Kinesin-domain-containing protein

Overview
NameKinesin-domain-containing protein
Smed IDSMED30004550
Length (bp)1749
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin-domain-containing protein (SMED30004550) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin-domain-containing protein (SMED30004550) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinesin-domain-containing protein (SMED30004550) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinesin-domain-containing protein (SMED30004550) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004550

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30004550SMESG000077277.1 SmedASXL_015116SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30004550SMESG000077277.1 dd_Smed_v4_14426_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004550SMESG000077277.1 SMED_12208_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin-domain-containing protein vs. Ensembl Human
Match: CENPE (centromere protein E [Source:HGNC Symbol;Acc:HGNC:1856])

HSP 1 Score: 78.9518 bits (193), Expect = 1.648e-14
Identity = 70/291 (24.05%), Postives = 131/291 (45.02%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFESIKS-TVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRST-ISNLDFIELNYND-------SGPFVKFICNIQSKEETF---------------------ENCISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPII 920
            F FD VF  N   K V+E I +  +D+  +G +  I A+G   +GK++T+ G++   G+    I+ I   ++K   ++ ++++SY +I N  I DLL  +  +  +       ++ YV +L + +  +      +   G+  R        Q+  + HTIFR+I+E  E     N + S  +S+L+ ++L  ++       +G  +K  CNI      F                     ++ ++ +L  S  G   T +IC I   +  ET   L+ A++A+  K  P +
Sbjct:   47 FNFDRVFHGNETTKNVYEEIAAPIIDSAIQGYNGTIFAYGQTASGKTYTMMGSEDHLGVIPRAIHDIFQKIKKFPDREFLLRVSYMEIYNETITDLLCGTQKMKPLIIREDVNRNVYVADLTEEVVYTSEMALKWITKGEKSRHYGETKMNQRSSRSHTIFRMILESREKGEPSNCEGSVKVSHLNLVDLAGSERAAQTGAAGVRLKEGCNINRS--LFILGQVIKKLSDGQVGGFINYRDSKLTRILQNSLGGNAKTRIICTITPVSFDETLTALQFASTAKYMKNTPYV 335          
BLAST of Kinesin-domain-containing protein vs. Ensembl Human
Match: CENPE (centromere protein E [Source:HGNC Symbol;Acc:HGNC:1856])

HSP 1 Score: 78.9518 bits (193), Expect = 1.658e-14
Identity = 70/291 (24.05%), Postives = 131/291 (45.02%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFESIKS-TVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRST-ISNLDFIELNYND-------SGPFVKFICNIQSKEETF---------------------ENCISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPII 920
            F FD VF  N   K V+E I +  +D+  +G +  I A+G   +GK++T+ G++   G+    I+ I   ++K   ++ ++++SY +I N  I DLL  +  +  +       ++ YV +L + +  +      +   G+  R        Q+  + HTIFR+I+E  E     N + S  +S+L+ ++L  ++       +G  +K  CNI      F                     ++ ++ +L  S  G   T +IC I   +  ET   L+ A++A+  K  P +
Sbjct:   47 FNFDRVFHGNETTKNVYEEIAAPIIDSAIQGYNGTIFAYGQTASGKTYTMMGSEDHLGVIPRAIHDIFQKIKKFPDREFLLRVSYMEIYNETITDLLCGTQKMKPLIIREDVNRNVYVADLTEEVVYTSEMALKWITKGEKSRHYGETKMNQRSSRSHTIFRMILESREKGEPSNCEGSVKVSHLNLVDLAGSERAAQTGAAGVRLKEGCNINRS--LFILGQVIKKLSDGQVGGFINYRDSKLTRILQNSLGGNAKTRIICTITPVSFDETLTALQFASTAKYMKNTPYV 335          
BLAST of Kinesin-domain-containing protein vs. Ensembl Human
Match: CENPE (centromere protein E [Source:HGNC Symbol;Acc:HGNC:1856])

HSP 1 Score: 78.9518 bits (193), Expect = 1.728e-14
Identity = 70/291 (24.05%), Postives = 131/291 (45.02%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFESIKS-TVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRST-ISNLDFIELNYND-------SGPFVKFICNIQSKEETF---------------------ENCISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPII 920
            F FD VF  N   K V+E I +  +D+  +G +  I A+G   +GK++T+ G++   G+    I+ I   ++K   ++ ++++SY +I N  I DLL  +  +  +       ++ YV +L + +  +      +   G+  R        Q+  + HTIFR+I+E  E     N + S  +S+L+ ++L  ++       +G  +K  CNI      F                     ++ ++ +L  S  G   T +IC I   +  ET   L+ A++A+  K  P +
Sbjct:   47 FNFDRVFHGNETTKNVYEEIAAPIIDSAIQGYNGTIFAYGQTASGKTYTMMGSEDHLGVIPRAIHDIFQKIKKFPDREFLLRVSYMEIYNETITDLLCGTQKMKPLIIREDVNRNVYVADLTEEVVYTSEMALKWITKGEKSRHYGETKMNQRSSRSHTIFRMILESREKGEPSNCEGSVKVSHLNLVDLAGSERAAQTGAAGVRLKEGCNINRS--LFILGQVIKKLSDGQVGGFINYRDSKLTRILQNSLGGNAKTRIICTITPVSFDETLTALQFASTAKYMKNTPYV 335          
BLAST of Kinesin-domain-containing protein vs. Ensembl Human
Match: KIF3B (kinesin family member 3B [Source:HGNC Symbol;Acc:HGNC:6320])

HSP 1 Score: 76.2554 bits (186), Expect = 8.233e-14
Identity = 75/306 (24.51%), Postives = 128/306 (41.83%), Query Frame = 3
Query:  138 KAIFHQNENLFEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD----GL----FNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYND-------SGPFVKFICNIQSKEETFENCISA------------------VLYKSYLGLGNTVLICNIALS--NIKETKQILKLATSARQFKGNPII 920
            K   H+    F FD V+D N+   +++ E+ +  VD+V +G +  I A+G  G GK++T+ G + D    G+    F++I  +I    R Q Q+  +++ SY +I    I+DLL S +    +          YV +L  ++  S    EH    G+  R        +   + H IF + IE  E   +D      +  L+ ++L  ++        G  +K    I        N ISA                  +L  S  G   TV++ N+  +  N++ET   L+ A  A+  K  P +
Sbjct:   47 KGTAHEMPKTFTFDAVYDWNAKQFELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGIRGDPEKRGVIPNSFDHIFTHIS---RSQNQQ-YLVRASYLEIYQEEIRDLL-SKDQTKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSEVG-LDGENHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRLLQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRV 346          
BLAST of Kinesin-domain-containing protein vs. Ensembl Human
Match: KIF4A (kinesin family member 4A [Source:HGNC Symbol;Acc:HGNC:13339])

HSP 1 Score: 69.3218 bits (168), Expect = 1.471e-11
Identity = 71/295 (24.07%), Postives = 131/295 (44.41%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD--------GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSN--SLVTVAFDP--------ICQKSKYVNLKQYICLSKSSFEHYKKSGDDKRQQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFI----ELNYNDSGPFVKFICNIQSKEETFENCISA-------------------VLYKSYLGLGNTVLICNI--ALSNIKETKQILKLATSARQFKGNPII 920
            F +D VFD +++ ++VF  ++   +  VF+G +A ++A+G  G+GK++++ G  +         G+   +I  +  ++ K++  +  +K+SY +I N  I DLL  S   + + +  DP        + +K+  V L    CL + +      S      Q  + H IF + +E  + +  ++  RS +  +D      +      G  +K   NI        N ISA                   +L  S  G  +T++I  +  A SN++ET   L+ A  AR+ K  PI+
Sbjct:   49 FTYDFVFDPSTEQEEVFNTAVAPLIKGVFKGYNATVLAYGQTGSGKTYSMGGAYTAEQENEPTVGVIPRVIQLLFKEIDKKSDFEFTLKVSYLEIYNEEILDLLCPSREKAQINIREDPKEGIKIVGLTEKTVLVALDTVSCLEQGNNSRTVAS-TAMNSQSSRSHAIFTISLEQRKKSDKNSSFRSKLHLVDLAGSERQKKTKAEGDRLKEGININRGLLCLGNVISALGDDKKGGFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNLEETLNTLRYADRARKIKNKPIV 342          
BLAST of Kinesin-domain-containing protein vs. Ensembl Celegans
Match: klp-13 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:H2KYL6])

HSP 1 Score: 66.2402 bits (160), Expect = 3.977e-11
Identity = 78/316 (24.68%), Postives = 125/316 (39.56%), Query Frame = 3
Query:  150 HQNENLFEFDEVFDANSDNKKVFESIKSTV-DNVFRGISANIIAFGMPGNGKSHTLFGTK-SDGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFD-------PICQKSKYVNLKQYICLSKSSFEHYKKSGDDKRQQKY--------KGHTIFRV-------------IIELIESNSIDN-------LKRSTISNLDFIELNYNDSGPFVKFICNIQSKEETFENC----ISAVLYKSYLGLGNTVLICNI--ALSNIKETKQILKLATSARQFKGNPIIERFVQHDENYFINLNT 968
             Q+E  FEFD  F A S+ + V E+    + D+V  G +A + A+G  G+GK+ T+ GTK   GL   +   + + L  Q Q    + +SY +I N  I+DLL  S   + +  D       P     K  N+ Q +           + G+ +R Q+         + H + +V             +I+L  S    N       LK     N   + L           I ++ SK   F N     ++ +L  S  G   T +I ++  + SN +ET   L  A+ A      P+  R    D+ Y   +N 
Sbjct:   71 RQHERKFEFDASFGATSNQEDVHETTTGPIIDSVVEGFNATVFAYGATGSGKTFTMIGTKDRPGLMTLMTKTLYEKLDNQYQ----VLLSYMEIYNEIIRDLLNPSGGDLELLEDERGNIRVPGLSSVKAPNIMQIL-----------QEGNLRRTQEATMANKTSSRSHALLQVMIVKNQSLHSKLFMIDLAGSERASNTQNRGIRLKEGAAINRSLLALG--------NVINSLASKTTKFVNYRDSKLTRLLKDSLGGTAKTCMIAHVTPSSSNFEETYNTLMYASRAMNITNKPMRNRPASADQVYAEAMNA 363          
BLAST of Kinesin-domain-containing protein vs. Ensembl Celegans
Match: klp-13 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:H2KYL6])

HSP 1 Score: 64.6994 bits (156), Expect = 6.367e-11
Identity = 42/132 (31.82%), Postives = 68/132 (51.52%), Query Frame = 3
Query:  150 HQNENLFEFDEVFDANSDNKKVFESIKSTV-DNVFRGISANIIAFGMPGNGKSHTLFGTK-SDGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDP-----ICQKSKYVNLK 524
             Q+E  FEFD  F A S+ + V E+    + D+V  G +A + A+G  G+GK+ T+ GTK   GL   +   + + L  Q Q    + +SY +I N  I+DLL  S   + +  D      + + +K+VN +
Sbjct:   71 RQHERKFEFDASFGATSNQEDVHETTTGPIIDSVVEGFNATVFAYGATGSGKTFTMIGTKDRPGLMTLMTKTLYEKLDNQYQ----VLLSYMEIYNEIIRDLLNPSGGDLELLEDERGNIRVPETTKFVNYR 198          
BLAST of Kinesin-domain-containing protein vs. Ensembl Celegans
Match: klp-11 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:E5QCG4])

HSP 1 Score: 65.4698 bits (158), Expect = 7.262e-11
Identity = 70/293 (23.89%), Postives = 118/293 (40.27%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFE-SIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD----GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLL-GSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYND-------SGPFVKFICNIQSKEETFENCISA------------------VLYKSYLGLGNTVLICNIALS--NIKETKQILKLATSARQFKGNPII 920
            F FD ++D NS    ++E + +  VD+V  G +A I A+G  G GK+HT+ G  SD    G+    I++I + +     ++ +++ SY +I    ++DLL   SN  + +   P      YV +L   +  +          G+  R        +   + H IF + +E       D     T+  L+ ++L  ++       +G   K    I        N ISA                  +L  S  G   TV++  I  +  N +ET   L+ A  A+  K  P I
Sbjct:   60 FTFDAIYDENSTQSDLYEETFRDLVDSVLNGYNATIFAYGQTGTGKTHTMEGKSSDPEQRGVIYKCIDHIFEHMAASHNQEYLVRASYLEIYQEELRDLLEAESNKKLEIKERP--DGGVYVKDLTSKLTRTVGEIHEVMIRGNGHRSVGRTNMNEHSSRSHAIFIITVECSRIGE-DGESHITVGRLNLVDLAGSERQSKTGATGERFKEATKINLSLSALGNVISALVDAKSAHIPYRDSKLTRLLQDSLGGNSKTVMVACIGPASYNFEETLGTLRYANRAKNIKNQPKI 349          
BLAST of Kinesin-domain-containing protein vs. Ensembl Celegans
Match: klp-13 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:H2KYL6])

HSP 1 Score: 65.0846 bits (157), Expect = 7.792e-11
Identity = 42/132 (31.82%), Postives = 68/132 (51.52%), Query Frame = 3
Query:  150 HQNENLFEFDEVFDANSDNKKVFESIKSTV-DNVFRGISANIIAFGMPGNGKSHTLFGTK-SDGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDP-----ICQKSKYVNLK 524
             Q+E  FEFD  F A S+ + V E+    + D+V  G +A + A+G  G+GK+ T+ GTK   GL   +   + + L  Q Q    + +SY +I N  I+DLL  S   + +  D      + + +K+VN +
Sbjct:   71 RQHERKFEFDASFGATSNQEDVHETTTGPIIDSVVEGFNATVFAYGATGSGKTFTMIGTKDRPGLMTLMTKTLYEKLDNQYQ----VLLSYMEIYNEIIRDLLNPSGGDLELLEDERGNIRVPETTKFVNYR 198          
BLAST of Kinesin-domain-containing protein vs. Ensembl Celegans
Match: klp-20 (Kinesin-like protein klp-20 [Source:UniProtKB/Swiss-Prot;Acc:Q965T6])

HSP 1 Score: 56.9954 bits (136), Expect = 3.089e-8
Identity = 33/101 (32.67%), Postives = 53/101 (52.48%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFE-SIKSTVDNVFRGISANIIAFGMPGNGKSHTLFG----TKSDGLFNYIINYICDDLRK-QTQKDVVIKISYFDIINSRIKDLL 452
            F FD VF  N+D   V+  + +  V+NV +G +  I A+G  G GK+ T+ G     +  G+      +I D + K Q     ++++SY +I N  I+DLL
Sbjct:   52 FYFDAVFSPNTDQMTVYNVAARPIVENVLKGYNGTIFAYGQTGTGKTFTMAGDLEPVEMRGIIPNSFAHIFDHIAKCQHDTTFLVRVSYLEIYNEEIRDLL 152          
BLAST of Kinesin-domain-containing protein vs. Ensembl Fly
Match: cmet (gene:FBgn0040232 transcript:FBtr0332203)

