   +     F +  +  I     SN   +L S  N  VY  +S +FR  ++ I       QL D+
Sbjct:   79 WGINSFICMRNWTVVLLTLSRCEVVINPLSTRNRMIFSHYRTVIFEISFVTSSFSLSFLNNLRFLIKICENLQGIVLTEKFLAKYRFFHYFQIYGIFMFQSCIPVLVTVIATVIIWVCLQQASSIGRGGSNM----------EIHKHSHSVRT-----NTTGLVLVFSIVFCLLQIPTFIATCI---TTFRSSHLYTIHPDIFSNTFCILGSLLNFFVYAASSKRFRSSLKAILISSERVQLSDQ 305          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183SJQ73.431e-2229.00G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A3P7M9356.030e-2128.64G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A0R3T6F12.044e-1828.76G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A0R3SJV12.321e-1828.12G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
G7Y2I61.460e-1726.43G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO387846.178e-638.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016965.10.000e+0100.00SMESG000016965.1[more]
SMESG000078733.12.530e-8342.71SMESG000078733.1[more]
SMESG000031763.13.184e-7444.39SMESG000031763.1[more]
SMESG000063918.19.395e-3328.90SMESG000063918.1[more]
SMESG000037130.12.282e-1726.94SMESG000037130.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004551 ID=SMED30004551|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1876bp
AAAATTTATAAAATAATTTTATTTTCGTAAATCAAATATTATTTTTAGCA
TAATTTATTTAATTGGATGTGCATTTTTATGGTTATAATCACCGGGCCCA
TAATAATGCCCATTTTATTTTTCATCTTTCTCTTTCTGATTATGCTCAAA
ACCGGTTACTCAACATTACAATTTCCACAAAAAAGAGAAAGCCAAATCAT
CAAGGGTTATTTACCTTTACATTTTTACCCTTACATTTTCGGTGACGACC
TTCCTATTTCTGTTGGCGCAGAAAGTGATTAATTATCGATTAAAATTATT
GATAAAAAAATAAAAATAAAATTAAAAATTAATTCAAAGAATTTAAGTGC
AAGCACTAAAACTAGTGTATAAAACTAGCGGCTAGCCAATGCAAAATTAC
ACACAAAAAACTCATAAAAAAGGTTTATAAAAGTCTCAAAATCTCACAGT
AAAATTGCGCTTGTTTTATTGGATTAGAGAAAATGTTTATTTTTCACAAA
TTAACAAATCGAGAGATTTTGATTGGCTGGCTGACGCTAAAAATTTCTCC
GAAAAGAATTATCGCACAAATGTTCATAGTGAAATATATTAATAACTGCT
TGATAGCACAGTCGAACAAAACGATGATCGACAACCGGGAGAGTTCGAGC
AAAATCTACGCAACCGTTTCAATGGCTTTGGCAACGATGGCCTTCATTTT
CAATGGATTTTCTTTGATCATTCTGACGAGAAAGAACTCGAATTTACGAT
TCGGACAAATCAAATTGAATCTGTTGCTGTTGTCATTGGTCGAGACGTTT
TTGACTGGATTTATCACTCTGTTTCATGTGGTAGTCGAATACAAGAGGTC
CGCAAATTCCGGTGGAATCGGGTTGCTTTGGTTGGATTTGATTGTGTTTT
ACAACATCACCTCATTGACTTGCACGAGAAATTGGATCGTTGTCATAATA
GCCTGTTCAAGATGCGAAATCATTTTTGTACCCTTCAACAGTCGAAGGGG
TTTGAAGTTTAATCATCACAACACGAAAATTATCGCTTTGATCATTTTGT
TTTTCTCGTATTGTATATCGTTCGTCAGATTGTTCGCCAAGAAAGCCCTG
ATTTGTCAGGATACAAATGTCCCTCAACTAGCCAACCATCTTTTGGATTA
CCGCGCATATCGTTTGTTTAAAACTTACTGTTTCTTCATTTACCAATCCG