HSP 1 Score: 81.6481 bits (200), Expect = 1.244e-15
Identity = 84/333 (25.23%), Postives = 157/333 (47.15%), Query Frame = 3
Query:   63 KNMSVFKILSKIKP--ESLTSELEIKDKAIFHQNENLFE---FDEVFDANSDNKKVFESI-KSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLG----------SSNSLVTVAFDPICQKSKYVNLKQYICLSKSSFEHYKKSGD-DKRQQKYKGHTIFRVIIELIESNSIDN--LKRSTISNLDFIELNYNDS----GPFVK----------FICN-IQSKEETFENC--------ISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPIIERFV 932
            KN S  ++  K++P    LTS  ++K++   H  ++  E   FD VFD  + N++VF+ + K  V    +G +  I A+G   +GK++T+ G + + G+       I   +  +T++D ++++ Y +I N +I DLL           S N +V V  +  C  +  V+L + +CL        +  G+ +  ++  + H IF++IIE  +S+  D+  + +S ++ +D       D     G  +K          F+ N I+S  E  +N         ++ +L  S  G   T +IC I  S ++E++  L  AT A++ +  P +   V
Sbjct:    4 KNASSIQVCIKVRPCEPGLTSLWQVKERRSIHLADSHAEPYVFDYVFDEGASNQEVFDRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQQISSETERDFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGIVNVNCEE-CIITSEVDLLRLLCLGNKE----RTVGETNMNERSSRSHAIFKIIIESRKSDHSDDDAVIQSVLNLVDLAGSERADQTGARGARLKEGGHINKSLLFLSNVIKSLSENADNRFTNYRDSKLTRILQASLGGNAFTSIICTIKPSIMEESQSTLSFATRAKKIRIKPQVNEMV 331          
BLAST of Kinesin-domain-containing protein vs. Ensembl Fly
Match: cmet (gene:FBgn0040232 transcript:FBtr0332205)

HSP 1 Score: 81.6481 bits (200), Expect = 1.255e-15
Identity = 84/333 (25.23%), Postives = 157/333 (47.15%), Query Frame = 3
Query:   63 KNMSVFKILSKIKP--ESLTSELEIKDKAIFHQNENLFE---FDEVFDANSDNKKVFESI-KSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLG----------SSNSLVTVAFDPICQKSKYVNLKQYICLSKSSFEHYKKSGD-DKRQQKYKGHTIFRVIIELIESNSIDN--LKRSTISNLDFIELNYNDS----GPFVK----------FICN-IQSKEETFENC--------ISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPIIERFV 932
            KN S  ++  K++P    LTS  ++K++   H  ++  E   FD VFD  + N++VF+ + K  V    +G +  I A+G   +GK++T+ G + + G+       I   +  +T++D ++++ Y +I N +I DLL           S N +V V  +  C  +  V+L + +CL        +  G+ +  ++  + H IF++IIE  +S+  D+  + +S ++ +D       D     G  +K          F+ N I+S  E  +N         ++ +L  S  G   T +IC I  S ++E++  L  AT A++ +  P +   V
Sbjct:    4 KNASSIQVCIKVRPCEPGLTSLWQVKERRSIHLADSHAEPYVFDYVFDEGASNQEVFDRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQQISSETERDFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGIVNVNCEE-CIITSEVDLLRLLCLGNKE----RTVGETNMNERSSRSHAIFKIIIESRKSDHSDDDAVIQSVLNLVDLAGSERADQTGARGARLKEGGHINKSLLFLSNVIKSLSENADNRFTNYRDSKLTRILQASLGGNAFTSIICTIKPSIMEESQSTLSFATRAKKIRIKPQVNEMV 331          
BLAST of Kinesin-domain-containing protein vs. Ensembl Fly
Match: cmet (gene:FBgn0040232 transcript:FBtr0332204)

HSP 1 Score: 81.2629 bits (199), Expect = 1.447e-15
Identity = 84/333 (25.23%), Postives = 157/333 (47.15%), Query Frame = 3
Query:   63 KNMSVFKILSKIKP--ESLTSELEIKDKAIFHQNENLFE---FDEVFDANSDNKKVFESI-KSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLG----------SSNSLVTVAFDPICQKSKYVNLKQYICLSKSSFEHYKKSGD-DKRQQKYKGHTIFRVIIELIESNSIDN--LKRSTISNLDFIELNYNDS----GPFVK----------FICN-IQSKEETFENC--------ISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPIIERFV 932
            KN S  ++  K++P    LTS  ++K++   H  ++  E   FD VFD  + N++VF+ + K  V    +G +  I A+G   +GK++T+ G + + G+       I   +  +T++D ++++ Y +I N +I DLL           S N +V V  +  C  +  V+L + +CL        +  G+ +  ++  + H IF++IIE  +S+  D+  + +S ++ +D       D     G  +K          F+ N I+S  E  +N         ++ +L  S  G   T +IC I  S ++E++  L  AT A++ +  P +   V
Sbjct:    4 KNASSIQVCIKVRPCEPGLTSLWQVKERRSIHLADSHAEPYVFDYVFDEGASNQEVFDRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQQISSETERDFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGIVNVNCEE-CIITSEVDLLRLLCLGNKE----RTVGETNMNERSSRSHAIFKIIIESRKSDHSDDDAVIQSVLNLVDLAGSERADQTGARGARLKEGGHINKSLLFLSNVIKSLSENADNRFTNYRDSKLTRILQASLGGNAFTSIICTIKPSIMEESQSTLSFATRAKKIRIKPQVNEMV 331          
BLAST of Kinesin-domain-containing protein vs. Ensembl Fly
Match: cmet (gene:FBgn0040232 transcript:FBtr0332202)

HSP 1 Score: 81.2629 bits (199), Expect = 1.619e-15
Identity = 84/333 (25.23%), Postives = 157/333 (47.15%), Query Frame = 3
Query:   63 KNMSVFKILSKIKP--ESLTSELEIKDKAIFHQNENLFE---FDEVFDANSDNKKVFESI-KSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLG----------SSNSLVTVAFDPICQKSKYVNLKQYICLSKSSFEHYKKSGD-DKRQQKYKGHTIFRVIIELIESNSIDN--LKRSTISNLDFIELNYNDS----GPFVK----------FICN-IQSKEETFENC--------ISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPIIERFV 932
            KN S  ++  K++P    LTS  ++K++   H  ++  E   FD VFD  + N++VF+ + K  V    +G +  I A+G   +GK++T+ G + + G+       I   +  +T++D ++++ Y +I N +I DLL           S N +V V  +  C  +  V+L + +CL        +  G+ +  ++  + H IF++IIE  +S+  D+  + +S ++ +D       D     G  +K          F+ N I+S  E  +N         ++ +L  S  G   T +IC I  S ++E++  L  AT A++ +  P +   V
Sbjct:    4 KNASSIQVCIKVRPCEPGLTSLWQVKERRSIHLADSHAEPYVFDYVFDEGASNQEVFDRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQQISSETERDFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGIVNVNCEE-CIITSEVDLLRLLCLGNKE----RTVGETNMNERSSRSHAIFKIIIESRKSDHSDDDAVIQSVLNLVDLAGSERADQTGARGARLKEGGHINKSLLFLSNVIKSLSENADNRFTNYRDSKLTRILQASLGGNAFTSIICTIKPSIMEESQSTLSFATRAKKIRIKPQVNEMV 331          
BLAST of Kinesin-domain-containing protein vs. Ensembl Fly
Match: cana (gene:FBgn0040233 transcript:FBtr0091678)

HSP 1 Score: 79.337 bits (194), Expect = 5.717e-15
Identity = 79/317 (24.92%), Postives = 148/317 (46.69%), Query Frame = 3
Query:   63 KNMSVFKILSKIKP--ESLTSELEIKDKAIFHQNENLFE---FDEVFDANSDNKKVFESI-KSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTV--AFDPICQKSKYVNLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDN--LKRSTISNLDFIELNYNDSGP----------FVKFIC-NIQSKEETFENC-ISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPII 920
            KN S  ++  K++P    LTS  ++K+       ++  E   FD VFD  + N++VF+ + K  V    +G +  I A+G   +GK++T+ G + + G+       I   +  +T++D ++++ Y +I N +I DLL   N  + +  + + I      VN K+ I  S+         G+ +R        ++  + H IFR+IIE  +S+  DN  +K+S +S +D       D              VK +  ++ SK  +F +  +  ++  S  G   T +IC I  S ++E+   +   T A++ +  P +
Sbjct:    4 KNASSIQVCIKVRPCEPGLTSLWQVKEGRSIQLADSHAEPYVFDYVFDEGASNQEVFDRMAKHIVHACMQGSNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQQISSETERDFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGIVN----VNCKESIVTSEDDLLRQLYMGNKERVVGETNMNERSSRSHAIFRIIIESRKSDHSDNDTVKQSVLSLVDLAGSEQVDPADHASSLMIFRNLVKSLSESVDSKPNSFRDSKLPRIMLPSLGGNVLTSIICTITPSFVEESSSTISFGTCAKKIRCKPQV 316          
BLAST of Kinesin-domain-containing protein vs. Ensembl Zebrafish
Match: kif3b (kinesin family member 3B [Source:ZFIN;Acc:ZDB-GENE-050119-3])

HSP 1 Score: 76.6406 bits (187), Expect = 3.758e-14
Identity = 77/305 (25.25%), Postives = 128/305 (41.97%), Query Frame = 3
Query:  141 AIFHQNENLFEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD----GL----FNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYND-------SGPFVKFICNIQSKEETFENCISA------------------VLYKSYLGLGNTVLICNIALS--NIKETKQILKLATSARQFKGNPII 920
            A  H++  +F FD V+D NS   +++ E+ +  VD+V  G +  I A+G  G GK++T+ G ++D    G+    F +I  +I    R Q Q+  +++ SY +I    I+DLL S +    +          YV +L  ++  S    EH    G+  R        +   + H IF + IE  E    D      +  L+ ++L  ++        G  +K    I        N ISA                  +L  S  G   TV++ NI  +  N++ET   L+ A  A+  K  P +
Sbjct:   49 ASSHEHPKVFTFDSVYDWNSKQMELYDETFRPLVDSVLFGFNGTIFAYGQTGTGKTYTMEGVRNDPERRGVIPNSFEHIFTHIS---RSQNQQ-YLVRASYLEIYQEEIRDLL-SKDQARRLELKERPDTGVYVKDLSSFVTKSVREIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSELGP-DGENHIRVGKLNLVDLAGSERQTKTGAQGERLKEATKINLSLSALGNVISALVDGRSTHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNVEETLTTLRYANRAKNIKNKPRV 347          
BLAST of Kinesin-domain-containing protein vs. Ensembl Zebrafish
Match: kif3b (kinesin family member 3B [Source:ZFIN;Acc:ZDB-GENE-050119-3])

HSP 1 Score: 76.6406 bits (187), Expect = 3.758e-14
Identity = 77/305 (25.25%), Postives = 128/305 (41.97%), Query Frame = 3
Query:  141 AIFHQNENLFEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD----GL----FNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYND-------SGPFVKFICNIQSKEETFENCISA------------------VLYKSYLGLGNTVLICNIALS--NIKETKQILKLATSARQFKGNPII 920
            A  H++  +F FD V+D NS   +++ E+ +  VD+V  G +  I A+G  G GK++T+ G ++D    G+    F +I  +I    R Q Q+  +++ SY +I    I+DLL S +    +          YV +L  ++  S    EH    G+  R        +   + H IF + IE  E    D      +  L+ ++L  ++        G  +K    I        N ISA                  +L  S  G   TV++ NI  +  N++ET   L+ A  A+  K  P +
Sbjct:   49 ASSHEHPKVFTFDSVYDWNSKQMELYDETFRPLVDSVLFGFNGTIFAYGQTGTGKTYTMEGVRNDPERRGVIPNSFEHIFTHIS---RSQNQQ-YLVRASYLEIYQEEIRDLL-SKDQARRLELKERPDTGVYVKDLSSFVTKSVREIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSELGP-DGENHIRVGKLNLVDLAGSERQTKTGAQGERLKEATKINLSLSALGNVISALVDGRSTHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNVEETLTTLRYANRAKNIKNKPRV 347          
BLAST of Kinesin-domain-containing protein vs. Ensembl Zebrafish
Match: kif3b (kinesin family member 3B [Source:ZFIN;Acc:ZDB-GENE-050119-3])

HSP 1 Score: 76.6406 bits (187), Expect = 3.771e-14
Identity = 77/305 (25.25%), Postives = 128/305 (41.97%), Query Frame = 3
Query:  141 AIFHQNENLFEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD----GL----FNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYND-------SGPFVKFICNIQSKEETFENCISA------------------VLYKSYLGLGNTVLICNIALS--NIKETKQILKLATSARQFKGNPII 920
            A  H++  +F FD V+D NS   +++ E+ +  VD+V  G +  I A+G  G GK++T+ G ++D    G+    F +I  +I    R Q Q+  +++ SY +I    I+DLL S +    +          YV +L  ++  S    EH    G+  R        +   + H IF + IE  E    D      +  L+ ++L  ++        G  +K    I        N ISA                  +L  S  G   TV++ NI  +  N++ET   L+ A  A+  K  P +
Sbjct:   49 ASSHEHPKVFTFDSVYDWNSKQMELYDETFRPLVDSVLFGFNGTIFAYGQTGTGKTYTMEGVRNDPERRGVIPNSFEHIFTHIS---RSQNQQ-YLVRASYLEIYQEEIRDLL-SKDQARRLELKERPDTGVYVKDLSSFVTKSVREIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSELGP-DGENHIRVGKLNLVDLAGSERQTKTGAQGERLKEATKINLSLSALGNVISALVDGRSTHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNVEETLTTLRYANRAKNIKNKPRV 347          
BLAST of Kinesin-domain-containing protein vs. Ensembl Zebrafish
Match: cenpe (centromere protein E [Source:ZFIN;Acc:ZDB-GENE-060929-860])

HSP 1 Score: 67.781 bits (164), Expect = 3.093e-11
Identity = 75/342 (21.93%), Postives = 141/342 (41.23%), Query Frame = 3
Query:  135 DKAIFHQ------NENLFEFDEVFDANSDNKKVFESI-KSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRS----TISNLDFIEL-------NYNDSGPFVKFICNIQSKEETFENCI-------------------SAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPIIER------FVQHDENYFINLNTELNELIKICKS 1001
            DK   HQ          + FD VF A     ++++ I K  V +   G +  I A+G   +GK+ T+ G++ + G+    +  +   ++   +K+ ++++SY +I N  + DLL  S     +       K+ YV +L + +  S      +   G+  R        Q+  + HTIFR+I+E  E +     + +     +S+L+ ++L            G   K  CNI     T    I                   + +L  S  G   TV+IC I  + + ET   L+ A++A++ K +P +         ++   N  ++L   L E+  + ++
Sbjct:   35 DKQAIHQLDEDGAQTKSYSFDRVFSAAESTAQLYQDIAKPLVVSAVEGYNGTIFAYGQTSSGKTFTMMGSEHNPGVIPLAMADVFKTIKSFPKKEFLLRVSYMEIYNETVTDLLCDSWKRKPLEIREGNYKNVYVADLTEELVTSPEQALSWITKGEKNRHYGKTKMNQRSSRSHTIFRMILESRERSDPTAGESADGAIIVSHLNLVDLAGAERASQTGAEGARFKEGCNINRSLFTLGQVIKKLSDESQKGFLNYRDSKLTRILQNSLGGNAKTVIICTITPATVDETVSTLQFASAAKRMKNDPHVTEVSDEGALLRRYRNEIVDLKRRLQEVSSVTQT 376          
BLAST of Kinesin-domain-containing protein vs. Ensembl Zebrafish
Match: kif4 (kinesin family member 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1545])

HSP 1 Score: 63.5438 bits (153), Expect = 5.902e-10
Identity = 68/299 (22.74%), Postives = 126/299 (42.14%), Query Frame = 3
Query:  156 NENLFEFDEVFDANSDNKKVFES-IKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD--------GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNS--LVTVAFDPI-------CQKSKYVNLKQYICLSKSSFEHYKKSGDDKRQQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFI----ELNYNDSGPFVKFICNIQSKEETFENCISA--------------------VLYKSYLGLGNTVLICNI--ALSNIKETKQILKLATSARQFKGNPII 920
            N+  F FD VFD  ++ ++VF + +   +  +F+G  A ++A+G  G+GK+ ++ GT +         G+   +I  I  +  K+T  + V+ +SY +I N  I DLL +S    ++++  DP          +   +N  + +C  +                  + H IF + +E   +    ++  S +  +D      +      G  +K   +I     +  N ISA                    +L  S  G  +T++I  +  A SNI+ET   L+ A  AR+ K  P++
Sbjct:   46 NDKAFTFDYVFDPTTEQEEVFNTAVSPLLSGLFKGYHATVLAYGQTGSGKTFSMGGTYTSEQENEPTVGVIPRVIRRIFQEKAKRTDCEFVLAVSYLEIYNEEILDLLCTSKDKPVISIREDPKDGIKIVGLTERDVLNAHEMVCCLEMGNSARTVGSTAMNAASSRSHAIFTISLEQRRNGDKTDVMVSKLHLVDLAGSERQKKTKAEGDRLKEGISINRGLLSLGNVISALGDESKKGSFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNIEETINTLRYADRARKIKNKPVL 344          
BLAST of Kinesin-domain-containing protein vs. Ensembl Xenopus
Match: insm2 (insulinoma-associated 2 [Source:Xenbase;Acc:XB-GENE-986609])

HSP 1 Score: 70.4774 bits (171), Expect = 4.811e-12
Identity = 73/296 (24.66%), Postives = 123/296 (41.55%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD----GL----FNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYND-------SGPFVKFICNIQSKEETFENCISA------------------VLYKSYLGLGNTVLICNIALS--NIKETKQILKLATSARQFKGNPII 920
            F FD V+D+NS   +++ E+ +  VD+V  G +  I A+G  G GK++T+ G + D    G+    F +I  +I    R Q Q+  +++ SY +I    I+DLL    S   +          YV +L  ++  S    EH    G+  R        +   + H IF + IE  +   +D      +  L+ ++L  ++        G  +K    I        N ISA                  +L  S  G   TV++ NI  +  N++ET   L+ +  A+  K  P +
Sbjct:   57 FTFDAVYDSNSKQVELYDETFRPLVDSVLLGFNGTIFAYGQTGTGKTYTMEGVRIDPEKRGVIPNSFEHIFTHIS---RSQNQQ-YLVRASYLEIYQEEIRDLLSKDQS-KRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFMITIECSQIG-LDGENHIRVGKLNLVDLAGSERQTKTGAQGERLKEATKINLSLSALGNVISALVDGRSTHIPYRDSKLTRLLQDSLGGNAKTVMVANIGPASYNVEETLTTLRYSNRAKNIKNKPRV 346          
BLAST of Kinesin-domain-containing protein vs. Ensembl Xenopus
Match: insm2 (insulinoma-associated 2 [Source:Xenbase;Acc:XB-GENE-986609])

HSP 1 Score: 70.4774 bits (171), Expect = 5.165e-12
Identity = 73/296 (24.66%), Postives = 123/296 (41.55%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD----GL----FNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYND-------SGPFVKFICNIQSKEETFENCISA------------------VLYKSYLGLGNTVLICNIALS--NIKETKQILKLATSARQFKGNPII 920
            F FD V+D+NS   +++ E+ +  VD+V  G +  I A+G  G GK++T+ G + D    G+    F +I  +I    R Q Q+  +++ SY +I    I+DLL    S   +          YV +L  ++  S    EH    G+  R        +   + H IF + IE  +   +D      +  L+ ++L  ++        G  +K    I        N ISA                  +L  S  G   TV++ NI  +  N++ET   L+ +  A+  K  P +
Sbjct:   57 FTFDAVYDSNSKQVELYDETFRPLVDSVLLGFNGTIFAYGQTGTGKTYTMEGVRIDPEKRGVIPNSFEHIFTHIS---RSQNQQ-YLVRASYLEIYQEEIRDLLSKDQS-KRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFMITIECSQIG-LDGENHIRVGKLNLVDLAGSERQTKTGAQGERLKEATKINLSLSALGNVISALVDGRSTHIPYRDSKLTRLLQDSLGGNAKTVMVANIGPASYNVEETLTTLRYSNRAKNIKNKPRV 346          
BLAST of Kinesin-domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000012585.1 (centromere protein E [Source:NCBI gene;Acc:100126678])

HSP 1 Score: 69.707 bits (169), Expect = 1.092e-11
Identity = 71/315 (22.54%), Postives = 137/315 (43.49%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFESIK-STVDNVFRGISANIIAFGMPGNGKSHTLFGT-KSDGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKRQ--------QKYKGHTIFRVIIELIESNSIDNLKRS----TISNLDFIELNYND-------SGPFVKFICNI---------------QSKEETF----ENCISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPIIERFVQHDENYFINLNTELNELIK 989
            F FD VF+++    +V++ I    + +  +G +  I A+G   +GK++T+ GT  S G+    I  +   +++   ++ ++++SY +I N  +KDLL        +       ++ YV +L + + +       + K G+  R            + HTIFR+I+E  + N   N +       +S+L+ ++L  ++        G  +K  CNI                 +   F    ++ ++ +L  S  G   TV+IC I   +  ET   L+ A++A+  +  P +   +  DE        E+ EL K
Sbjct:   45 FSFDRVFNSHESTSQVYQEIAVPIIQSALQGYNGTIFAYGQTSSGKTYTMMGTPNSLGIIPQAIQEVFKIIQEIPNREFLLRVSYMEIYNETVKDLLCDDRKKKPLEIREDINRNVYVADLTEELVMVPDHVIQWIKKGEKNRHYGETKMNDHSSRSHTIFRMIVESRDRNDSANSENCDGAVMVSHLNLVDLAGSERASQTGAEGVRLKEGCNINRSLFILGQVIKKLSDGQAGGFINYRDSKLTRILQNSLGGNAKTVIICTITPVSFDETLSTLQFASTAKHMRNTPHVNEVL-DDEALLKRYRKEILELKK 358          
BLAST of Kinesin-domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000028811.1 (centromere protein E [Source:NCBI gene;Acc:100126678])

HSP 1 Score: 69.3218 bits (168), Expect = 1.753e-11
Identity = 71/315 (22.54%), Postives = 137/315 (43.49%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFESIK-STVDNVFRGISANIIAFGMPGNGKSHTLFGT-KSDGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKRQ--------QKYKGHTIFRVIIELIESNSIDNLKRS----TISNLDFIELNYND-------SGPFVKFICNI---------------QSKEETF----ENCISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPIIERFVQHDENYFINLNTELNELIK 989
            F FD VF+++    +V++ I    + +  +G +  I A+G   +GK++T+ GT  S G+    I  +   +++   ++ ++++SY +I N  +KDLL        +       ++ YV +L + + +       + K G+  R            + HTIFR+I+E  + N   N +       +S+L+ ++L  ++        G  +K  CNI                 +   F    ++ ++ +L  S  G   TV+IC I   +  ET   L+ A++A+  +  P +   +  DE        E+ EL K
Sbjct:   45 FSFDRVFNSHESTSQVYQEIAVPIIQSALQGYNGTIFAYGQTSSGKTYTMMGTPNSLGIIPQAIQEVFKIIQEIPNREFLLRVSYMEIYNETVKDLLCDDRKKKPLEIREDINRNVYVADLTEELVMVPDHVIQWIKKGEKNRHYGETKMNDHSSRSHTIFRMIVESRDRNDSANSENCDGAVMVSHLNLVDLAGSERASQTGAEGVRLKEGCNINRSLFILGQVIKKLSDGQAGGFINYRDSKLTRILQNSLGGNAKTVIICTITPVSFDETLSTLQFASTAKHMRNTPHVNEVL-DDEALLKRYRKEILELKK 358          
BLAST of Kinesin-domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000012564.1 (centromere protein E [Source:NCBI gene;Acc:100126678])

HSP 1 Score: 68.9366 bits (167), Expect = 1.792e-11
Identity = 66/285 (23.16%), Postives = 122/285 (42.81%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFESIK-STVDNVFRGISANIIAFGMPGNGKSHTLFGT-KSDGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKRQ--------QKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYNDSGPFVKFICNIQSKEETFENCISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPIIERFVQHDENYFINLNTELNELIK 989
            F FD VF+++    +V++ I    + +  +G +  I A+G   +GK++T+ GT  S G+    I  +   +++   ++ ++++SY +I N  +KDLL        +       ++ YV +L + + +       + K G+  R            + HTIFR++       SI     +  + + FI  NY DS                    ++ +L  S  G   TV+IC I   +  ET   L+ A++A+  +  P +   +  DE        E+ EL K
Sbjct:   45 FSFDRVFNSHESTSQVYQEIAVPIIQSALQGYNGTIFAYGQTSSGKTYTMMGTPNSLGIIPQAIQEVFKIIQEIPNREFLLRVSYMEIYNETVKDLLCDDRKKKPLEIREDINRNVYVADLTEELVMVPDHVIQWIKKGEKNRHYGETKMNDHSSRSHTIFRMV-------SI-----ADTTGVGFI--NYRDSK-------------------LTRILQNSLGGNAKTVIICTITPVSFDETLSTLQFASTAKHMRNTPHVNEVL-DDEALLKRYRKEILELKK 295          
BLAST of Kinesin-domain-containing protein vs. Ensembl Mouse
Match: Cenpe (centromere protein E [Source:MGI Symbol;Acc:MGI:1098230])

HSP 1 Score: 85.5001 bits (210), Expect = 1.013e-16
Identity = 85/383 (22.19%), Postives = 163/383 (42.56%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFESIK-STVDNVFRGISANIIAFGMPGNGKSHTLFGTKS-DGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRST-ISNLDFIELNYNDS------------------------GPFVKFICNIQ---------SKEETFENCISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPIIERFVQHDENYFINLNTELNELIKICKSEDXXXXXXXXXXSSVQKQEFLKSYHAIELHLVNLRENFCKNDIFSQIIDDIFNDFRNLLF 1181
            F+FD VFD+N   K V+E I    + +  +G +  I A+G   +GK+HT+ G++   G+    I+ I   ++K  +++ ++++SY +I N  I DLL ++  +  +       ++ YV +L + +  +      +  +G+  R        Q+  + HTIFR+I+E  E     N   S  +S+L+ ++L  ++                         G  +K + + Q         SK       ++ +L  S  G   T +IC I  +++ ET   L+ A++A+  K  P +   V +DE        E+ +L K                   Q +E      A E+    L +   + D+  ++ D+  N+ + +L 
Sbjct:   47 FQFDRVFDSNETTKNVYEEIAVPIISSAIQGYNGTIFAYGQTASGKTHTMMGSEDCLGVIPRAIHDIFQRIKKFPEREFLLRVSYMEIYNETITDLLCNAQKMKPLIIREDTNRTVYVSDLTEEVVYTAEMALKWLATGEKNRHYGITKMNQRSSRSHTIFRMILESREKAEPSNCDGSVKVSHLNLVDLAGSERAAQTGAEGVRLKEGCFINRNLFILGQVIKKLSDGQVGGFINYRDSK-------LTRILQNSLGGNAKTRIICTITPASLDETLTTLQFASTAKYMKNTPYVNE-VSNDEALLKRYRREIADLRK-------------------QLEEVNTKTRAQEMEKDQLAQLLDEKDLLQKVQDEKINNLKRMLV 402          
BLAST of Kinesin-domain-containing protein vs. Ensembl Mouse
Match: Kif3b (kinesin family member 3B [Source:MGI Symbol;Acc:MGI:107688])

HSP 1 Score: 76.6406 bits (187), Expect = 4.629e-14
Identity = 75/306 (24.51%), Postives = 128/306 (41.83%), Query Frame = 3
Query:  138 KAIFHQNENLFEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD----GL----FNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYND-------SGPFVKFICNIQSKEETFENCISA------------------VLYKSYLGLGNTVLICNIALS--NIKETKQILKLATSARQFKGNPII 920
            K   H+    F FD V+D N+   +++ E+ +  VD+V +G +  I A+G  G GK++T+ G + D    G+    F++I  +I    R Q Q+  +++ SY +I    I+DLL S +    +          YV +L  ++  S    EH    G+  R        +   + H IF + IE  E   +D      +  L+ ++L  ++        G  +K    I        N ISA                  +L  S  G   TV++ N+  +  N++ET   L+ A  A+  K  P +
Sbjct:   47 KGTSHEMPKTFTFDAVYDWNAKQFELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGVRGDPEKRGVIPNSFDHIFTHIS---RSQNQQ-YLVRASYLEIYQEEIRDLL-SKDQTKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSEVG-LDGENHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRLLQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRV 346          
BLAST of Kinesin-domain-containing protein vs. Ensembl Mouse
Match: Kif4 (kinesin family member 4 [Source:MGI Symbol;Acc:MGI:108389])

HSP 1 Score: 75.485 bits (184), Expect = 1.051e-13
Identity = 77/300 (25.67%), Postives = 134/300 (44.67%), Query Frame = 3
Query:  156 NENLFEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD--------GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVT---VAFDPICQKSKYVNLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFI----ELNYNDSGPFVKFICNIQSKEETFENCISA-------------------VLYKSYLGLGNTVLICNI--ALSNIKETKQILKLATSARQFKGNPII 920
            N+  F +D VFD +++ ++VF  ++   +  VF+G +A ++A+G  G+GK++++ G  +         G+   +I  +  ++ K++  +  +K+SY +I N  I DLL SS    T   +  DP  +  K V L +   L  S      + G++ R         Q  + H IF + IE  + N  ++  RS +  +D      +      G  ++   NI        N ISA                   +L  S  G  +T++I  +  A SN++ET   L+ A  AR+ K  PII
Sbjct:   45 NDKSFTYDFVFDPSTEQEEVFNTAVAPLIKGVFKGYNATVLAYGQTGSGKTYSMGGAYTAEQEHDSAIGVIPRVIQLLFKEINKKSDFEFTLKVSYLEIYNEEILDLLCSSREKATQINIREDPK-EGIKIVGLTEKTVLVASDTVSCLEQGNNSRTVASTAMNSQSSRSHAIFTISIEQRKKNDKNSSFRSKLHLVDLAGSERQKKTKAEGDRLREGININRGLLCLGNVISALGDDKKGNFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNLEETLNTLRYADRARKIKNKPII 343          
BLAST of Kinesin-domain-containing protein vs. Ensembl Mouse
Match: Kif18a (kinesin family member 18A [Source:MGI Symbol;Acc:MGI:2446977])