TATTGCCCGTCGTGATTGTCGGAATAGTCAGCTTGGCGATGTCTTTCAGT
CTTCTAGGATCAACGAGATCATCGTCATATAACTCGACTCACATCAATGA
CTGCTCGTATTTTCGCATGAACCATTTATCAGATCAACGTCATTCAAGCA
GAAAATTGAACAGCCAACGTAAAGCTACTCGAACGATTCTGGTGTTGGCG
GTCGTGTTCACGTTGCTTGAAGTTCCGGTTTTTATCATACAATCTGTCGT
AGACCGGGATGACTTTTCCAACCATTCAATTCTGAAAATAAAATTAACTG
AACTCAGCAATATCCTGGTCGTGTTGGATTCCTGTAGCAATATCGTCGTG
TATTTGTTGACGAGTGACAAGTTCCGATTGGAAGTTCGTCGGATCTTCTG
GCAGATAAGCAGCTGCCAGTTATGCGATGAAAATAACTACCTCTCCGCGA
CCGAGCATTTAGTGGTTCATCAAAACAATGTTCTCTCCCTTCTATCGGCC
ATACCTCTTTCTACTCGTTCGAATCCGAGCCACGATAAAGAATAATATTT
ATGCTAGAAATAGACATGATTATGAGAGTGGACTAATAACTTGCATGTCA
AAAGGAACTCCAAGAGTAACAGATTTAGTAAAATGTCTGTGATTTTTCTG
AATTTATTTTCTATTAATGGTCTCGT
back to top

protein sequence of SMED30004551-orf-1

>SMED30004551-orf-1 ID=SMED30004551-orf-1|Name=SMED30004551-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=421bp
MFIFHKLTNREILIGWLTLKISPKRIIAQMFIVKYINNCLIAQSNKTMID
NRESSSKIYATVSMALATMAFIFNGFSLIILTRKNSNLRFGQIKLNLLLL
SLVETFLTGFITLFHVVVEYKRSANSGGIGLLWLDLIVFYNITSLTCTRN
WIVVIIACSRCEIIFVPFNSRRGLKFNHHNTKIIALIILFFSYCISFVRL
FAKKALICQDTNVPQLANHLLDYRAYRLFKTYCFFIYQSVLPVVIVGIVS
LAMSFSLLGSTRSSSYNSTHINDCSYFRMNHLSDQRHSSRKLNSQRKATR
TILVLAVVFTLLEVPVFIIQSVVDRDDFSNHSILKIKLTELSNILVVLDS
CSNIVVYLLTSDKFRLEVRRIFWQISSCQLCDENNYLSATEHLVVHQNNV
LSLLSAIPLSTRSNPSHDKE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: INTERPRO
TermDefinition
IPR0194277TM_GPCR_serpentine_rcpt_Srw
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0008528G-protein coupled peptide receptor activity
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 41..381
e-value: 6.9E-26
score: 92.9
NoneNo IPR availablePANTHERPTHR24241NEUROPEPTIDE RECEPTOR-RELATED G-PROTEIN COUPLED RECEPTORcoord: 56..373
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 136..365
e-value: 6.14999E-13
score: 66.8876
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 50..384
NoneNo IPR availableTMHMMTMhelixcoord: 338..360
NoneNo IPR availableTMHMMTMhelixcoord: 95..117
NoneNo IPR availableTMHMMTMhelixcoord: 236..258
NoneNo IPR availableTMHMMTMhelixcoord: 183..202
NoneNo IPR availableTMHMMTMhelixcoord: 151..170
NoneNo IPR availableTMHMMTMhelixcoord: 301..323
NoneNo IPR availableTMHMMTMhelixcoord: 124..146
NoneNo IPR availableTMHMMTMhelixcoord: 58..80
IPR0194277TM GPCR, serpentine receptor class w (Srw)PFAMPF103247TM_GPCR_Srwcoord: 62..373
e-value: 3.0E-6
score: 26.8
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 73..357
score: 15.015