HSP 1 Score: 64.3142 bits (155), Expect = 3.136e-10
Identity = 86/327 (26.30%), Postives = 151/327 (46.18%), Query Frame = 3
Query:  153 QNENL-FEFDEVFDANSDNKKVFE-SIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSDGLFNYIIN---YICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYVNLKQYICL--SKSSFE--HYKKSGDDKRQQ--------KYKGHTIFRVIIE------------LIESNSIDNL---KRSTISNLD---FIE-LNYNDS----GPFVKFICNIQSKEE--TFENCISAVLYKSYLGLGN--TVLICNIALSNI--KETKQILKLATSARQFKGNPIIERFVQHDENYFINLNTELNELIKIC 995
            QN++L F FD VFD  S   +VFE + K  + +   G +  + A+G  G+GK+HT+ G+ ++    Y+     + C D  K+ +K+    +SY ++ N +I+DLL +S  L   A     QK   V   Q + L   KSS E      +G+  R Q          + H +F++ +              I   S+ +L   +R+++S      F+E  N N S    G  +  + N + + +   + N     L K  LG GN  T++I  ++ S++   +T   LK A  A++ K +          ++  +NLN+ +++ +KIC
Sbjct:   68 QNKDLKFVFDAVFDETSTQMEVFEHTTKPILHSFLNGYNCTVFAYGATGSGKTHTMLGSAAEPGVMYLTMLDLFKCIDEIKE-EKECSTAVSYLEVYNEQIRDLLTNSGPL---AVREDSQKGVVV---QGLTLHQPKSSEEILQLLDNGNKNRTQHPTDVNAVSSRSHAVFQIYLRQQDKTASINQNVRIAKMSLIDLAGSERASVSGAKGSRFVEGTNINKSLLALGNVINALANTKRRNQHIPYRNSKLTRLLKDSLG-GNCQTIMIAAVSPSSLFYDDTYNTLKYANRAKEIKSSL---------KSNVLNLNSHISQYVKIC 377          
BLAST of Kinesin-domain-containing protein vs. Ensembl Mouse
Match: Kif3c (kinesin family member 3C [Source:MGI Symbol;Acc:MGI:107979])

HSP 1 Score: 63.1586 bits (152), Expect = 7.740e-10
Identity = 51/208 (24.52%), Postives = 95/208 (45.67%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSDG--------LFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLG-SSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIEL----NYNDSGP 722
            F FD V+DA+S    ++ E+++  +D+V +G +  + A+G  G GK++T+ GT  +          F +I  +I    R Q Q+  +++ SY +I    I+DLL       + +  +P  +   Y+ +L  ++  +    EH    G+  R        +   + H IF + +E  E  S D      +  L+ ++L      N +GP
Sbjct:   58 FTFDAVYDASSKQADLYDETVRPLIDSVLQGFNGTVFAYGQTGTGKTYTMQGTWVEPELRGVIPNAFEHIFTHIS---RSQNQQ-YLVRASYLEIYQEEIRDLLSKEPGKRLELKENP--ETGVYIKDLSSFVTKNVKEIEHVMNLGNQARAVGSTHMNEVSSRSHAIFVITVECSERGS-DGQDHIRVGKLNLVDLAGSERQNKAGP 258          
BLAST of Kinesin-domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6RT24|CENPE_MOUSE (Centromere-associated protein E OS=Mus musculus OX=10090 GN=Cenpe PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 7.658e-16
Identity = 85/383 (22.19%), Postives = 163/383 (42.56%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFESIK-STVDNVFRGISANIIAFGMPGNGKSHTLFGTKS-DGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRST-ISNLDFIELNYNDS------------------------GPFVKFICNIQ---------SKEETFENCISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPIIERFVQHDENYFINLNTELNELIKICKSEDXXXXXXXXXXSSVQKQEFLKSYHAIELHLVNLRENFCKNDIFSQIIDDIFNDFRNLLF 1181
            F+FD VFD+N   K V+E I    + +  +G +  I A+G   +GK+HT+ G++   G+    I+ I   ++K  +++ ++++SY +I N  I DLL ++  +  +       ++ YV +L + +  +      +  +G+  R        Q+  + HTIFR+I+E  E     N   S  +S+L+ ++L  ++                         G  +K + + Q         SK       ++ +L  S  G   T +IC I  +++ ET   L+ A++A+  K  P +   V +DE        E+ +L K                   Q +E      A E+    L +   + D+  ++ D+  N+ + +L 
Sbjct:   47 FQFDRVFDSNETTKNVYEEIAVPIISSAIQGYNGTIFAYGQTASGKTHTMMGSEDCLGVIPRAIHDIFQRIKKFPEREFLLRVSYMEIYNETITDLLCNAQKMKPLIIREDTNRTVYVSDLTEEVVYTAEMALKWLATGEKNRHYGITKMNQRSSRSHTIFRMILESREKAEPSNCDGSVKVSHLNLVDLAGSERAAQTGAEGVRLKEGCFINRNLFILGQVIKKLSDGQVGGFINYRDSK-------LTRILQNSLGGNAKTRIICTITPASLDETLTTLQFASTAKYMKNTPYVNE-VSNDEALLKRYRREIADLRK-------------------QLEEVNTKTRAQEMEKDQLAQLLDEKDLLQKVQDEKINNLKRMLV 402          
BLAST of Kinesin-domain-containing protein vs. UniProt/SwissProt
Match: sp|Q02224|CENPE_HUMAN (Centromere-associated protein E OS=Homo sapiens OX=9606 GN=CENPE PE=1 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 7.962e-14
Identity = 70/291 (24.05%), Postives = 131/291 (45.02%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFESIKS-TVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRST-ISNLDFIELNYND-------SGPFVKFICNIQSKEETF---------------------ENCISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPII 920
            F FD VF  N   K V+E I +  +D+  +G +  I A+G   +GK++T+ G++   G+    I+ I   ++K   ++ ++++SY +I N  I DLL  +  +  +       ++ YV +L + +  +      +   G+  R        Q+  + HTIFR+I+E  E     N + S  +S+L+ ++L  ++       +G  +K  CNI      F                     ++ ++ +L  S  G   T +IC I   +  ET   L+ A++A+  K  P +
Sbjct:   47 FNFDRVFHGNETTKNVYEEIAAPIIDSAIQGYNGTIFAYGQTASGKTYTMMGSEDHLGVIPRAIHDIFQKIKKFPDREFLLRVSYMEIYNETITDLLCGTQKMKPLIIREDVNRNVYVADLTEEVVYTSEMALKWITKGEKSRHYGETKMNQRSSRSHTIFRMILESREKGEPSNCEGSVKVSHLNLVDLAGSERAAQTGAAGVRLKEGCNINRS--LFILGQVIKKLSDGQVGGFINYRDSKLTRILQNSLGGNAKTRIICTITPVSFDETLTALQFASTAKYMKNTPYV 335          
BLAST of Kinesin-domain-containing protein vs. UniProt/SwissProt
Match: sp|Q61771|KIF3B_MOUSE (Kinesin-like protein KIF3B OS=Mus musculus OX=10090 GN=Kif3b PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 3.238e-13
Identity = 75/306 (24.51%), Postives = 128/306 (41.83%), Query Frame = 3
Query:  138 KAIFHQNENLFEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD----GL----FNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYND-------SGPFVKFICNIQSKEETFENCISA------------------VLYKSYLGLGNTVLICNIALS--NIKETKQILKLATSARQFKGNPII 920
            K   H+    F FD V+D N+   +++ E+ +  VD+V +G +  I A+G  G GK++T+ G + D    G+    F++I  +I    R Q Q+  +++ SY +I    I+DLL S +    +          YV +L  ++  S    EH    G+  R        +   + H IF + IE  E   +D      +  L+ ++L  ++        G  +K    I        N ISA                  +L  S  G   TV++ N+  +  N++ET   L+ A  A+  K  P +
Sbjct:   47 KGTSHEMPKTFTFDAVYDWNAKQFELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGVRGDPEKRGVIPNSFDHIFTHIS---RSQNQQ-YLVRASYLEIYQEEIRDLL-SKDQTKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSEVG-LDGENHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRLLQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRV 346          
BLAST of Kinesin-domain-containing protein vs. UniProt/SwissProt
Match: sp|O15066|KIF3B_HUMAN (Kinesin-like protein KIF3B OS=Homo sapiens OX=9606 GN=KIF3B PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 3.954e-13
Identity = 75/306 (24.51%), Postives = 128/306 (41.83%), Query Frame = 3
Query:  138 KAIFHQNENLFEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD----GL----FNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYND-------SGPFVKFICNIQSKEETFENCISA------------------VLYKSYLGLGNTVLICNIALS--NIKETKQILKLATSARQFKGNPII 920
            K   H+    F FD V+D N+   +++ E+ +  VD+V +G +  I A+G  G GK++T+ G + D    G+    F++I  +I    R Q Q+  +++ SY +I    I+DLL S +    +          YV +L  ++  S    EH    G+  R        +   + H IF + IE  E   +D      +  L+ ++L  ++        G  +K    I        N ISA                  +L  S  G   TV++ N+  +  N++ET   L+ A  A+  K  P +
Sbjct:   47 KGTAHEMPKTFTFDAVYDWNAKQFELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGIRGDPEKRGVIPNSFDHIFTHIS---RSQNQQ-YLVRASYLEIYQEEIRDLL-SKDQTKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSEVG-LDGENHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRLLQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRV 346          
BLAST of Kinesin-domain-containing protein vs. UniProt/SwissProt
Match: sp|P33174|KIF4_MOUSE (Chromosome-associated kinesin KIF4 OS=Mus musculus OX=10090 GN=Kif4 PE=1 SV=3)

HSP 1 Score: 75.485 bits (184), Expect = 7.354e-13
Identity = 77/300 (25.67%), Postives = 134/300 (44.67%), Query Frame = 3
Query:  156 NENLFEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD--------GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVT---VAFDPICQKSKYVNLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFI----ELNYNDSGPFVKFICNIQSKEETFENCISA-------------------VLYKSYLGLGNTVLICNI--ALSNIKETKQILKLATSARQFKGNPII 920
            N+  F +D VFD +++ ++VF  ++   +  VF+G +A ++A+G  G+GK++++ G  +         G+   +I  +  ++ K++  +  +K+SY +I N  I DLL SS    T   +  DP  +  K V L +   L  S      + G++ R         Q  + H IF + IE  + N  ++  RS +  +D      +      G  ++   NI        N ISA                   +L  S  G  +T++I  +  A SN++ET   L+ A  AR+ K  PII
Sbjct:   45 NDKSFTYDFVFDPSTEQEEVFNTAVAPLIKGVFKGYNATVLAYGQTGSGKTYSMGGAYTAEQEHDSAIGVIPRVIQLLFKEINKKSDFEFTLKVSYLEIYNEEILDLLCSSREKATQINIREDPK-EGIKIVGLTEKTVLVASDTVSCLEQGNNSRTVASTAMNSQSSRSHAIFTISIEQRKKNDKNSSFRSKLHLVDLAGSERQKKTKAEGDRLREGININRGLLCLGNVISALGDDKKGNFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNLEETLNTLRYADRARKIKNKPII 343          
BLAST of Kinesin-domain-containing protein vs. TrEMBL
Match: A0A1V9X5M8 (Kinesin motor domain-containing protein OS=Tropilaelaps mercedesae OX=418985 GN=BIW11_12722 PE=3 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 7.426e-21
Identity = 74/309 (23.95%), Postives = 141/309 (45.63%), Query Frame = 3
Query:  162 NLFEFDEVFDANSDNKKVFESI-KSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYVNLKQYICLSKSSFEHYKKSGDDKRQ--------QKYKGHTIFRVIIELIESNSIDNLKRS-TISNLDFIELNYND-------SGPFVKFICNIQ-------------SKEETF----ENCISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPIIERFVQHDENYFINLNTELNEL 983
            N+F FD +F     N  ++E +    +D+V  G    + A+G   +GK+HT+ G  +D G+    I YI + + K   ++ +I+ISY +I N +I+DLL   +S + +    +        L + +C       H+  +GD  RQ        +  + H+IFRV +E    N+  N +   T+S L+ ++L  ++       +G  ++  C+I              SK E      ++ ++ +L  S  G   T ++C IA  + + +   L+  + A++ +  P+I + +  D +     N E+  L
Sbjct:   61 NVFAFDHIFSQEKTNADIYEEVVGPIIDSVLDGYHGTVFAYGQTSSGKTHTMMGNDADPGIIKRAIAYIFEQIHKAADREFMIRISYLEIYNEQIRDLLNPHSSALQIKGPDMA----VSGLTEQVCTDADELLHWMLAGDKNRQVGCTNMNERSSRSHSIFRVTLESSHRNADTNKREGVTVSQLNLVDLAGSERATQTGATGTRLREGCHINTSLTALGIVIRKLSKGEKHINFRDSKLTRILQNSLGGNSRTAVVCTIAPFDYETSLSTLRFGSEAKRIRNRPVINQVLSEDASLLQKRNKEIESL 365          
BLAST of Kinesin-domain-containing protein vs. TrEMBL
Match: A0A1B6EB68 (Kinesin-like protein (Fragment) OS=Clastoptera arizonana OX=38151 GN=g.18946 PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 8.220e-16
Identity = 85/332 (25.60%), Postives = 154/332 (46.39%), Query Frame = 3
Query:   78 FKILSKIKPESLTSELEIKDKAIFH-------QNENLFEFDEVFDANSDNKKVFES-IKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLL-GSSN--------SLVTVAFDPICQKSKYVNLKQYICLSKSSFEHYKKSGDDKRQQKYKGHTIFRVIIEL-IESNSIDNLKRSTI-------SNLDFIELNYND------SGPFVKFICNIQSKEETF-------------------ENCISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPII 920
             K++ K+KPE+      +++  I         Q  +   FD +FD  S N  +F + I+  VD   +G +  I A+G   +GK+HT+ GTK + G+    + Y+   L K+T ++ ++++SY ++ N +I DLL G+ N        S+ T A + IC  ++ V L+  +   K+       + D       + HTIFR+I+E  +++ SI   + + +       S L+ ++L  ++      S   +K  C+I S   T                    ++ ++ +L  S  G  +TV+IC I  + I +T   L  A  A++ K  PI+
Sbjct:    5 IKVVVKLKPENKICHWSVQNNRICQIDPESQKQKSDFLTFDNIFDEKSTNLDIFSTVIRPIVDATIQGYNGTIFAYGQTSSGKTHTMSGTKEEPGIIPIAVKYLLSSLEKETNREFLLRVSYLELYNEKINDLLSGNENLTMKEENGSIKTGAEEKICNSTEKV-LEAMLNGEKARKIAETVAND----HSSRSHTIFRIILESSVKNKSISEKENNNVGGEFVKNSQLNLVDLAGSERASCTTSKDRLKEGCHINSSLSTLGLVIKQLSEGNERQYISFRDSKLTRLLKTSLGGNSHTVIICTITPAVIDQTMNTLNFAQRAKKVKTKPIL 331          
BLAST of Kinesin-domain-containing protein vs. TrEMBL
Match: A0A0N4UJM7 (Kinesin-like protein OS=Dracunculus medinensis OX=318479 GN=DME_LOCUS10220 PE=3 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 9.857e-16
Identity = 75/290 (25.86%), Postives = 148/290 (51.03%), Query Frame = 3
Query:  165 LFEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKS-DGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYVNLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIE----LIESNSIDNLKRSTISNLDFIELNYNDSG---------------------PFVKFICNIQSKEE--TFENCISAVLYKSYLGLGN--TVLICNIALSNIKETKQILKLATSARQFKGNPI 917
            ++EFD VFD+ S+ K ++ E ++S +D+   G +  I+A+G   +GK+HT+FG+ S DG+    I  I D +  ++    +++IS+ ++ N +++DLL  ++  ++V    I +++    +K+ +  S +S ++  +   D+R        Q+  + H I R+IIE    L+  +S+     S IS+L+ ++L  +++                        ++ I  +  K +  +F +     L KS LG GN  T++IC+++     ET Q L+ A+ A+  K  P+
Sbjct:   45 IYEFDRVFDSLSNTKDIYREYVQSIIDSAINGYNGTILAYGQTASGKTHTIFGSCSEDGIIQMAIRSIFDAIASRSTSRYLLRISFIELYNEKVRDLLVDNSKDLSVK--EIKEQTVIQGIKEEVITSDTSADYLIRMAYDRRVVGETTSNQRSSRSHVIIRLIIESHDALLGESSV-----SYISHLNIVDLAGSENSNCVSCQKERIVEGASINRSLLALLRVIQQLSDKCDHISFRDSKLTRLLKSSLG-GNARTIIICSVSPLVNTETLQTLRFASRAKIIKNRPV 326          
BLAST of Kinesin-domain-containing protein vs. TrEMBL
Match: A0A1E1XDK6 (Putative kinesin-like protein (Fragment) OS=Amblyomma aureolatum OX=187763 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.546e-15
Identity = 75/291 (25.77%), Postives = 135/291 (46.39%), Query Frame = 3
Query:  177 DEVFDANSDNKKVFES-IKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYVNLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIE-LIESNSIDNLKRSTISNLDFIEL--------------------NYNDSGPFVKFICNIQSKEE----TFENC-ISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPIIERFVQHD 941
            D VFD  S N+ V++      V++V +G +  I AFG   +GK+HT+ GT S  GL    IN I + +    +++ +I++SY +I N  I DLL  +N       D    +   V+L +    SK        +G+  R        Q+  + HTIFR++IE  +   S+D  +  T+  L+ ++L                      N S  F+  + +  S+ E     F +  ++ +L  S  G  +T ++C +   + ++T + L+ A+SA++ +  P++   V +D
Sbjct:    1 DHVFDWASTNRDVYDKYCHPIVESVMQGFNGTIFAFGQTSSGKTHTMMGTSSQPGLIPLAINAIFNIIENVPEREYLIRVSYIEIYNENIMDLLDPTNGKNLQIRDNADGQPIIVDLTELTVGSKDEIRAAMNTGERHRHVASTDLNQRSSRSHTIFRMVIESSLRDESVD--RAVTVGQLNLVDLAGSERSEQCGEAGERFRESTRINLSLTFLTQVISRLSRGERGHINFRDSKLTRILRNSLGGNAHTAIVCTVNPFSAEQTLRTLQFASSAKKIQNTPVVNESVSND 289          
BLAST of Kinesin-domain-containing protein vs. TrEMBL
Match: A0A016VXL4 (Kinesin motor domain-containing protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0004.g2187 PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 5.577e-15
Identity = 77/320 (24.06%), Postives = 143/320 (44.69%), Query Frame = 3
Query:   84 ILSKIKPESLTSELEI---KDKAIFHQN-ENLFEFDEVFDANSDNKKVFESIKST-VDNVFRGISANIIAFGMPGNGKSHTLFGTK-SDGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFD-PICQKSKYV----NLKQYICLSKSSFEHYKKSGDDKRQ--------QKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYNDSGPFVKFI-----CNIQSKEETFENCISA-----------------VLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPII 920
            ++++I+P     ++E     ++ I  ++   ++ FD+VFD    N++++E++ +  VD    G +  + A+G  G GK+HTL G++  DG+     + + + + K   +  +++ISY +I N RI+DLL        +A D PI +    V     LK+ +   K+  E   K   ++RQ        +  + HTI R+ IE  +     N  R +I NL  +  + N +    + +      NI          +S+                 +L  S  G   T +IC +A  ++ ET   LK A  A++    P++
Sbjct:   90 VVARIRPGWDEGQVEWIKNGERNIMRKDGSEIYTFDDVFDQLCTNEQIYENVMTGIVDAALAGFNTAVCAYGQSGAGKTHTLTGSEHEDGIVQNTFDALLETISKSNDRKYMLRISYIEIYNERIRDLLSD------IASDLPIYENKDGVAQIEGLKEVVVTEKAEVEELLKQAQERRQLGETRLNERSSRSHTIIRLTIESHDVKYGGNATRCSIMNLVDLAGSENAAAAGTQGLRQKEGANINRSLLALSKVVSSLADNLKFIPYRDSKLTRILKPSLGGNSKTAIICCVAPFSVAETSSTLKFAKLAKKIVTRPVV 403          
BLAST of Kinesin-domain-containing protein vs. Ensembl Cavefish
Match: kif3b (kinesin family member 3B [Source:NCBI gene;Acc:103035116])

HSP 1 Score: 74.3294 bits (181), Expect = 1.790e-13
Identity = 77/305 (25.25%), Postives = 126/305 (41.31%), Query Frame = 3
Query:  141 AIFHQNENLFEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD----GL----FNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYND-------SGPFVKFICNIQSKEETFENCISA------------------VLYKSYLGLGNTVLICNIALS--NIKETKQILKLATSARQFKGNPII 920
            A  H++  +F FD V+D NS    ++ E+ +  VD+V  G +  I A+G  G GK++T+ G ++D    G+    F +I  +I    R Q Q+  +++ SY +I    I+DLL    S   +          YV +L  ++  S    EH    G+  R        +   + H IF + IE  E    D      +  L+ ++L  ++        G  +K    I        N ISA                  +L  S  G   TV++ NI  +  N++ET   L+ +  A+  K  P I
Sbjct:   49 ASSHEHPKVFTFDSVYDWNSKQIDLYDETFRPLVDSVLLGFNGTIFAYGQTGTGKTYTMEGVRNDPERRGVIPNSFEHIFTHIS---RSQNQQ-YLVRASYLEIYQEEIRDLLSKDQSR-RLELKERPDTGVYVKDLSSFVTKSVREIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSELGP-DGENHIRVGKLNLVDLAGSERQTKTGAQGERLKEATKINLSLSALGNVISALVDGRSTHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNVEETLTTLRYSNRAKNIKNKPRI 347          
BLAST of Kinesin-domain-containing protein vs. Ensembl Cavefish
Match: kif4 (kinesin family member 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1545])

HSP 1 Score: 66.2402 bits (160), Expect = 6.281e-11
Identity = 70/299 (23.41%), Postives = 131/299 (43.81%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFE-SIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD--------GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSS--NSLVTVAFDPICQKSKYVNLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYND-------SGPFVKFICNIQSKEETFENCISA--------------------VLYKSYLGLGNTVLICNI--ALSNIKETKQILKLATSARQFKGNPII 920
            F +D VFD  ++ ++VF  ++   +  +F+G +A ++A+G  G+GK+ ++ GT +         G+   ++  I  +  K+   + ++ +SY +I N  I DLL +S    ++++  DP  +  K V L +   L+        + G+  R            + H IF + +E    +  D    + +S L  ++L  ++        G  +K   +I     +  N ISA                    +L  S  G  +T++I  I  A SNI+ET   L+ A  AR+ K  P++
Sbjct:   50 FTYDYVFDPTTEQEEVFNMAVSPLLSGLFKGYNATVLAYGQTGSGKTFSMGGTYTSAQENEPTVGVIPRVVRKIFQEKSKRMDSEFLLNVSYLEIYNEEILDLLCTSKDKPVLSIREDPK-EGIKIVGLTEKAVLTAQEMVGCLEVGNSARTVGSTAMNAASSRSHAIFTISLEQRRGSEND----AVVSKLHLVDLAGSERQKKTKAEGDRLKEGISINRGLLSLGNVISALGDESKKGSFVPYRDSKLTRLLQDSLGGNSHTLMIACISPADSNIEETINTLRYADRARKIKNKPVL 343          
BLAST of Kinesin-domain-containing protein vs. Ensembl Cavefish
Match: cenpe (centromere protein E [Source:ZFIN;Acc:ZDB-GENE-060929-860])

HSP 1 Score: 65.4698 bits (158), Expect = 1.384e-10
Identity = 70/290 (24.14%), Postives = 128/290 (44.14%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFESI-KSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKS-DGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESN---SIDNLKRSTI-SNLDFIELNYND-------SGPFVKFICNIQ---------------SKEETFENC----ISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNP 914
            F FD VF A     ++++ I K  V +   G +  I  +G   +GK+ T+ G+    G+    +  +   ++   +K+ ++++SY +I N  + DLL  S     +       K+ YV +L + +  S      + + G+  R        Q+  + HTIFR+I+E  E +   S +N   + I S+L+ ++L  ++        G   K  CNI                  ++ F N     ++ +L  S  G   TV+IC I    + ET   L+ A++A++ K +P
Sbjct:   56 FAFDRVFSAEETTNQLYQDIAKPLVVSTVEGYNGTIFTYGQTSSGKTFTMMGSDHIPGVIPLAMADVFQTIKNCPKKEFLLRVSYMEIYNETVTDLLCDSWKRKPLEIREGNYKNVYVADLTEELVTSPEQALAWIRKGEKNRHYGKTKMNQRSSRSHTIFRMILESRERSDPASGENADGAIIVSHLNLVDLAGSERASQTGAEGARFKEGCNINRSLFILGQVIKKLSDESQKGFINYRDSKLTRILQNSLGGNAKTVIICTITPVTVDETLSTLQFASAAKRMKNDP 345          
BLAST of Kinesin-domain-containing protein vs. Ensembl Cavefish
Match: kif4 (kinesin family member 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1545])

HSP 1 Score: 62.003 bits (149), Expect = 1.392e-9
Identity = 69/299 (23.08%), Postives = 129/299 (43.14%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFE-SIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD--------GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSS--NSLVTVAFDPICQKSKYVNLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYND-------SGPFVKFICNIQSKEETFENCISA--------------------VLYKSYLGLGNTVLICNI--ALSNIKETKQILKLATSARQFKGNPII 920
            F +D VFD  ++ ++VF  ++   +  +F+G +A ++A+G  G+GK+ ++ GT +         G+   ++  I  +  K+   + ++ +SY +I N  I DLL +S    ++++  DP  +  K V L +   L+        + G+  R            + H IF + +E    +         +S L  ++L  ++        G  +K   +I     +  N ISA                    +L  S  G  +T++I  I  A SNI+ET   L+ A  AR+ K  P++
Sbjct:   50 FTYDYVFDPTTEQEEVFNMAVSPLLSGLFKGYNATVLAYGQTGSGKTFSMGGTYTSAQENEPTVGVIPRVVRKIFQEKSKRMDSEFLLNVSYLEIYNEEILDLLCTSKDKPVLSIREDPK-EGIKIVGLTEKAVLTAQEMVGCLEVGNSARTVGSTAMNAASSRSHAIFTISLEQRRGSEKHC---DILSKLHLVDLAGSERQKKTKAEGDRLKEGISINRGLLSLGNVISALGDESKKGSFVPYRDSKLTRLLQDSLGGNSHTLMIACISPADSNIEETINTLRYADRARKIKNKPVL 344          
BLAST of Kinesin-domain-containing protein vs. Ensembl Cavefish
Match: KIF5A (kinesin family member 5A [Source:NCBI gene;Acc:103025097])

HSP 1 Score: 61.6178 bits (148), Expect = 1.927e-9
Identity = 48/151 (31.79%), Postives = 76/151 (50.33%), Query Frame = 3
Query:   78 FKILSKIKPESLTSELEIKDK--AIFHQNENL------FEFDEVFDANSDNKKVFES-IKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSDGLFNYIINYICDDL-----RKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFD 488
             K+L + +P +  SE+   DK   +F +N+ +      F FD VF  N+  ++V+ S  K  V +V  G +  I A+G   +GK+HT+ G   D     II  I DD+           +  IK+SYF+I   +I+DLL  S + ++V  D
Sbjct:   10 IKVLCRFRPLN-QSEIVRGDKFLPVFQENDTVILGGKSFAFDRVFPTNTTQEQVYNSCAKQIVTDVLGGYNGTIFAYGQTSSGKTHTMEGKLHDPNNMGIIPRIADDIFNHIFAMDENLEFHIKVSYFEIYMDKIRDLLDVSKTNLSVHED 159          
BLAST of Kinesin-domain-containing protein vs. Ensembl Sea Lamprey
Match: kif3ca (kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GENE-111214-2])

HSP 1 Score: 64.6994 bits (156), Expect = 3.328e-11
Identity = 68/295 (23.05%), Postives = 115/295 (38.98%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFE-SIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD----GL----FNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYVNLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYND-------SGPFVKFICNIQSKEETFENCISA------------------VLYKSYLGLGNTVLICNIALS--NIKETKQILKLATSARQFKGNPII 920
            F FD V+  ++    ++E S +  VD+V  G +  I A+G  G GK++T+ G +SD    G+    F +I  +I    R Q Q    ++ SY +I    I+DLL    S      +         +L  ++  S    EH    G+  R        +   + H IF + +E  E  + D      +  L+ ++L  ++        G  +K    I        N ISA                  +L  S  G   TV++ N+  +  N  E+   L+ A  A+  +  P +
Sbjct:   66 FTFDAVYGGDAKQLDIYEESFRPLVDSVLCGFNGTIFAYGQTGTGKTYTMEGVRSDPERRGVIPNSFEHIFTHIS---RSQNQPVPEVRASYLEIYQEEIRDLLSRDQSRRLELRERPDTGIHVKDLSSFVTKSAREIEHVMGIGNQNRSVGATNMNEHSSRSHAIFVITVECSELGA-DGESHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHVPYRDSKLTRLLQDSLGGNARTVMVANVGPASYNYDESLTTLRYANRAKNIRNRPRV 356          
BLAST of Kinesin-domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010732.1 (pep scaffold:Pmarinus_7.0:GL483624:886:9557:1 gene:ENSPMAG00000009720.1 transcript:ENSPMAT00000010732.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 2.818e-9
Identity = 65/289 (22.49%), Postives = 128/289 (44.29%), Query Frame = 3
Query:  156 NENLFEFDEVFDANSDNKKVFESI-KSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKRQ--------QKYKGHTIFRVIIELIESNSIDNLKRS-TISNLDFIELNYND-------SGPFVKFICNI--------QSKEETFENC------------ISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFK 905
            N   F FD VF  +     VF+ I +  +    +G +  I A+G   +GK+ T+ G++S  G+    +  + D ++    ++ ++++SY +I N  I DLL       ++       ++ YV +L++ +  S          G + R            + H+IFR+IIE  E +  +++  +  +S+L+ ++L  ++        G  +K  CNI        Q  ++  EN             ++ +L  S  G   TV++C +  + ++ET   L  A++A+  K
Sbjct:   48 NNKCFIFDRVFGVDEQTCDVFDEIARPIIKAAVKGYNGTIFAYGQTSSGKTFTMLGSESHPGIIPLAMKEVFDVIKNLPSREFLLRVSYMEIYNETICDLLSKDKKKKSLDIHE--DRTVYVADLREEVITSIKDILEIMSIGPENRHYGETKMNDHSSRSHSIFRMIIESRERSQRESMDGAIAVSHLNLVDLAGSERTRQTGAEGLRLKEGCNINRSLFILGQVIKKLSENPSGGVYLNYRDSKLTRILQNSLGGNAKTVILCTVTPAALEETLSTLMFASTAKNMK 334          
BLAST of Kinesin-domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010492.1 (pep scaffold:Pmarinus_7.0:GL478879:14589:34633:-1 gene:ENSPMAG00000009502.1 transcript:ENSPMAT00000010492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 4.344e-9
Identity = 39/141 (27.66%), Postives = 67/141 (47.52%), Query Frame = 3
Query:   66 NMSVFKILSKIKPESLTSELEIKDKA---IFHQNEN---LFEFDEVFDANSDNKKVFESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTK-SDGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNS 467
            N+ VF       P+     LE    A   +  Q+E     F FD+VF  N+  ++VF      + +   G +  I+A+G  G+GK+HT+ GT  + G+    +  + +  +++      +KIS  +I N  ++DLLG   S
Sbjct:   62 NIRVFCRGRPGAPDGGVPGLEFSPSAGEVLVMQSEGKTTSFAFDQVFPPNATQEQVFADTLPLITSCVDGYNVCILAYGQTGSGKTHTMMGTSNAPGVNVRSVKELLNICKERHNVKYTLKISMLEIYNETVRDLLGKPGS 202          
BLAST of Kinesin-domain-containing protein vs. Ensembl Sea Lamprey
Match: kif6 (kinesin family member 6 [Source:ZFIN;Acc:ZDB-GENE-061027-130])

HSP 1 Score: 57.7658 bits (138), Expect = 4.500e-9
Identity = 32/100 (32.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFESIKSTV-DNVFRGISANIIAFGMPGNGKSHTLFGTKS----DGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLL 452
            F+F ++FD  +  +++FE+I   V D+V  G +  I A+G  G+GK+ T+ G        G+   I+ Y+ +  +K T +     ISY +I N    DLL
Sbjct:   56 FQFKKIFDQQAKQEEIFETIARPVADSVLSGYNGTIFAYGQTGSGKTFTITGGAERFADRGIIPRILGYLFEQFQKDTNRVYTAHISYLEIYNENGYDLL 155          
BLAST of Kinesin-domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010733.1 (pep scaffold:Pmarinus_7.0:GL483624:1870:9566:1 gene:ENSPMAG00000009720.1 transcript:ENSPMAT00000010733.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 4.839e-9
Identity = 62/282 (21.99%), Postives = 125/282 (44.33%), Query Frame = 3
Query:  177 DEVFDANSDNKKVFESI-KSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKRQ--------QKYKGHTIFRVIIELIESNSIDNLKRS-TISNLDFIELNYND-------SGPFVKFICNI--------QSKEETFENC------------ISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFK 905
            D VF  +     VF+ I +  +    +G +  I A+G   +GK+ T+ G++S  G+    +  + D ++    ++ ++++SY +I N  I DLL       ++       ++ YV +L++ +  S          G + R            + H+IFR+IIE  E +  +++  +  +S+L+ ++L  ++        G  +K  CNI        Q  ++  EN             ++ +L  S  G   TV++C +  + ++ET   L  A++A+  K
Sbjct:   17 DRVFGVDEQTCDVFDEIARPIIKAAVKGYNGTIFAYGQTSSGKTFTMLGSESHPGIIPLAMKEVFDVIKNLPSREFLLRVSYMEIYNETICDLLSKDKKKKSLDIHEDVNRTVYVADLREEVITSIKDILEIMSIGPENRHYGETKMNDHSSRSHSIFRMIIESRERSQRESMDGAIAVSHLNLVDLAGSERTRQTGAEGLRLKEGCNINRSLFILGQVIKKLSENPSGGVYLNYRDSKLTRILQNSLGGNAKTVILCTVTPAALEETLSTLMFASTAKNMK 298          
BLAST of Kinesin-domain-containing protein vs. Ensembl Yeast
Match: KIP2 (Kinesin-related motor protein involved in mitotic spindle positioning; stabilizes microtubules by targeting Bik1p to the plus end; functions as a microtubule polymerase and catastrophe inhibitor in vitro; Kip2p levels are controlled during the cell cycle [Source:SGD;Acc:S000006076])

HSP 1 Score: 67.3958 bits (163), Expect = 3.214e-12
Identity = 41/113 (36.28%), Postives = 66/113 (58.41%), Query Frame = 3
Query:  135 DKAIFHQNENLFEFDEVFDANSDNKKVFE-SIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-GLFNYIINYICDDLRKQTQ---KDVVIKISYFDIINSRIKDLLGS 458
            DK I H+    F+FD VF ++  N +V+E + K  +D +  G +A I A+GM G+GK+ T+ G + + GL    ++Y+  ++ +Q+    K   + ISY +I N RI DLL S
Sbjct:  152 DKTIVHEEIGEFKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQELGLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLES 264          
BLAST of Kinesin-domain-containing protein vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 62.003 bits (149), Expect = 1.777e-10
Identity = 40/111 (36.04%), Postives = 60/111 (54.05%), Query Frame = 3
Query:  150 HQNENLFEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKS---------DGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLL 452
            H  E  F FD++FD  S   +V+ E+    +D+V  G ++ + A+G  G GK++T+ GT S         + LFN I      DL+   +KD  I +SY +I N RI+DLL
Sbjct:  147 HGGEIKFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTPSQPGIIFLAMEELFNKIT-----DLKD--EKDFEISLSYLEIYNERIRDLL 250          
BLAST of Kinesin-domain-containing protein vs. Ensembl Yeast
Match: KAR3 (Minus-end-directed microtubule motor; functions in mitosis and meiosis, localizes to the spindle pole body and localization is dependent on functional Cik1p, required for nuclear fusion during mating; potential Cdc28p substrate [Source:SGD;Acc:S000006345])

HSP 1 Score: 51.2174 bits (121), Expect = 3.927e-7
Identity = 35/114 (30.70%), Postives = 57/114 (50.00%), Query Frame = 3
Query:  129 IKDKAIFHQNENLFEFDEVFDANSDNKKVFESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSDGLFNYIINYICDDLRKQTQK--DVVIKISYFDIINSRIKDLLGSSN 464
            I++ A  H+    F+FD++FD    N  VF+ +   V +   G +  I A+G  G+GK+ T+     DG+    I++I + + K   K  D  +   + +I N  I DLL S N
Sbjct:  427 IQNTAQVHE----FKFDKIFDQQDTNVDVFKEVGQLVQSSLDGYNVCIFAYGQTGSGKTFTMLNP-GDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLLRSDN 535          
BLAST of Kinesin-domain-containing protein vs. Ensembl Yeast
Match: KIP1 (Kinesin-related motor protein; required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions [Source:SGD;Acc:S000000159])

HSP 1 Score: 50.447 bits (119), Expect = 7.054e-7
Identity = 74/322 (22.98%), Postives = 131/322 (40.68%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFESI-KSTVDNVFRGISANIIAFGMPGNGKSHTLFG--------TKSDGLF----NYIINYICDDLRKQTQ---KDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYVN-----------LKQYICLSKSSFEHYKKSGDDKRQQKY--------KGHTIFRVIIELIESNSIDNLKRST---ISNLDFIEL----NYNDSGP--------------------FVKFICNIQSKEETFENCISAVLYKSYLGLGNTVLICNIALSNI--KETKQILKLATSARQFKGNPIIERFVQHD 941
            ++FD+VF A SD + VF +  K+ +  +  G +  I A+G  G GK++T+ G          +D L       II  +  DL K+     K+  +KIS+ ++ N  +KDLL  S        DP  Q   + N           +++    S     +    G  KR+           + HT+F +   ++E +S D+ +      I  L+ ++L    N N SG                      +  + +  +     E+ ++ +L  S  G+  T +I  I+ + I  +ET   L+ AT A+  K  P + + +  D
Sbjct:  102 YQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLKDLLSDSEDDDPAVNDPKRQIRIFDNNNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQSLSKD 423          
BLAST of Kinesin-domain-containing protein vs. Ensembl Yeast
Match: SMY1 (Kinesin-like myosin passenger-protein; interacts with Myo2p and enhances its interaction with Sec4p during transport of secretory vesicles; controls actin cable structure and dynamics [Source:SGD;Acc:S000001562])

HSP 1 Score: 49.2914 bits (116), Expect = 1.446e-6
Identity = 45/173 (26.01%), Postives = 86/173 (49.71%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFE-SIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTK-SDGLFNYIINYICDDLRK--QTQKDV-VIKISYFDIINSRIKDL-----------LGSSNSLVTVAFDPICQK--SKYVNLKQYICLSKSSFEHYKKSGDDKRQQKYKGHTIFRVIIE 632
            F+FD+VFDAN+  + V +  +   +++V  G +  +I +G   +GKS++L G+K S+G+   I   + D L K  +T+ D   + +  F+I   +  DL           L  S+S + +    IC      Y +L+ YI   + +  +    GD  + ++ + H +F++ +E
Sbjct:   75 FQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGPSFSGKSYSLIGSKESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYMEKTYDLLVPLPERKPLKLHRSSSKMDLEIKDICPAHVGSYEDLRSYIQAVQ-NVGNRMACGD--KTERSRSHLVFQLHVE 244          
BLAST of Kinesin-domain-containing protein vs. Ensembl Nematostella
Match: EDO40836 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5X0])

HSP 1 Score: 74.3294 bits (181), Expect = 5.738e-14
Identity = 69/297 (23.23%), Postives = 124/297 (41.75%), Query Frame = 3
Query:  165 LFEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSDGLFNYII----NYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSI----------------------------DNLKRSTISNLDFIELNYNDSGPFVKFICNIQSKEETFENC-ISAVLYKSYLGLGNTVLICNIALS--NIKETKQILKLATSARQFKGNPII 920
            +F +D V+D NS    ++ E+ +  V++V  G +  I A+G  G GK+ T+ G +SD     +I    ++I   + + T +  +++ SY +I    ++DLLG       +          YV +L+ ++C S    EH    G+  R        +   + H IF + IE  + N++                            D LK +T  NL    L     G  +  + + +S    + +  ++ +L  S  G   TV++ NI  +  N +E+   L+ A  A+  K  P I
Sbjct:   37 MFTYDAVYDWNSKQIDLYDETFRQLVESVLEGYNGTIFAYGQTGTGKTFTMEGVRSDPDLRGVIPNSFDHIFTHIARTTNQQYLVRASYLEIYQEEVRDLLGKDQK-KRLELKERPDTGVYVKDLQSFVCKSVKEIEHVMNVGNQNRSVGATKMNEHSSRSHAIFIITIECSQLNAVGECHIRVGKLNMVDLAGSERQTKTEATGDRLKEATKINLSLSAL-----GNVISALVDGKSTHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNYEESITTLRYANRAKNIKNKPHI 327          
BLAST of Kinesin-domain-containing protein vs. Ensembl Nematostella
Match: EDO31386 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SY31])

HSP 1 Score: 69.707 bits (169), Expect = 1.286e-12
Identity = 79/325 (24.31%), Postives = 138/325 (42.46%), Query Frame = 3
Query:  165 LFEFDEVFDANSDNKKVFES-IKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKS-DGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFD-------------PICQKSKYVNLKQYICLSKSSFEHYKKSGDDKRQQKYKGHTIFRVIIELIESNSIDNLK-RSTISNLDFIELNYND-------SGPFVKFICNIQSKEETFENCIS-----------------AVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNP----------IIERFVQH--DENYFINLNTELNEL 983
            ++ FD+VFD  +  + V+ S  K  + +V  G +  I A+G   +GK+HT+ G  S  G+    I+ I   + +   ++  + +SY +I N  I DLL ++   + +  D             PI    + ++L            H+ ++  ++R    + HTIF++ IE  ++N  D+   R+ + NL  ++L  ++        G   K  CNI S        IS                  +L  S  G   T +IC I  + I ET   L  A+ A++ K  P          II+R+ +   +    +N NT++ EL
Sbjct:   41 VYAFDQVFDQITSTEDVYGSFAKPVILSVMEGFNGTIFAYGQTASGKTHTMMGDDSCPGIIPQAIDEIFTYIDQHPNREFCLVVSYMEIYNEVITDLLSTNKKNLKIGEDVKGKVWVKDLTATPINSSEQVMDL----MAQGEKHRHFGQTLMNERSS--RSHTIFQMQIESRDTNEEDDGAVRAALLNL--VDLAGSERVSSTGAEGVRFKEGCNINSSLMALGTVISNLSEGESFIPFRNSKLTRILQNSLGGNAKTGIICTITPAAIDETASTLNFASRAKKIKNKPEINEVLDDASIIKRYKRQIKELEEQLNSNTKIEEL 357          
BLAST of Kinesin-domain-containing protein vs. Ensembl Nematostella
Match: EDO49145 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH21])

HSP 1 Score: 62.7734 bits (151), Expect = 2.912e-10
Identity = 70/300 (23.33%), Postives = 127/300 (42.33%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFESI-KSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-----------GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVA-FDPICQKSKYV--NLKQYICLSKSSFEHYKKSGDDKRQ--------QKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIEL----NYNDSGPFVKFICNIQSKEETF--------------------ENCISAVLYKSYLGLGNTVLICNI--ALSNIKETKQILKLATSARQFKGNPII 920
            F FD+VF  NS    V++++   T+D V +G +  I A+G  G GK++T+ G KS+           G+    ++ + + L  QT  +  +++S+ +I N  + DLL  +     +  F+   +K   V   L++ +   +    +    G  +RQ           + H++F V I  I+ NS++  +   I  L+ ++L    N   SG   K +    +  ++                     E+ ++ +L  S  G   T +I  I  AL NI+ET   L  A  A+     P +
Sbjct:   59 FTFDKVFAPNSKQIDVYKAVVMPTLDEVLQGYNCTIFAYGQTGTGKTYTMEGEKSEENLSWDQDPLAGIIPRTMHQLFERLNSQTDCEFSVRVSFLEIYNEELFDLLSPNFETAKLRLFEDGARKGSVVIQGLEELVVSDRDEVYNILDRGRARRQTAATLMNAHSSRSHSLFSVTIH-IKENSVNGEELLKIGKLNLVDLAGSENVGRSGAVDKRLREAGTINQSLLTLGRVITSLVERAPHVPYRESKLTRLLQDSLGGRTKTSIIATISPALCNIEETLSTLDYAHRAKNILNRPEV 357          
BLAST of Kinesin-domain-containing protein vs. Ensembl Nematostella
Match: EDO47601 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLG6])

HSP 1 Score: 60.077 bits (144), Expect = 5.197e-10
Identity = 40/131 (30.53%), Postives = 69/131 (52.67%), Query Frame = 3
Query:  159 ENLFEFDEVFDANSDNKKVFE-SIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSDGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSL-VTVAFDPICQKSKYV-NLKQYICLS 542
            E  F FD V    + N++V+  + +  VD  F G +  ++A+G  G GK++T+     DG+   +++ +   L K  Q +  + +SY  I   +I DLL S++ L + +  DP  +K  YV NL +Y+  S
Sbjct:    6 ERRFVFDAVLPPAATNRQVYSYAGRPLVDAAFSGFNGTLMAYGQTGTGKTYTMM--SRDGVCMQMVHKLFRRLVKDQQHEYKVCMSYLQIYQEKIYDLLNSNHKLEMVLREDP--KKGVYVENLTEYVVRS 132          
BLAST of Kinesin-domain-containing protein vs. Ensembl Nematostella
Match: EDO49629 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFN0])

HSP 1 Score: 61.6178 bits (148), Expect = 5.754e-10
Identity = 71/302 (23.51%), Postives = 129/302 (42.72%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVFESIKSTV-DNVFRGISANIIAFGMPGNGKSHTL-----FGTKSDGLFNYIINYICDDLRKQTQKDVV---IKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKS--------KYVNLKQYI--CLSKSSFEHYKKSGDDKRQQKYKGHTIFRVIIE----------------LIESNSIDNLKRSTISNLDFIE-LNYNDS----GPFVKFICNIQSKEETF----ENCISAVLYKSYLGLGNTVLICNI--ALSNIKETKQILKLATSARQFKGNPIIERFVQ 935
            F +D VF  +S  K+++  + + + D  F+G +A ++A+G  G+GK+H++       T  D     +I  +  DL +  ++D     +K+S+ +I N  I DLL  S++   +     C+          K V+  Q +  CL   S             +  + H I+ +I+E                L++    + +K++      F E +N N      G  +  + + Q    T     ++ ++ +L  S  G  NT+++  +  A SN +ET   L+ A  AR  K  PII R  Q
Sbjct:   51 FTYDYVFGKSSSQKELYTDVVTPLLDGFFKGYNATVLAYGQTGSGKTHSMGTSFTVCTSDDEDSQGVIPRLIQDLFRHIEQDKCEYSLKVSFLEIHNEEIHDLLNPSSTDERITIRESCEGGIKIAGLMEKKVDSVQDMVQCLELGSASRV-TGATAMNSRSSRSHAIYTIIMEQRGKGIDSDVRKAKFHLVDLAGSERVKKTNAQGERFKEGVNINKGLLCLGNVISALSDEQRNPSTHVPYRDSKLTRLLQDSLGGNSNTLMLACVSPADSNYEETLNTLRYADRARHIKNKPIINRDPQ 351          
BLAST of Kinesin-domain-containing protein vs. Ensembl Medaka
Match: kif4 (chromosome-associated kinesin KIF4 [Source:NCBI gene;Acc:101165832])

HSP 1 Score: 77.0258 bits (188), Expect = 2.758e-14
Identity = 80/304 (26.32%), Postives = 138/304 (45.39%), Query Frame = 3
Query:  156 NENLFEFDEVFDANSDNKKVFES-IKSTVDNVFRGISANIIAFGMPGNGKSHTLFGT--------KSDGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAF--DPICQKSKYVNLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIES-NSIDNLKRSTISNLDFIELNYNDSGPFVK---------------FIC--NI------QSKEETF----ENCISAVLYKSYLGLGNTVLICNI--ALSNIKETKQILKLATSARQFKGNPII 920
             E  F +D VFD  ++ ++VF S +   +  +FRG  A ++A+G  G+GK++++ GT         S G+   +I  I ++  K+T  +  + ISY +I N  I DLL SS    +++   DP     K V L +    S     +  + G+  R            + H IF + +E  +  N +D    S +S L  ++L  ++     K                +C  N+      +SK+ TF    ++ ++ +L  S  G  +T++I  I  A SN++ET   L+ A  AR+ K  PI+
Sbjct:   46 TEKAFTYDYVFDPTAEQEEVFSSAVSPLLRGLFRGYHATVLAYGQTGSGKTYSMGGTYTSAQENDPSVGVIPRVIKKIFEEREKKTDSEFSLSISYLEIYNEDILDLLCSSKDKPSISIREDPK-DGIKIVGLTERQVFSAQEMVNCLELGNAARTVGSTAMNAASSRSHAIFTITLEQRKGLNKVD----SIVSKLHLVDLAGSERQKKTKAEGDRLKEGISINRGLLCLGNVISALGDESKKNTFVPYRDSKLTRLLQDSLGGNSHTLMIACISPADSNMEETINTLRYADRARKIKNKPIV 344          
BLAST of Kinesin-domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000022071.2 (kinesin-like protein KIF3C [Source:NCBI gene;Acc:101173427])

HSP 1 Score: 73.9442 bits (180), Expect = 2.397e-13
Identity = 72/308 (23.38%), Postives = 126/308 (40.91%), Query Frame = 3
Query:  138 KAIFHQNENLFEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD--------GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFD--PICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYNDS-------GPFVKFICNIQSKEETFENCISA------------------VLYKSYLGLGNTVLICNI--ALSNIKETKQILKLATSARQFKGNPII 920
            +A   + +  F FD V+D NS  + ++ ES++  +D+V  G +  I A+G  G GK++T+ G   D          F++I  +I    R Q+ K  +++ SY +I    I+DLL  ++S  T   D     +   YV +L   +C S    E     G+  R        +   + H +F + +E  +    D  K   +  L+ ++L  ++        G  +K    I        N ISA                  +L  S  G   TV++  +  A ++  ET   L+ A  A+  +  P +
Sbjct:   48 RASPSEPQKTFTFDAVYDGNSKQRDLYDESVRPLIDSVLAGFNGTIFAYGQTGTGKTYTMQGAWLDPEKRGVIPNAFDHIFTHIS---RSQSDKQYLVRASYLEIYREEIRDLLDPNHS-TTRGLDLRESPETGVYVQDLTSCVCKSIKEIEEVMNVGNQTRVVGATDMNEHSSRSHALFLITVECSQPGP-DGRKHIRVGRLNLVDLAGSERQAKTGVHGERLKEAAKINLSLSALGNVISALADGRSGHVPYRDSKLTRLLQDSLGGNAKTVMVATLGPAPAHYDETLTTLRYANRAKNIQNQPKV 350          
BLAST of Kinesin-domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000040869.1 (kinesin-like protein KIF3C [Source:NCBI gene;Acc:101173427])

HSP 1 Score: 73.9442 bits (180), Expect = 2.397e-13
Identity = 72/308 (23.38%), Postives = 126/308 (40.91%), Query Frame = 3
Query:  138 KAIFHQNENLFEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD--------GLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFD--PICQKSKYV-NLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYNDS-------GPFVKFICNIQSKEETFENCISA------------------VLYKSYLGLGNTVLICNI--ALSNIKETKQILKLATSARQFKGNPII 920
            +A   + +  F FD V+D NS  + ++ ES++  +D+V  G +  I A+G  G GK++T+ G   D          F++I  +I    R Q+ K  +++ SY +I    I+DLL  ++S  T   D     +   YV +L   +C S    E     G+  R        +   + H +F + +E  +    D  K   +  L+ ++L  ++        G  +K    I        N ISA                  +L  S  G   TV++  +  A ++  ET   L+ A  A+  +  P +
Sbjct:   48 RASPSEPQKTFTFDAVYDGNSKQRDLYDESVRPLIDSVLAGFNGTIFAYGQTGTGKTYTMQGAWLDPEKRGVIPNAFDHIFTHIS---RSQSDKQYLVRASYLEIYREEIRDLLDPNHS-TTRGLDLRESPETGVYVQDLTSCVCKSIKEIEEVMNVGNQTRVVGATDMNEHSSRSHALFLITVECSQPGP-DGRKHIRVGRLNLVDLAGSERQAKTGVHGERLKEAAKINLSLSALGNVISALADGRSGHVPYRDSKLTRLLQDSLGGNAKTVMVATLGPAPAHYDETLTTLRYANRAKNIQNQPKV 350          
BLAST of Kinesin-domain-containing protein vs. Ensembl Medaka
Match: kif3b (kinesin family member 3B [Source:NCBI gene;Acc:101155428])

HSP 1 Score: 67.0106 bits (162), Expect = 2.904e-11
Identity = 72/296 (24.32%), Postives = 119/296 (40.20%), Query Frame = 3
Query:  165 LFEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD----GL----FNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYVNLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYND-------SGPFVKFICNIQSKEETFENCISA------------------VLYKSYLGLGNTVLICNIALS--NIKETKQILKLATSARQFKGNPII 920
            +F FD V+D NS    ++ E+ +  VD+V  G +  I A+G  G GK++T+ G + D    G+    F +I  +I    R Q Q+  ++  SY +I    I+DLL    S      +         +L  ++  S    E+    G+  R        +   + H IF + +E  E   +D      +  L+ ++L  ++        G  +K    I        N ISA                  +L  S  G   TV++ NI  +  N++ET   L+ A  A+  K  P I
Sbjct:   57 VFTFDSVYDWNSKQIDLYDETFRPLVDSVLLGFNGTIFAYGQTGTGKTYTMEGVRKDPERRGVIPNSFEHIFTHIS---RSQNQQ-YLVSASYLEIYQEEIRDLLSKDQSRRLELRERPDVGVHVRDLSSFVTKSVREIENVMNIGNQNRSVGATNMNEHSSRSHAIFVITVECSEMG-VDEENHIRVGKLNLVDLAGSERQSKTGAQGERLKEATKINLSLSALGNVISALVDGRSSHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNVEETLTTLRYANRAKNIKNKPRI 347          
BLAST of Kinesin-domain-containing protein vs. Ensembl Medaka
Match: kif3b (kinesin family member 3B [Source:NCBI gene;Acc:101155428])

HSP 1 Score: 67.0106 bits (162), Expect = 2.904e-11
Identity = 72/296 (24.32%), Postives = 119/296 (40.20%), Query Frame = 3
Query:  165 LFEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD----GL----FNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYVNLKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYND-------SGPFVKFICNIQSKEETFENCISA------------------VLYKSYLGLGNTVLICNIALS--NIKETKQILKLATSARQFKGNPII 920
            +F FD V+D NS    ++ E+ +  VD+V  G +  I A+G  G GK++T+ G + D    G+    F +I  +I    R Q Q+  ++  SY +I    I+DLL    S      +         +L  ++  S    E+    G+  R        +   + H IF + +E  E   +D      +  L+ ++L  ++        G  +K    I        N ISA                  +L  S  G   TV++ NI  +  N++ET   L+ A  A+  K  P I
Sbjct:   57 VFTFDSVYDWNSKQIDLYDETFRPLVDSVLLGFNGTIFAYGQTGTGKTYTMEGVRKDPERRGVIPNSFEHIFTHIS---RSQNQQ-YLVSASYLEIYQEEIRDLLSKDQSRRLELRERPDVGVHVRDLSSFVTKSVREIENVMNIGNQNRSVGATNMNEHSSRSHAIFVITVECSEMG-VDEENHIRVGKLNLVDLAGSERQSKTGAQGERLKEATKINLSLSALGNVISALVDGRSSHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNVEETLTTLRYANRAKNIKNKPRI 347          
BLAST of Kinesin-domain-containing protein vs. Planmine SMEST
Match: SMESG000077277.1 (SMESG000077277.1)

HSP 1 Score: 928.317 bits (2398), Expect = 0.000e+0
Identity = 468/469 (99.79%), Postives = 468/469 (99.79%), Query Frame = 3
Query:  285 MPGNGKSHTLFGTKSDGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYVNLKQYICLSKSSFEHYKKSGDDKRQQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYNDSGPFVKFICNIQSKEETFENCISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPIIERFVQHDENYFINLNTELNELIKICKSEDXXXXXXXXXXSSVQKQEFLKSYHAIELHLVNLRENFCKNDIFSQIIDDIFNDFRNLLFIMEPKNVSMDKNHSFCRKGLLENKLFILGSNLHTLKMKCVPNYLQGENNEGEIKLISPGPDKGNRFDYFVHNNTISPNVSVFSPRNKENQSPVDSYILNVSKFSPFVKAEFPVDVNIATVATVNTRQVTNPEFDTKSYIVSNSMDKSKNSQWKSYVTERVLVKSQSVQTD 1691
            MPGNGKSHTLFGTKSDGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYVNLKQYICLSKSSFEHYKKSGDDKRQQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYNDSGPFVKFICNIQSKEETFENCISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPIIERFVQHDENYFINLNTELNELIKICKSEDNKNNLLLTKLSSVQKQEFLKSYHAIELHLVNLRENFCKNDIFSQIIDDIFNDFRNLLFIMEPKNVSMDKNHSFCRKGLLENKLFILGSNLHTLKMKCVPNYLQGENNEGEIK ISPGPDKGNRFDYFVHNNTISPNVSVFSPRNKENQSPVDSYILNVSKFSPFVKAEFPVDVNIATVATVNTRQVTNPEFDTKSYIVSNSMDKSKNSQWKSYVTERVLVKSQSVQTD
Sbjct:    1 MPGNGKSHTLFGTKSDGLFNYIINYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYVNLKQYICLSKSSFEHYKKSGDDKRQQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYNDSGPFVKFICNIQSKEETFENCISAVLYKSYLGLGNTVLICNIALSNIKETKQILKLATSARQFKGNPIIERFVQHDENYFINLNTELNELIKICKSEDNKNNLLLTKLSSVQKQEFLKSYHAIELHLVNLRENFCKNDIFSQIIDDIFNDFRNLLFIMEPKNVSMDKNHSFCRKGLLENKLFILGSNLHTLKMKCVPNYLQGENNEGEIKFISPGPDKGNRFDYFVHNNTISPNVSVFSPRNKENQSPVDSYILNVSKFSPFVKAEFPVDVNIATVATVNTRQVTNPEFDTKSYIVSNSMDKSKNSQWKSYVTERVLVKSQSVQTD 469          
BLAST of Kinesin-domain-containing protein vs. Planmine SMEST
Match: SMESG000020245.1 (SMESG000020245.1)

HSP 1 Score: 66.2402 bits (160), Expect = 3.983e-11
Identity = 72/293 (24.57%), Postives = 119/293 (40.61%), Query Frame = 3
Query:  168 FEFDEVFDANSDNKKVF-ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSDGLFNYII----NYICDDLRKQTQKDVVIKISYFDIINSRIKDLLGSSNS-LVTVAFDPICQKSKYVN-LKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYND-------SGPFVKFICNIQSKEETFENCISA------------------VLYKSYLGLGNTVLICNIALS--NIKETKQILKLATSARQFKGNPII 920
            F FD V+D NS  K ++ E+ +  V +V  G +  I A+G  G GK+ T+ G K D +   +I    ++I + + + T    +++ SY +I    ++DLL    +  + +   P      YVN L   +  S    E+    G+  R        +   + H IF V IE   +N+ +      +  L+ ++L  ++        G  +K    I        N ISA                  +L  S  G   TV++ NI  +  N  ET   L+ A  A+  K  P I
Sbjct:   38 FTFDAVYDWNSAQKDLYDETFQDLVQSVLEGFNGTIFAYGQTGTGKTFTMQGLKEDPVLKGVIPRSFDHIFNHISRSTDAQYLVRASYLEIYKESVRDLLHKDQTKQLEIKEKPDT--GVYVNDLSSVLTNSCREIENVMNIGNKNRSVGATNMNEHSSRSHAIFIVTIECCRANA-EGENHIRVGKLNMVDLAGSERQSKTHSEGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRLLQDSLGGNAKTVMVANIGPASYNYDETTNTLRYANRAKNIKNKPKI 327          
BLAST of Kinesin-domain-containing protein vs. Planmine SMEST
Match: SMESG000049581.1 (SMESG000049581.1)

HSP 1 Score: 63.5438 bits (153), Expect = 2.888e-10
Identity = 62/233 (26.61%), Postives = 109/233 (46.78%), Query Frame = 3
Query:   78 FKILSKIKPESLTSELEIK--DK-------AIFHQNENLFEFDEVFDANSDNKKVFESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-GLFNYIINYICDDLRK-QTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYVNLKQYICLSKSSFEHYKKSGDDKRQ--------QKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYNDSG 719
            F++L ++KP+   S    K  DK        +   +E  + F+ V    S N+++F+  KS + +   G +   +A+G  G+GK++T+ GT+ D GL    I  + D ++  ++  D+   +   +I N  I DLL    S V ++ D    +   +N KQ    ++     +   G  +R+        Q  + H I R  I L+  N IDN +RS  S+L F +L  ++S 
Sbjct:  375 FRVLCRVKPDVEESSWGFKGNDKIRIPEACQLPRGDEGCYTFNRVLRPESTNREIFDETKSLISSCIDGFNVCFLAYGPTGSGKTYTMQGTREDPGLTLRTIAELSDLIQATKSVWDIQTSVCMIEIHNEVIYDLLSKCISSVRLSDDGCDVRLIDINEKQ--AATEQDLLFWIAKGHKRRKMAATKLNLQSSRSHLIIR--ITLMMQNKIDNSRRS--SSLIFCDLAGSESA 601          
BLAST of Kinesin-domain-containing protein vs. Planmine SMEST
Match: SMESG000022785.1 (SMESG000022785.1)

HSP 1 Score: 56.9954 bits (136), Expect = 4.110e-8
Identity = 59/237 (24.89%), Postives = 106/237 (44.73%), Query Frame = 3
Query:  168 FEFDEVF-DANSDNKK------VFESIK-STVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-GLFNYIINYICDDL--RKQTQKDVVIKISYFDIINSRIKDLL---GSSNSLVTVAFDPICQKSKYVN-LKQYICLSKSSFEHYKKSGDDKR--------QQKYKGHTIFRVIIELIESNSIDNLKRSTISNLDFIELNYNDS-------GPFVKFICNIQSKEETFENCISAV 788
            F FDE F   + DNKK      VF  +    ++N F+G +A I A+G  G+GKS+T+ GT +  G+   + N + D++  R+ +     +++SY +I N ++ DLL   G   SL     + +     YV+ L Q +    +  E     G+  R         +  + H +F +I+     + + ++     S +  ++L  ++        G  ++  CNI     T    ISA+
Sbjct:   62 FGFDECFWSVDPDNKKFASQEVVFSRLGLDVMENAFKGYNACIFAYGQTGSGKSYTMMGTANQPGIIPRLCNSLFDEIAQRESSNLSYKVEVSYMEIYNEKVHDLLDVQGQRKSLRVREHNIL---GPYVDGLSQLVVTCLADIEKLMIEGNKSRTVASTNMNSESSRSHAVFNIILTETIVDPMADVTGEKKSKISLVDLAGSERAQKTGAVGERLREGCNINKSLTTLMLVISAL 295          
BLAST of Kinesin-domain-containing protein vs. Planmine SMEST
Match: SMESG000022785.1 (SMESG000022785.1)

HSP 1 Score: 56.6102 bits (135), Expect = 4.843e-8
Identity = 36/106 (33.96%), Postives = 60/106 (56.60%), Query Frame = 3
Query:  168 FEFDEVF-DANSDNKK------VFESIK-STVDNVFRGISANIIAFGMPGNGKSHTLFGTKSD-GLFNYIINYICDDL--RKQTQKDVVIKISYFDIINSRIKDLL 452
            F FDE F   + DNKK      VF  +    ++N F+G +A I A+G  G+GKS+T+ GT +  G+   + N + D++  R+ +     +++SY +I N ++ DLL
Sbjct:   62 FGFDECFWSVDPDNKKFASQEVVFSRLGLDVMENAFKGYNACIFAYGQTGSGKSYTMMGTANQPGIIPRLCNSLFDEIAQRESSNLSYKVEVSYMEIYNEKVHDLL 167          
The following BLAST results are available for this feature:
BLAST of Kinesin-domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CENPE1.648e-1424.05centromere protein E [Source:HGNC Symbol;Acc:HGNC:... [more]
CENPE1.658e-1424.05centromere protein E [Source:HGNC Symbol;Acc:HGNC:... [more]
CENPE1.728e-1424.05centromere protein E [Source:HGNC Symbol;Acc:HGNC:... [more]
KIF3B8.233e-1424.51kinesin family member 3B [Source:HGNC Symbol;Acc:H... [more]
KIF4A1.471e-1124.07kinesin family member 4A [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Kinesin-domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klp-133.977e-1124.68Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
klp-136.367e-1131.82Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
klp-117.262e-1123.89Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
klp-137.792e-1131.82Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
klp-203.089e-832.67Kinesin-like protein klp-20 [Source:UniProtKB/Swi... [more]
back to top
BLAST of Kinesin-domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmet1.244e-1525.23gene:FBgn0040232 transcript:FBtr0332203[more]
cmet1.255e-1525.23gene:FBgn0040232 transcript:FBtr0332205[more]
cmet1.447e-1525.23gene:FBgn0040232 transcript:FBtr0332204[more]
cmet1.619e-1525.23gene:FBgn0040232 transcript:FBtr0332202[more]
cana5.717e-1524.92gene:FBgn0040233 transcript:FBtr0091678[more]
back to top
BLAST of Kinesin-domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif3b3.758e-1425.25kinesin family member 3B [Source:ZFIN;Acc:ZDB-GENE... [more]
kif3b3.758e-1425.25kinesin family member 3B [Source:ZFIN;Acc:ZDB-GENE... [more]
kif3b3.771e-1425.25kinesin family member 3B [Source:ZFIN;Acc:ZDB-GENE... [more]
cenpe3.093e-1121.93centromere protein E [Source:ZFIN;Acc:ZDB-GENE-060... [more]
kif45.902e-1022.74kinesin family member 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Kinesin-domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
insm24.811e-1224.66insulinoma-associated 2 [Source:Xenbase;Acc:XB-GEN... [more]
insm25.165e-1224.66insulinoma-associated 2 [Source:Xenbase;Acc:XB-GEN... [more]
ENSXETT00000012585.11.092e-1122.54centromere protein E [Source:NCBI gene;Acc:1001266... [more]
ENSXETT00000028811.11.753e-1122.54centromere protein E [Source:NCBI gene;Acc:1001266... [more]
ENSXETT00000012564.11.792e-1123.16centromere protein E [Source:NCBI gene;Acc:1001266... [more]
back to top
BLAST of Kinesin-domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cenpe1.013e-1622.19centromere protein E [Source:MGI Symbol;Acc:MGI:10... [more]
Kif3b4.629e-1424.51kinesin family member 3B [Source:MGI Symbol;Acc:MG... [more]
Kif41.051e-1325.67kinesin family member 4 [Source:MGI Symbol;Acc:MGI... [more]
Kif18a3.136e-1026.30kinesin family member 18A [Source:MGI Symbol;Acc:M... [more]
Kif3c7.740e-1024.52kinesin family member 3C [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Kinesin-domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6RT24|CENPE_MOUSE7.658e-1622.19Centromere-associated protein E OS=Mus musculus OX... [more]
sp|Q02224|CENPE_HUMAN7.962e-1424.05Centromere-associated protein E OS=Homo sapiens OX... [more]
sp|Q61771|KIF3B_MOUSE3.238e-1324.51Kinesin-like protein KIF3B OS=Mus musculus OX=1009... [more]
sp|O15066|KIF3B_HUMAN3.954e-1324.51Kinesin-like protein KIF3B OS=Homo sapiens OX=9606... [more]
sp|P33174|KIF4_MOUSE7.354e-1325.67Chromosome-associated kinesin KIF4 OS=Mus musculus... [more]
back to top
BLAST of Kinesin-domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1V9X5M87.426e-2123.95Kinesin motor domain-containing protein OS=Tropila... [more]
A0A1B6EB688.220e-1625.60Kinesin-like protein (Fragment) OS=Clastoptera ari... [more]
A0A0N4UJM79.857e-1625.86Kinesin-like protein OS=Dracunculus medinensis OX=... [more]
A0A1E1XDK61.546e-1525.77Putative kinesin-like protein (Fragment) OS=Amblyo... [more]
A0A016VXL45.577e-1524.06Kinesin motor domain-containing protein OS=Ancylos... [more]
back to top
BLAST of Kinesin-domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif3b1.790e-1325.25kinesin family member 3B [Source:NCBI gene;Acc:103... [more]
kif46.281e-1123.41kinesin family member 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
cenpe1.384e-1024.14centromere protein E [Source:ZFIN;Acc:ZDB-GENE-060... [more]
kif41.392e-923.08kinesin family member 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
KIF5A1.927e-931.79kinesin family member 5A [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Kinesin-domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif3ca3.328e-1123.05kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000010732.12.818e-922.49pep scaffold:Pmarinus_7.0:GL483624:886:9557:1 gene... [more]
ENSPMAT00000010492.14.344e-927.66pep scaffold:Pmarinus_7.0:GL478879:14589:34633:-1 ... [more]
kif64.500e-932.00kinesin family member 6 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000010733.14.839e-921.99pep scaffold:Pmarinus_7.0:GL483624:1870:9566:1 gen... [more]
back to top
BLAST of Kinesin-domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIP23.214e-1236.28Kinesin-related motor protein involved in mitotic ... [more]
KIP31.777e-1036.04Kinesin-related antiparallel sliding motor protein... [more]
KAR33.927e-730.70Minus-end-directed microtubule motor; functions in... [more]
KIP17.054e-722.98Kinesin-related motor protein; required for mitoti... [more]
SMY11.446e-626.01Kinesin-like myosin passenger-protein; interacts w... [more]
back to top
BLAST of Kinesin-domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO408365.738e-1423.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO313861.286e-1224.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491452.912e-1023.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476015.197e-1030.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496295.754e-1023.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin-domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif42.758e-1426.32chromosome-associated kinesin KIF4 [Source:NCBI ge... [more]
ENSORLT00000022071.22.397e-1323.38kinesin-like protein KIF3C [Source:NCBI gene;Acc:1... [more]
ENSORLT00000040869.12.397e-1323.38kinesin-like protein KIF3C [Source:NCBI gene;Acc:1... [more]
kif3b2.904e-1124.32kinesin family member 3B [Source:NCBI gene;Acc:101... [more]
kif3b2.904e-1124.32kinesin family member 3B [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Kinesin-domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077277.10.000e+099.79SMESG000077277.1[more]
SMESG000020245.13.983e-1124.57SMESG000020245.1[more]
SMESG000049581.12.888e-1026.61SMESG000049581.1[more]
SMESG000022785.14.110e-824.89SMESG000022785.1[more]
SMESG000022785.14.843e-833.96SMESG000022785.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004550 ID=SMED30004550|Name=Kinesin-domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1749bp
TTTCAGTTTAATTTTTAATAATTTTTTCTTTGTAAAGAACTTGTTTAACC
AATTGTTTTTTAAAAAATATGAGTGTGTTTAAAATTTTAAGTAAAATTAA
ACCAGAGTCTTTGACAAGTGAATTGGAAATAAAAGACAAAGCTATTTTTC
ATCAGAATGAAAATTTATTTGAATTTGATGAAGTTTTCGATGCGAATAGC
GACAATAAAAAAGTATTCGAATCGATCAAATCAACAGTAGATAATGTATT
TCGTGGAATTAGTGCGAATATTATTGCATTTGGAATGCCTGGAAATGGCA
AATCTCATACGTTGTTTGGAACTAAATCCGATGGTTTATTTAATTACATT
ATCAATTATATCTGTGATGACCTTCGAAAACAAACACAGAAAGATGTTGT
TATTAAAATTTCATATTTCGATATAATAAATAGTCGTATAAAAGATTTGC
TCGGTTCATCTAATTCACTAGTGACAGTAGCATTTGACCCGATTTGTCAG
AAATCAAAATATGTCAATCTAAAACAATATATTTGTCTTAGTAAAAGTTC
ATTTGAACATTACAAAAAGTCTGGGGATGATAAGAGACAACAAAAATACA
AAGGCCATACAATATTTCGTGTCATTATTGAATTAATAGAATCAAATTCC
ATTGACAACTTGAAAAGATCAACAATTTCTAATTTGGATTTTATCGAATT
GAATTATAACGATTCGGGTCCATTTGTCAAGTTTATTTGCAACATCCAGT
CAAAAGAGGAAACTTTTGAAAATTGTATATCAGCGGTTTTATATAAGTCT
TATCTGGGTCTGGGTAACACTGTGCTGATATGTAACATTGCTCTTTCAAA
TATTAAAGAAACTAAACAAATTCTCAAATTAGCTACTTCTGCAAGACAAT
TCAAAGGCAATCCAATTATAGAACGATTTGTACAACATGATGAAAACTAT
TTTATAAACTTAAACACGGAACTGAATGAACTAATAAAAATCTGTAAATC
GGAAGATAATAAGAATAATCTTCTTTTAACTAAGTTGAGTTCCGTACAGA
AACAAGAATTTCTTAAATCTTATCACGCTATTGAACTGCATCTTGTCAAC
CTTCGTGAGAACTTTTGTAAAAATGACATTTTCTCTCAAATTATCGATGA
TATTTTCAATGATTTTCGAAATTTACTATTTATTATGGAGCCGAAAAATG
TCTCGATGGACAAGAATCATTCATTTTGTAGAAAAGGTTTACTGGAAAAT
AAGTTATTCATTCTTGGAAGTAATTTACACACATTGAAAATGAAATGTGT
GCCGAATTATCTTCAGGGGGAGAATAATGAGGGAGAAATTAAATTAATTT
CTCCAGGGCCCGATAAAGGAAATCGTTTCGATTATTTCGTTCATAATAAT
ACCATTAGTCCGAATGTAAGCGTGTTTTCTCCTCGAAACAAAGAAAACCA
ATCACCAGTGGATTCTTATATTTTGAATGTGTCAAAATTTTCTCCTTTCG
TGAAGGCAGAATTTCCCGTTGATGTGAACATTGCCACGGTGGCAACAGTC
AACACGCGCCAGGTCACTAATCCTGAATTTGATACCAAATCCTATATAGT
CAGCAACTCAATGGACAAATCTAAAAACAGTCAATGGAAATCATATGTCA
CTGAAAGAGTTCTTGTAAAATCCCAATCGGTTCAAACGGATTAGGATTTA
ATTTTGTATTGTAGATTGCAAGATTATGATAACGCTGTGAATGAATGTG
back to top

protein sequence of SMED30004550-orf-1

>SMED30004550-orf-1 ID=SMED30004550-orf-1|Name=SMED30004550-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=542bp
MSVFKILSKIKPESLTSELEIKDKAIFHQNENLFEFDEVFDANSDNKKVF
ESIKSTVDNVFRGISANIIAFGMPGNGKSHTLFGTKSDGLFNYIINYICD
DLRKQTQKDVVIKISYFDIINSRIKDLLGSSNSLVTVAFDPICQKSKYVN
LKQYICLSKSSFEHYKKSGDDKRQQKYKGHTIFRVIIELIESNSIDNLKR
STISNLDFIELNYNDSGPFVKFICNIQSKEETFENCISAVLYKSYLGLGN
TVLICNIALSNIKETKQILKLATSARQFKGNPIIERFVQHDENYFINLNT
ELNELIKICKSEDNKNNLLLTKLSSVQKQEFLKSYHAIELHLVNLRENFC
KNDIFSQIIDDIFNDFRNLLFIMEPKNVSMDKNHSFCRKGLLENKLFILG
SNLHTLKMKCVPNYLQGENNEGEIKLISPGPDKGNRFDYFVHNNTISPNV
SVFSPRNKENQSPVDSYILNVSKFSPFVKAEFPVDVNIATVATVNTRQVT
NPEFDTKSYIVSNSMDKSKNSQWKSYVTERVLVKSQSVQTD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR027640Kinesin-like_fam
IPR001752Kinesin_motor_dom
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
GO:0007059chromosome segregation
GO:0007080mitotic metaphase plate congression
GO:0051315attachment of mitotic spindle microtubules to kinetochore
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003774motor activity
GO:0043515kinetochore binding
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001752Kinesin motor domainSMARTSM00129kinesin_4coord: 1..286
e-value: 1.8E-9
score: -76.6
IPR001752Kinesin motor domainPFAMPF00225Kinesincoord: 18..211
e-value: 1.1E-24
score: 87.0
IPR001752Kinesin motor domainPROSITEPS50067KINESIN_MOTOR_2coord: 1..141
score: 13.086
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 6..292
e-value: 4.9E-32
score: 113.1
IPR027640Kinesin-like proteinPANTHERPTHR24115FAMILY NOT NAMEDcoord: 32..435
NoneNo IPR availablePANTHERPTHR24115:SF557KINESIN-LIKE PROTEINcoord: 32..435
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 29..317